Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30006019
Length (bp)867
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006019

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30006019SMESG000021744.1 PL06004A1A01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 266.159 bits (679), Expect = 3.282e-86
Identity = 139/269 (51.67%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDEIRNG ++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 265.388 bits (677), Expect = 8.655e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 265.388 bits (677), Expect = 9.217e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3E (tubulin alpha 3e [Source:HGNC Symbol;Acc:HGNC:20765])

HSP 1 Score: 265.003 bits (676), Expect = 9.685e-86
Identity = 135/269 (50.19%), Postives = 187/269 (69.52%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAASN+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G  S + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAASNYARGHYTIGKEIVDLVLDRIRKLADLCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 265.003 bits (676), Expect = 1.250e-85
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 282.337 bits (721), Expect = 7.412e-93
Identity = 141/266 (53.01%), Postives = 195/266 (73.31%), Query Frame = 1
Query:   76 F*MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            F M+EVIS+++GQAGVQ+GNA WEL C EHGI   G +  +   D E   TFF  T   RYVPR++FVDLEPTV+DEIR G++K LFHP+++ITG EDAA+N+ARG +TVGK L+ T+ +  RRL +N   +QG F+F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L+++ P++  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    4 FNMREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 269          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-1 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18688])

HSP 1 Score: 281.567 bits (719), Expect = 1.340e-92
Identity = 140/264 (53.03%), Postives = 194/264 (73.48%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQ+GNA WEL C EHGI   G +  +   D E   TFF  T   RYVPR++FVDLEPTV+DEIR G++K LFHP+++ITG EDAA+N+ARG +TVGK L+ T+ +  RRL +N   +QG F+F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L+++ P++  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSDQQADGESFTTFFSDTGNGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLSVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 264          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-7 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:O18154])

HSP 1 Score: 278.1 bits (710), Expect = 2.856e-91
Identity = 140/263 (53.23%), Postives = 192/263 (73.00%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGL-AEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQ+GNA WEL C EHGI   G   EP  +   L TFF  T   R+VPR++FVDLEPTV+DEIR G++K LFHP++++TG EDAA+N+ARG +TVGK ++ T  +  RRL  N + +QG F+F S GGGTG+G TS + + L AEY K +K+E  IYP+P +S+++VEPYN +L  H  +E  D   ++DNEA+YDIC + L ++ PT+  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGILPDGTSMEPDGNSGSLGTFFSDTGYGRHVPRSIFVDLEPTVVDEIRTGAYKKLFHPEQMLTGKEDAANNYARGHYTVGKEIIDTTLDRIRRLANNCEGLQGFFVFHSFGGGTGSGFTSMLMERLSAEYGKKSKLEFSIYPAPQISTSVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLRVSRPTYNNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 263          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 277.715 bits (709), Expect = 4.730e-91
Identity = 139/264 (52.65%), Postives = 192/264 (72.73%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQ+GNA WEL C EHGI   G +  +   + E   TFF  T   RYVPR++FVDLEPTV+DEIR G++K LFHP+++ITG EDAA+N+ARG +TVGK L+ T+ +  RRL +N   +QG F+F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L +  P++  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 264          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 277.715 bits (709), Expect = 4.730e-91
Identity = 139/264 (52.65%), Postives = 192/264 (72.73%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQ+GNA WEL C EHGI   G +  +   + E   TFF  T   RYVPR++FVDLEPTV+DEIR G++K LFHP+++ITG EDAA+N+ARG +TVGK L+ T+ +  RRL +N   +QG F+F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L +  P++  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 264          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 265.003 bits (676), Expect = 4.814e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS++IGQAGVQ+GNA WEL C EHGI   G++   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHM---PSDKTVGGGDDSFSTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 264.618 bits (675), Expect = 8.870e-86
Identity = 135/269 (50.19%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 264.233 bits (674), Expect = 1.137e-85
Identity = 134/269 (49.81%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 243.432 bits (620), Expect = 1.750e-77
Identity = 128/277 (46.21%), Postives = 183/277 (66.06%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPP--------------LDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EV+S+ IGQ G+Q+GNA WEL   EHGIN  G+L+                        TFF  T   + VPR++FVDLEPTVID++RNG  + L+HP++LI+G EDAA+N+ARG +++GK ++  + +  +++ E  D +QG  +F SLGGGTG+G TS + + L+ +Y K  K++  +YPSP +S+A+VEPYN LL  H  M+  D   ++DNEA+YDIC+  L ++ P +  +NRL+AQ+ SS TAS RF   MN D+   QTNLVP+PRIH
Sbjct:    1 MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIH 277          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 239.58 bits (610), Expect = 5.120e-76
Identity = 132/263 (50.19%), Postives = 173/263 (65.78%), Query Frame = 1
Query:   88 EVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYV-PRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAE--YPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            E+I ++IGQAGVQ+ NA WEL C EHGI   G L + P+D   L TFF  TS    V PR + +D EPTVIDEIR GS++ LFHPD LITG +D+ SNFARG+  +   LL    N  RR+ +    ++G  +FR++GGG+G+GL + I + L E    K+T +E  +YPSP++S  +VEPYN LL  HF M+  DV  ++DNEALYDIC+  L +  PT+  +NR++AQ+ SS TAS RF          LQTNLVPYPRIH
Sbjct:    6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMDDSFL-TFFEFTSHQPCVQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIH 267          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l3 (tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-040801-77])

