SMED30006006

Overview
NameSMED30006006
Smed IDSMED30006006
Length (bp)909
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30006006 (SMED30006006) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30006006 (SMED30006006) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30006006 (SMED30006006) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30006006 (SMED30006006) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006006

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30006006SMESG000007018.1 SMESG000007017.1 SmedASXL_015004SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v6_1969_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30006006SMESG000007018.1 SMESG000007017.1 dd_Smed_v4_1969_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30006006 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000022:291916..292824 +4473
Homology
BLAST of SMED30006006 vs. Planmine SMEST
Match: SMESG000007017.1 (SMESG000007017.1)

HSP 1 Score: 496.123 bits (1276), Expect = 5.033e-162
Identity = 296/297 (99.66%), Postives = 297/297 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+NEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct:  281 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRNEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 577          

HSP 2 Score: 496.123 bits (1276), Expect = 5.033e-162
Identity = 296/297 (99.66%), Postives = 297/297 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+NEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct:  611 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRNEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907          

HSP 3 Score: 496.123 bits (1276), Expect = 5.033e-162
Identity = 296/297 (99.66%), Postives = 297/297 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+NEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct:  941 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRNEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 1237          

HSP 4 Score: 496.123 bits (1276), Expect = 5.033e-162
Identity = 296/297 (99.66%), Postives = 297/297 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+NEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct: 1271 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRNEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 1567          

HSP 5 Score: 411.379 bits (1056), Expect = 2.017e-131
Identity = 239/241 (99.17%), Postives = 240/241 (99.59%), Query Frame = 2
Query:  185 GELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
             ELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+NEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct:    7 SELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRNEISESKLIELEEILLKEVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 247          
BLAST of SMED30006006 vs. Planmine SMEST
Match: SMESG000007018.1 (SMESG000007018.1)

HSP 1 Score: 270.781 bits (691), Expect = 3.509e-88
Identity = 161/179 (89.94%), Postives = 165/179 (92.18%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKN 553
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE      +D++I E       KSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+N
Sbjct:  260 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE------VDRNIWE-------KSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRN 425          

HSP 2 Score: 172.555 bits (436), Expect = 3.139e-50
Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE 325
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE
Sbjct:   52 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE 154          

HSP 3 Score: 152.91 bits (385), Expect = 7.148e-43
Identity = 79/89 (88.76%), Postives = 82/89 (92.13%), Query Frame = 2
Query:  614 GKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKIN 880
            GKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIE  L+ +  NSKNDQIKLKGQDLSKLSKVMDKIE  I+
Sbjct:  159 GKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIENNLERISRNSKNDQIKLKGQDLSKLSKVMDKIEKVID 247          
BLAST of SMED30006006 vs. Planmine SMEST
Match: SMESG000007018.1 (SMESG000007018.1)

HSP 1 Score: 272.322 bits (695), Expect = 2.325e-86
Identity = 161/179 (89.94%), Postives = 165/179 (92.18%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKN 553
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE      +D++I E       KSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDAL+N
Sbjct:  260 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE------VDRNIWE-------KSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALRN 425          

HSP 2 Score: 173.326 bits (438), Expect = 4.326e-49
Identity = 103/103 (100.00%), Postives = 103/103 (100.00%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE 325
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE
Sbjct:   52 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEIIDDLNRSLE 154          

HSP 3 Score: 150.214 bits (378), Expect = 8.690e-41
Identity = 78/88 (88.64%), Postives = 81/88 (92.05%), Query Frame = 2
Query:  617 KDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKIN 880
            KDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIE  L+ +  NSKNDQIKLKGQDLSKLSKVMDKIE  I+
Sbjct:  160 KDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIENNLERISRNSKNDQIKLKGQDLSKLSKVMDKIEKVID 247          

HSP 4 Score: 97.8265 bits (242), Expect = 1.597e-22
Identity = 70/90 (77.78%), Postives = 71/90 (78.89%), Query Frame = 2
Query:   17 AERLSKLCKEFSESILPDSTVIRNXXXXXXXXXXXSKERKVGLENGTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRF 286
            AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKER                  ELENSKGKELVESLEIMKSLIPKSKAGEKER+ 
Sbjct:  591 AERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKER------------------ELENSKGKELVESLEIMKSLIPKSKAGEKERKI 662          

HSP 5 Score: 77.411 bits (189), Expect = 1.256e-15
Identity = 42/51 (82.35%), Postives = 45/51 (88.24%), Query Frame = 2
Query:  767 ETILKEL----VENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 907
            E +LKE+    + NSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN
Sbjct:  437 EILLKEVSEEKISNSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAERSN 487          
BLAST of SMED30006006 vs. Planmine SMEST
Match: SMESG000020529.1 (SMESG000020529.1)

HSP 1 Score: 160.229 bits (404), Expect = 1.021e-48
Identity = 108/143 (75.52%), Postives = 117/143 (81.82%), Query Frame = 2
Query:  383 KKSEKRLDNSDEDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIENSRRPIETILKELVENSKNDQ 811
            KKSE +L+NSDEDS KILEAIKCL DDEE +QEKLLNR D DNL DGIKV +      +SE KLI+LEE LLKEVSEGKDLVKLK TV E LIGILCEAVE Q SIPDIADRIRKS QD  ENS R IETILKEL+ENS+ND+
Sbjct:    5 KKSEIQLNNSDEDSKKILEAIKCLIDDEEIQQEKLLNRTDTDNLFDGIKVTE------VSELKLIQLEENLLKEVSEGKDLVKLKPTVIETLIGILCEAVEFQFSIPDIADRIRKSEQDGNENSLRSIETILKELIENSRNDK 141          
BLAST of SMED30006006 vs. Planmine SMEST
Match: SMESG000028712.1 (SMESG000028712.1)

HSP 1 Score: 108.612 bits (270), Expect = 4.191e-28
Identity = 76/93 (81.72%), Postives = 83/93 (89.25%), Query Frame = 2
Query:  416 EDSNKILEAIKCLFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNXXXXXXXXXXXXXXXXXXXXGKDLVKLKATVHEPLIGILCEAVEIQS 694
            ED+NKILEAIKCLFDD+E EQEKLLNRKDIDNL+DGIKV KD L NEISESK+IELEE LLK+VSEGKD VKLK T +E LI ILCE+VEIQS
Sbjct:  131 EDNNKILEAIKCLFDDQESEQEKLLNRKDIDNLIDGIKVTKDTLSNEISESKVIELEENLLKDVSEGKDFVKLKETDNESLIAILCESVEIQS 223          
The following BLAST results are available for this feature:
BLAST of SMED30006006 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30006006 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007017.15.033e-16299.66SMESG000007017.1[more]
SMESG000007018.13.509e-8889.94SMESG000007018.1[more]
SMESG000007018.12.325e-8689.94SMESG000007018.1[more]
SMESG000020529.11.021e-4875.52SMESG000020529.1[more]
SMESG000028712.14.191e-2881.72SMESG000028712.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006006 ID=SMED30006006|Name=SMED30006006|organism=Schmidtea mediterranea sexual|type=transcript|length=909bp