HSP 1 Score: 269.626 bits (688), Expect = 1.181e-87
Identity = 138/269 (51.30%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG QMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC K L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch211-114n24.6 (si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214-26])

HSP 1 Score: 269.24 bits (687), Expect = 1.955e-87
Identity = 138/269 (51.30%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 267.7 bits (683), Expect = 6.307e-87
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG QMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 266.159 bits (679), Expect = 2.665e-86
Identity = 137/269 (50.93%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK L+  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 266.159 bits (679), Expect = 2.665e-86
Identity = 137/269 (50.93%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK L+  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 265.388 bits (677), Expect = 7.846e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 265.388 bits (677), Expect = 7.846e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 265.388 bits (677), Expect = 7.846e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1b (tubulin alpha 4a [Source:NCBI gene;Acc:100038108])

HSP 1 Score: 265.388 bits (677), Expect = 7.846e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 265.388 bits (677), Expect = 8.462e-86
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Gm49450 (predicted gene, 49450 [Source:MGI Symbol;Acc:MGI:6155101])

HSP 1 Score: 265.003 bits (676), Expect = 3.133e-88
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 266.159 bits (679), Expect = 2.253e-86
Identity = 139/269 (51.67%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDEIRNG ++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 265.388 bits (677), Expect = 5.942e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 265.388 bits (677), Expect = 6.193e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 265.003 bits (676), Expect = 8.578e-86
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P34690|TBA2_CAEEL (Tubulin alpha-2 chain OS=Caenorhabditis elegans OX=6239 GN=tba-2 PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 6.017e-90
Identity = 139/264 (52.65%), Postives = 192/264 (72.73%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQ+GNA WEL C EHGI   G +  +   + E   TFF  T   RYVPR++FVDLEPTV+DEIR G++K LFHP+++ITG EDAA+N+ARG +TVGK L+ T+ +  RRL +N   +QG F+F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L +  P++  +NR+++Q+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQSTNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 264          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P49741|TBAA_SCHCO (Tubulin alpha-1A chain OS=Schizophyllum commune OX=5334 GN=TUB-1A PE=3 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 5.350e-89
Identity = 136/265 (51.32%), Postives = 191/265 (72.08%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQE--PPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EV+S+++GQAGVQ+GNA WEL   EHG++  G L +  P    +   TFF  TS  +YVPR+L+VDLEP VIDE+RNG +++LFHP+ +ITG EDAASN+ARG +T+GK  +  + ++ RRL++N + +QG F+F S GGGTG+G  + I + L+ +Y K +K+E  +YP+PTL+S++VEPYN +L  H  +E  D   ++DNEA+YDIC K L I  P    +NRL+AQ+ SSITAS RF+  +N D+   QTNLVP+PRIH
Sbjct:    1 MREVVSIHVGQAGVQIGNACWELYTIEHGLSPDGRLSDDSPSKHDDGFSTFFSETSSGKYVPRSLYVDLEPNVIDEVRNGPYRSLFHPETMITGKEDAASNYARGHYTIGKEQIDVVMDKVRRLVDNCNGLQGFFVFHSFGGGTGSGFGALILERLSTDYGKKSKLEFSVYPAPTLASSVVEPYNSVLTTHTTLEHSDCSFMVDNEAIYDICKKNLNIAQPGLTNLNRLIAQVVSSITASLRFDGSLNVDLNEFQTNLVPFPRIH 265          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P08070|TBA2_CHICK (Tubulin alpha-2 chain OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 274.633 bits (701), Expect = 9.160e-89
Identity = 138/263 (52.47%), Postives = 189/263 (71.86%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS++IGQAGVQ+GNA WEL C EH I   G   +PP   +   TFF  TS ++YVPRA+ VDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK  +  +++  R+L ++   +QG  +F S GGGTG+G TS + + L+ EY K +K+E  IYP+P  SSA+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVP+PRIH
Sbjct:    1 MRECISVHIGQAGVQIGNACWELFCLEHSIQPDGTFSDPPSSDDSFATFFRETSMSKYVPRAIMVDLEPTVVDEVRTGTYRHLFHPEQLITGKEDAANNYARGHYTVGKDKVDMVSDRIRKLADSCSGLQGFLIFHSFGGGTGSGFTSLLMERLSVEYGKKSKLEFAIYPAPQASSAVVEPYNSVLTTHTTLEHSDCVFMVDNEAIYDICHRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPFPRIH 263          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P30436|TBA_ONCKE (Tubulin alpha chain OS=Oncorhynchus keta OX=8018 PE=2 SV=2)

HSP 1 Score: 271.166 bits (692), Expect = 1.861e-87
Identity = 138/269 (51.30%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIEC------LETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQAGVQMGNA WEL C EHGI   G +   P D  C        TFF  T   ++VPRA+FVDLEPTVIDE+R G ++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  P++  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MREVISMHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTCGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGIYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDIVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q43473|TBA1_HORVU (Tubulin alpha-1 chain OS=Hordeum vulgare OX=4513 GN=TUBA1 PE=2 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 2.930e-87
Identity = 139/269 (51.67%), Postives = 192/269 (71.38%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E+IS++IGQAG+Q+GNA WEL C EHGIN  G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LI+G EDAA+NFARG +TVGK ++    +  R+L +N   +QG  +F ++GGGTG+GL S + + L+ +Y K +K+   IYPSP +S+A+VEPYN +L  H  +E  DV +LLDNEA+YDIC + L I  PT+  +NRL++Q+ SS+T S RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MREIISIHIGQAGIQVGNACWELYCLEHGINQDGTM---PSDTTVGVAHDAFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGAYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0R3X4B4 (Tubulin alpha chain OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8226 PE=3 SV=2)

HSP 1 Score: 337.035 bits (863), Expect = 9.520e-111
Identity = 163/262 (62.21%), Postives = 216/262 (82.44%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQ GVQ+GNA+WEL CAEH +++ G L E P ++E +ETFF ++   RYVPR LFVDLE +VIDEIR G ++ LFHPD+LITG EDA++NFARG+FT+GK+LL  I NE RR +E  D +QGI  FRSLGGGTGAGLT+A+ D L +Y K TK+E+PIYPSP+LS+A++EPYNCLLGEHF MED ++GLL+DNEA+YD+CS++L+ +Y T+  INRL A +CS++TAS RF++V+  D+ V+QTNL+PYPRIH
Sbjct:    1 MREVISIHVGQCGVQIGNAVWELYCAEHAVSNEGALFEQPHELEWVETFFNISEQGRYVPRCLFVDLEASVIDEIRVGPWRKLFHPDKLITGYEDASNNFARGYFTIGKVLLSPILNEVRRTVEQCDSLQGILFFRSLGGGTGAGLTAALLDVLGDYRKYTKVEIPIYPSPSLSNALIEPYNCLLGEHFTMEDFNIGLLMDNEAMYDVCSRFLSSSYTTYTKINRLAAIVCSAVTASLRFKNVLTSDLNVMQTNLIPYPRIH 262          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A068X2V6 (Tubulin alpha chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000735000 PE=3 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.054e-110
Identity = 161/262 (61.45%), Postives = 217/262 (82.82%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQ GVQ+GNA+WEL CAEH +++ G+L E P ++E +ETFF ++   RYVPR LFVDLE +VIDE+R G ++ LFHPD+LITG EDA++NFARG+FT+GK+LL  + NE RR +E  D +QGI  FRSLGGGTGAGLT+A+ D L +Y K TK+E+PIYPSP+LS+A++EPYNCLLGEHF MED ++GLL+DNEA+YD+CS++L+ +Y T+  INRL A +CS++TAS RF++V+  D+ V+QTNL+PYPRIH
Sbjct:    1 MREVISIHVGQCGVQIGNAVWELYCAEHAVSNEGSLFEQPHELEWVETFFNISEQGRYVPRCLFVDLEASVIDEVRVGPWRKLFHPDKLITGYEDASNNFARGYFTIGKVLLSPVLNEVRRTIEQCDSLQGILFFRSLGGGTGAGLTAALLDVLGDYRKYTKVEIPIYPSPSLSTALIEPYNCLLGEHFTMEDFNIGLLMDNEAMYDVCSRFLSSSYTTYTKINRLAAIVCSAVTASLRFKNVLTSDLNVMQTNLIPYPRIH 262          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A068Y4T6 (Tubulin alpha chain OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000735000 PE=3 SV=1)

HSP 1 Score: 337.421 bits (864), Expect = 4.210e-110
Identity = 162/262 (61.83%), Postives = 217/262 (82.82%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQ GVQ+GNA+WEL CAEH +++ G+L E P ++E +ETFF ++   RYVPR LFVDLE +VIDE+R G ++ LFHPD+LITG EDA++NFARG+FT+GK+LL  I NE RR +E  D +QGI  FRSLGGGTGAGLT+A+ D L +Y K TK+E+PIYPSP+LS+A++EPYNCLLGEHF MED ++GLL+DNEA+YD+CS++L+ +Y T+  INRL A +CS++TAS RF++V+  D+ V+QTNL+PYPRIH
Sbjct:    1 MREVISIHVGQCGVQIGNAVWELYCAEHAVSNEGSLFEQPHELEWVETFFNISEQGRYVPRCLFVDLEASVIDEVRVGPWRKLFHPDKLITGYEDASNNFARGYFTIGKVLLSPILNEVRRTIEQCDSLQGILFFRSLGGGTGAGLTAALLDVLGDYRKYTKVEIPIYPSPSLSTALIEPYNCLLGEHFTMEDFNIGLLMDNEAMYDVCSRFLSSSYTTYTKINRLAAIVCSAVTASLRFKNVLTSDLNVMQTNLIPYPRIH 262          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0R3TWS5 (Tubulin alpha chain OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12298 PE=3 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 5.332e-110
Identity = 166/262 (63.36%), Postives = 210/262 (80.15%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MKEVIS+++GQ GVQ+GNA+WEL CAEH +   G+L E P D E +ETFF L+   RYVPR LF+DLEP+VIDEIR G +++LFHPD+LITG EDAA+NFARG+FTVGK+LL  I NE RR +E  D +QG+  FRSLGGGTGAGLT+AI D L +Y K TK+E+PIYP+P+LS A+VEPYNC+ GEHF MED ++GLL+DNEALYD+CS++L+  Y T+  INRL A + S+ITAS RF++ +  D+ V QTNL+PYPRIH
Sbjct:    1 MKEVISIHVGQCGVQVGNAVWELYCAEHAVKTDGSLYEHPHDQEWVETFFNLSEKGRYVPRCLFIDLEPSVIDEIRVGPWRSLFHPDKLITGYEDAANNFARGYFTVGKVLLSPILNEVRRTIEQCDGLQGLLFFRSLGGGTGAGLTAAILDVLGDYRKYTKVEIPIYPAPSLSPAVVEPYNCIFGEHFAMEDFNMGLLMDNEALYDVCSRFLSSRYTTYTKINRLTAIVVSAITASLRFKNTLMADLNVTQTNLIPYPRIH 262          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0R3W9Z7 (Tubulin alpha chain OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7321 PE=3 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 7.562e-110
Identity = 162/262 (61.83%), Postives = 216/262 (82.44%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+++GQ GVQ+GNA+WEL CAEH +++ G L E P ++E +ETFF ++   RYVPR LFVDLE +VIDE+R G ++ LFHPD+LITG EDA++NFARG+FT+GK+LL  I NE RR +E  D +QGI  FRSLGGGTGAGLT+A+ D L +Y K TK+E+PIYPSP+LS+A++EPYNCLLGEHF MED ++GLL+DNEA+YD+CS++L+ +Y T+  INRL A +CS++TAS RF++V+  D+ V+QTNL+PYPRIH
Sbjct:    1 MREVISIHVGQCGVQIGNAVWELYCAEHAVSNEGALFEQPHELEWVETFFNISEQGRYVPRCLFVDLEASVIDEVRVGPWRKLFHPDKLITGYEDASNNFARGYFTIGKVLLSPILNEVRRTVEQCDSLQGILFFRSLGGGTGAGLTAALLDVLGDYRKYTKVEIPIYPSPSLSTALIEPYNCLLGEHFTMEDFNIGLLMDNEAMYDVCSRFLSSSYTTYTKINRLAAIVCSAVTASLRFKNVLTSDLNVMQTNLIPYPRIH 262          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 270.011 bits (689), Expect = 6.499e-88
Identity = 139/269 (51.67%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG QMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDEIR G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC K L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch211-114n24.6 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:103034569])

HSP 1 Score: 268.855 bits (686), Expect = 1.693e-87
Identity = 138/269 (51.30%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622])

HSP 1 Score: 268.085 bits (684), Expect = 3.522e-87
Identity = 135/265 (50.94%), Postives = 189/265 (71.32%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL--QEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG Q+GNA WEL C EHGI   G++  ++ P   +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC K L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGAQIGNACWELYCLEHGIQPDGHMPSEKIPRGDDSFNTFFSETGTGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEVIDAVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 265          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000030346.1 (tubulin alpha-1B chain [Source:NCBI gene;Acc:111195381])

HSP 1 Score: 265.388 bits (677), Expect = 4.820e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 265.003 bits (676), Expect = 5.302e-86
Identity = 133/266 (50.00%), Postives = 190/266 (71.43%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNL-QEPPL--DIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGN  WEL C EHGI   G +  + P+    +   TFF  T   +YVPRA+FVDLEPTVIDE+R G+++ LFHP++LI+G EDAA+N+ARG +T+GK ++ ++ +  R+L +    +QG  +F S GGGTG+G TS + + L+ ++ K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  P++  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSQKPVGGHDDSFTTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 263.462 bits (672), Expect = 2.301e-87
Identity = 135/269 (50.19%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.305 bits (534), Expect = 1.730e-66
Identity = 122/270 (45.19%), Postives = 167/270 (61.85%), Query Frame = 1
Query:   85 KEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI-----ECLETFFGLTSGARYVPRALFVDLEPTVIDE---IRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGL-AEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            ++ IS++IGQAGVQMGNA WEL C EHGI   G+L   P D+         TFF  T   ++VPRA+F+DLEP+VI E   +R  +         ++ G E  +S   RG    G+ +   +    R   E    +QG  LF S GGGTG+G TS + + L A+Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC K L I++P++  +NRL+AQ+ SSITAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    3 RDCISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHP-DVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIH 271          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 169.474 bits (428), Expect = 1.547e-50
Identity = 94/245 (38.37%), Postives = 144/245 (58.78%), Query Frame = 1
Query:  142 WELLCAEHGINDCGNLQ-EPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAE--YPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            WE++  EHGI+  G+   +  L +E +  ++   SG +YVPRA+ VDLEP  +D +R+G F  +F PD  + G   A +N+A+G +T G  L+ ++ +  R+  E+ DC+QG  L  SLGGGTG+G+ + +   + E    ++    V   PSP +S  +VEPYN  L  H  +E+ D    +DNEALYDIC + L +  PT+  +N LV+   S +T   RF   +N D+  L  N+VP+PR+H
Sbjct:    3 WEVISDEHGIDPTGSYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLH 247          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005307.1 (pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 gene:ENSPMAG00000004835.1 transcript:ENSPMAT00000005307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.035 bits (336), Expect = 9.545e-40
Identity = 61/128 (47.66%), Postives = 88/128 (68.75%), Query Frame = 1
Query:   85 KEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPL---DIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENS 459
            +E IS+++GQAGVQ+GNA WEL C EHGI   G +          +   TFF  T   ++VPRA+FVDLEPTV+  +R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L+  S
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSEKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVGAVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLVSGS 129          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 127.487 bits (319), Expect = 4.326e-34
Identity = 86/269 (31.97%), Postives = 141/269 (52.42%), Query Frame = 1
Query:   85 KEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLD-IECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPED--AASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEY----PKITKIEVPIYPSP-TLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            +E+I+L +GQ G Q+G   W+ LCAEHGI+  G L++   +  +  + FF       Y+PRA+ +DLEP VI+ I N S+  L++P+ +        A +N+A G  + G+ +   I +   R  + SD ++   L R L            ++ L +Y    PK       ++P+   +S  +V+PYN LL      ++ D  ++LDN AL  I +  L I  P+F  IN+LV+ + S+ T + R+   MN D+  L  +L+P PR+H
Sbjct:    3 REIITLQLGQCGNQIGFEFWKQLCAEHGISPDGILEDFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGH-SQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATN--------WNELCKYFCRFPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLH 262          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 257.299 bits (656), Expect = 6.802e-84
Identity = 127/267 (47.57%), Postives = 180/267 (67.42%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQE----PPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQG-IFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+ +GQAG Q+GNA WEL   EHGI   G+L++    P    E   TFF  T   ++VPRA++VDLEP VIDE+RNG +K LFHP++LI+G EDAA+N+ARG +TVG+ +LG + +  R+L +  D +QG +F     GG      +  + +  AEY K +K+E  +YP+P +S+++VEPYN +L  H  +E  D   ++DNEA+YD+C + L I  P+F  +N L+AQ+ SS+TAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIH 267          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 256.529 bits (654), Expect = 1.284e-83
Identity = 133/267 (49.81%), Postives = 185/267 (69.29%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQE----PPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+EVIS+ +GQAG Q+GNA WEL   EHGI + G+L++    P    E   TFF  T   ++VPRA++VDLEP VIDE+R G FK LFHP++LI G EDAA+N+ARG +TVG+ ++  +    R++ +  D +QG     SLGGGTG+GL S + + L+ EY K +K+E  +YP+P LS+++VEPYN +L  H  +E  D   ++DNEA+YDIC + L I+ P+F  +N L+AQ+ SS+TAS RF+  +N D+   QTNLVPYPRIH
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIH 267          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 184.111 bits (466), Expect = 1.817e-55
Identity = 102/264 (38.64%), Postives = 150/264 (56.82%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQ-EPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGL-AEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E+I +  GQ G Q+G A WE +C EHG++  G       +  E L  +F   S  ++VPR++ VDLEP  ID +RN +   LF PD  I G   A + +A+G +T G  L+ ++ +  RR  E  D +QG  +  SLGGGTG+G+ + +   +  E+P        + PSP  S  +VEPYN  L  H  +E  D    +DNEALYDIC + L +N P++  +N LV+ + S +T S R+   +N D+  L  NLVP+PR+H
Sbjct:    1 MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLH 264          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 100.908 bits (250), Expect = 1.353e-24
Identity = 80/266 (30.08%), Postives = 136/266 (51.13%), Query Frame = 1
Query:   88 EVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIEC---LETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAAS--NFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAE-YPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            E+I+L  GQ G  +G  +W  L  EH I   G  Q P    E     + FF   S  ++ PRA+ +D EP+VI ++ N +F+  F P       + A++  ++A G+  +G      I N+  + ++++D  +G  L  S+ GGTG+GL S + + L + YPK       ++P+ + S  +V+ YN +L     +ED D  ++ DN +L +I  K            N+L++ + SS+T S RF S M   ++ + + L+P P +H
Sbjct:    4 EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFTPRAIMMDSEPSVIADVEN-TFRGFFDPRNTWVASDGASAGNSWANGY-DIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPARS-SEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELH 266          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S698])

HSP 1 Score: 266.929 bits (681), Expect = 3.482e-87
Identity = 139/269 (51.67%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK  +  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +SSA+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++QL SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDAFNTFFAETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEQIDIVLDRLRKLADGCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPHISSAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQLVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO46332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB6])

HSP 1 Score: 266.929 bits (681), Expect = 3.497e-87
Identity = 132/266 (49.62%), Postives = 189/266 (71.05%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIEC---LETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E +S+++GQAGVQ+GNA WEL C EHGI   G++        C     TFF  T+  ++VPRA+FVDLEPTVIDEIR G+++ LFHP++++TG EDAA+N+ARG +TVGK L+  + ++ R+L +    +QG  +F S GGGTG+G +S + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SS+TAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDGHMPSDQSADRCDDSFSTFFSETASGKHVPRAVFVDLEPTVIDEIRTGTYRQLFHPEQMVTGKEDAANNYARGHYTVGKELIDVVLDKIRKLADQCTGLQGFLVFHSFGGGTGSGFSSLLMERLSVDYGKRSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSVTASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY3])

HSP 1 Score: 266.159 bits (679), Expect = 9.205e-87
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK L+  + +  R+L +    +QG  +F S GGGTG+G +S + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38091 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY0])

HSP 1 Score: 266.159 bits (679), Expect = 9.305e-87
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK L+  + +  R+L +    +QG  +F S GGGTG+G +S + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S699])

HSP 1 Score: 265.774 bits (678), Expect = 1.106e-86
Identity = 135/269 (50.19%), Postives = 187/269 (69.52%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+F DLEPTV+DE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK ++  + +  R+L +    +QG  +F S GGGTG+G +S + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFADLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEMIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 268.085 bits (684), Expect = 3.900e-87
Identity = 137/269 (50.93%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG QMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +TVGK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGRM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba8l3 (tubulin alpha chain [Source:NCBI gene;Acc:101168255])

HSP 1 Score: 267.7 bits (683), Expect = 4.566e-87
Identity = 136/269 (50.56%), Postives = 188/269 (69.89%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAG QMGNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + + TR+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  +YP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL+ Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020148.2 (protein O-fucosyltransferase 2 [Source:NCBI gene;Acc:100125468])

HSP 1 Score: 266.929 bits (681), Expect = 2.746e-86
Identity = 134/266 (50.38%), Postives = 191/266 (71.80%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGN-LQEPPL--DIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQMGN  WEL C EHGI   G  L + P+    +   TFF  T   +YVPRA+FVDLEPTVIDE+R+G+++ LFHP++LI+G EDAA+N+ARG +T+G+ ++ ++ +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  P++  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:   33 MRECISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMLTQKPIGGHDDSFTTFFSETGAKKYVPRAIFVDLEPTVIDEVRSGTYRQLFHPEQLISGKEDAANNYARGHYTIGREIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 298          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000033163.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 265.388 bits (677), Expect = 4.441e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020578.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 265.388 bits (677), Expect = 4.441e-86
Identity = 136/269 (50.56%), Postives = 189/269 (70.26%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI------ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLA-EYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            M+E IS+++GQAGVQ+GNA WEL C EHGI   G +   P D       +   TFF  T   ++VPRA+FVDLEPTVIDE+R G+++ LFHP++LITG EDAA+N+ARG +T+GK ++  + +  R+L +    +QG  +F S GGGTG+G TS + + L+ +Y K +K+E  IYP+P +S+A+VEPYN +L  H  +E  D   ++DNEA+YDIC + L I  PT+  +NRL++Q+ SSITAS RF+  +N D+T  QTNLVPYPRIH
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQM---PSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIH 266          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000021744.1 (SMESG000021744.1)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 262/262 (100.00%), Postives = 262/262 (100.00%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRSLGGGTGAGLTSAIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH
Sbjct:    1 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRSLGGGTGAGLTSAIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 262          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000006907.1 (SMESG000006907.1)

HSP 1 Score: 367.081 bits (941), Expect = 1.005e-125
Identity = 183/263 (69.58%), Postives = 222/263 (84.41%), Query Frame = 1
Query:   82 MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDI-ECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MKEV+SL+IGQAGVQMGN++WEL CAEH + + G+L  P + + E +E FF      +Y+PR LFVDLEPTV+DEIR G+F+ LFHPDRL+ GPEDAASNFARGFFT+GKLLL  IN+E R++ E++DC+QGI LFRSLGGGTGAGLTSAIFDGL+EYPK  KI++PIYPSP LS++ VEPYN +L EHFCMEDVDVGLL DNEALYDIC+++L +  PT+  INRLV+QLCS ITAS RF +++NCD+TVLQTNLVPYPRIH
Sbjct:    1 MKEVLSLHIGQAGVQMGNSLWELFCAEHCVTESGDLFSPEMYLSEKIEAFFTANLIPKYIPRCLFVDLEPTVVDEIRLGTFRLLFHPDRLMAGPEDAASNFARGFFTIGKLLLSKINHEVRKMFESADCVQGIMLFRSLGGGTGAGLTSAIFDGLSEYPKTPKIDIPIYPSPALSTSTVEPYNSILAEHFCMEDVDVGLLFDNEALYDICTRFLGVTDPTYGVINRLVSQLCSCITASIRFHNILNCDLTVLQTNLVPYPRIH 263          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000031184.1 (SMESG000031184.1)

HSP 1 Score: 369.777 bits (948), Expect = 1.107e-124
Identity = 181/247 (73.28%), Postives = 214/247 (86.64%), Query Frame = 1
Query:  127 MGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MGN+IWELL  EHGI+  G L+EP   IE +++FF L+   +YVPR++FVDLE TVIDE+R GS++  FHPDRL++GPEDAASNFARGFFTVGKLLLG I++E R+LLE   C   IF+FRSLGGGTG+GLTSAIFD L EYPK+TKIE+PIYPSPTLS+AMVEPYNCLL EHFCMED+DVGLL+DNEALYD+CSKYL+I++ ++ TINRL+ QL SSITAS RFESVMNCDI+VLQTNLVPYPRIH
Sbjct:    1 MGNSIWELLSTEHGIDASGLLKEPSFQIESVDSFFALSHANKYVPRSIFVDLEATVIDEVRTGSYRKFFHPDRLVSGPEDAASNFARGFFTVGKLLLGVISHEIRKLLETGTCTNAIFIFRSLGGGTGSGLTSAIFDSLIEYPKLTKIEMPIYPSPTLSTAMVEPYNCLLSEHFCMEDIDVGLLIDNEALYDVCSKYLSISHASYNTINRLIGQLTSSITASVRFESVMNCDISVLQTNLVPYPRIH 247          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000031184.1 (SMESG000031184.1)

HSP 1 Score: 369.392 bits (947), Expect = 1.402e-124
Identity = 181/247 (73.28%), Postives = 214/247 (86.64%), Query Frame = 1
Query:  127 MGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MGN+IWELL  EHGI+  G L+EP   IE +++FF L+   +YVPR++FVDLE TVIDE+R GS++  FHPDRL++GPEDAASNFARGFFTVGKLLLG I++E R+LLE   C   IF+FRSLGGGTG+GLTSAIFD L EYPK+TKIE+PIYPSPTLS+AMVEPYNCLL EHFCMED+DVGLL+DNEALYD+CSKYL+I++ ++ TINRL+ QL SSITAS RFESVMNCDI+VLQTNLVPYPRIH
Sbjct:    1 MGNSIWELLSTEHGIDASGLLKEPSFQIESVDSFFALSHANKYVPRSIFVDLEATVIDEVRTGSYRKFFHPDRLVSGPEDAASNFARGFFTVGKLLLGVISHEIRKLLETGTCTNAIFIFRSLGGGTGSGLTSAIFDSLIEYPKLTKIEMPIYPSPTLSTAMVEPYNCLLSEHFCMEDIDVGLLIDNEALYDVCSKYLSISHASYNTINRLIGQLTSSITASVRFESVMNCDISVLQTNLVPYPRIH 247          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000044805.1 (SMESG000044805.1)

HSP 1 Score: 369.777 bits (948), Expect = 2.012e-124
Identity = 181/247 (73.28%), Postives = 214/247 (86.64%), Query Frame = 1
Query:  127 MGNAIWELLCAEHGINDCGNLQEPPLDIECLETFFGLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNFARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRXXXXXXXXXXXXXIFDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLLDNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITVLQTNLVPYPRIH 867
            MGN+IWELL  EHGI+  G L+EP   IE +++FF L+   +YVPR++FVDLE TVIDE+R GS++  FHPDRL++GPEDAASNFARGFFTVGKLLLG I++E R+LLE   C   IF+FRSLGGGTG+GLTSAIFD L EYPK+TKIE+PIYPSPTLS+AMVEPYNCLL EHFCMED+DVGLL+DNEALYD+CSKYL+I++ ++ TINRL+ QL SSITAS RFESVMNCDI+VLQTNLVPYPRIH
Sbjct:    1 MGNSIWELLSTEHGIDASGLLKEPSFQIESVDSFFALSHANKYVPRSIFVDLEATVIDEVRTGSYRKFFHPDRLVSGPEDAASNFARGFFTVGKLLLGVISHEIRKLLETGTCTNAIFIFRSLGGGTGSGLTSAIFDSLIEYPKLTKIEMPIYPSPTLSTAMVEPYNCLLSEHFCMEDIDVGLLIDNEALYDVCSKYLSISHASYNTINRLIGQLTSSITASVRFESVMNCDISVLQTNLVPYPRIH 247          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA4A3.282e-8651.67tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA1B8.655e-8650.56tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
TUBA1C9.217e-8650.56tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA3E9.685e-8650.19tubulin alpha 3e [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1A1.250e-8550.56tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-17.412e-9353.01Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-11.340e-9253.03Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-72.856e-9153.23Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-24.730e-9152.65Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-24.730e-9152.65Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub85E4.814e-8650.56gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84B8.870e-8650.19gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub84D1.137e-8549.81gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C1.750e-7746.21gene:FBgn0087040 transcript:FBtr0076393[more]
CG77945.120e-7650.19gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l31.181e-8751.30tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch211-114n24.61.955e-8751.30si:ch211-114n24.6 [Source:ZFIN;Acc:ZDB-GENE-120214... [more]
tuba8l46.307e-8750.56tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba1b2.665e-8650.93tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
tuba1b2.665e-8650.93tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1b7.846e-8650.56tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b7.846e-8650.56tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b7.846e-8650.56tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
tuba1b7.846e-8650.56tubulin alpha 4a [Source:NCBI gene;Acc:100038108][more]
pex18.462e-8650.56peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm494503.133e-8850.56predicted gene, 49450 [Source:MGI Symbol;Acc:MGI:6... [more]
Tuba4a2.253e-8651.67tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b5.942e-8650.56tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba1c6.193e-8650.56tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1a8.578e-8650.56tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34690|TBA2_CAEEL6.017e-9052.65Tubulin alpha-2 chain OS=Caenorhabditis elegans OX... [more]
sp|P49741|TBAA_SCHCO5.350e-8951.32Tubulin alpha-1A chain OS=Schizophyllum commune OX... [more]
sp|P08070|TBA2_CHICK9.160e-8952.47Tubulin alpha-2 chain OS=Gallus gallus OX=9031 PE=... [more]
sp|P30436|TBA_ONCKE1.861e-8751.30Tubulin alpha chain OS=Oncorhynchus keta OX=8018 P... [more]
sp|Q43473|TBA1_HORVU2.930e-8751.67Tubulin alpha-1 chain OS=Hordeum vulgare OX=4513 G... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3X4B49.520e-11162.21Tubulin alpha chain OS=Hydatigena taeniaeformis OX... [more]
A0A068X2V62.054e-11061.45Tubulin alpha chain OS=Echinococcus granulosus OX=... [more]
A0A068Y4T64.210e-11061.83Tubulin alpha chain OS=Echinococcus multilocularis... [more]
A0A0R3TWS55.332e-11063.36Tubulin alpha chain OS=Rodentolepis nana OX=102285... [more]
A0A0R3W9Z77.562e-11061.83Tubulin alpha chain OS=Taenia asiatica OX=60517 GN... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042562.16.499e-8851.67tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
si:ch211-114n24.61.693e-8751.30tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
si:ch73-199e17.13.522e-8750.94tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000030346.14.820e-8650.56tubulin alpha-1B chain [Source:NCBI gene;Acc:11119... [more]
tuba8l25.302e-8650.00tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C2.301e-8750.19tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.730e-6645.19pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb21.547e-5038.37tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005307.19.545e-4047.66pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 ... [more]
tubg14.326e-3431.97tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB16.802e-8447.57Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB31.284e-8349.81Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB21.817e-5538.64Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB41.353e-2430.08Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407793.482e-8751.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463323.497e-8749.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380679.205e-8750.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380919.305e-8750.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407801.106e-8650.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003572.23.900e-8750.93tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
tuba8l34.566e-8750.56tubulin alpha chain [Source:NCBI gene;Acc:10116825... [more]
ENSORLT00000020148.22.746e-8650.38protein O-fucosyltransferase 2 [Source:NCBI gene;A... [more]
ENSORLT00000033163.14.441e-8650.56tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020578.24.441e-8650.56tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000021744.10.000e+0100.00SMESG000021744.1[more]
SMESG000006907.11.005e-12569.58SMESG000006907.1[more]
SMESG000031184.11.107e-12473.28SMESG000031184.1[more]
SMESG000031184.11.402e-12473.28SMESG000031184.1[more]
SMESG000044805.12.012e-12473.28SMESG000044805.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006019 ID=SMED30006019|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=867bp
CTATTCTAAAATAGATTACAGATAATAATTGATCCGATTTCAAATTTCAA
ATGTACATTTACTAGAAAGTAGCAATTTTAAATGAAGGAAGTTATAAGCT
TATATATTGGTCAAGCTGGCGTCCAAATGGGAAATGCCATATGGGAGTTG
CTTTGCGCCGAACATGGAATAAATGATTGTGGCAATTTACAGGAGCCGCC
ATTAGATATAGAATGCCTGGAAACATTTTTTGGATTAACTTCTGGAGCAA
GATATGTTCCCAGAGCTTTATTTGTCGACTTGGAGCCAACAGTAATTGAC
GAAATAAGAAATGGCTCATTTAAAGCGTTATTTCATCCAGATCGACTTAT
AACTGGCCCTGAAGATGCTGCCAGTAATTTTGCCAGAGGATTTTTTACAG
TGGGAAAACTTCTTTTGGGCACAATTAATAATGAAACAAGAAGACTTCTT
GAAAACAGTGATTGTATTCAAGGTATATTTTTGTTTAGGTCTTTAGGTGG
TGGAACTGGAGCTGGATTGACATCTGCTATTTTTGATGGTTTAGCCGAAT
ACCCGAAAATCACTAAAATTGAAGTTCCTATTTATCCTTCACCTACTCTA
TCTTCAGCGATGGTTGAACCTTACAATTGTTTATTAGGGGAACACTTTTG
TATGGAGGATGTCGATGTAGGACTTTTATTAGACAATGAAGCATTATATG
ATATATGCTCGAAATATTTAACTATAAATTATCCGACATTTTGTACAATT
AACCGTCTTGTTGCTCAACTTTGTAGCTCTATAACAGCATCAGCCAGATT
TGAAAGTGTTATGAATTGTGATATTACAGTTCTACAAACTAATTTAGTTC
CATATCCAAGAATTCAT
back to top

protein sequence of SMED30006019-orf-1

>SMED30006019-orf-1 ID=SMED30006019-orf-1|Name=SMED30006019-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=262bp
MKEVISLYIGQAGVQMGNAIWELLCAEHGINDCGNLQEPPLDIECLETFF
GLTSGARYVPRALFVDLEPTVIDEIRNGSFKALFHPDRLITGPEDAASNF
ARGFFTVGKLLLGTINNETRRLLENSDCIQGIFLFRSLGGGTGAGLTSAI
FDGLAEYPKITKIEVPIYPSPTLSSAMVEPYNCLLGEHFCMEDVDVGLLL
DNEALYDICSKYLTINYPTFCTINRLVAQLCSSITASARFESVMNCDITV
LQTNLVPYPRIH
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR002452Alpha_tubulin
IPR000217Tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR017975Tubulin_CS
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000217TubulinPRINTSPR01161TUBULINcoord: 92..103
score: 53.64
coord: 105..129
score: 26.89
coord: 149..170
score: 26.03
coord: 131..149
score: 51.47
coord: 188..208
score: 50.69
coord: 10..30
score: 61.46
coord: 50..69
score: 55.55
coord: 174..187
score: 51.15
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..262
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 157..168
score: 40.06
coord: 117..125
score: 29.6
coord: 42..55
score: 29.47
coord: 210..222
score: 28.57
coord: 18..33
score: 60.98
coord: 85..98
score: 66.03
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 46..242
e-value: 6.6E-35
score: 132.0
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..209
e-value: 4.1E-53
score: 180.5
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..262
e-value: 1.3E-89
score: 302.2
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..240
NoneNo IPR availablePANTHERPTHR11588:SF304AT04270P-RELATEDcoord: 2..262
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 139..145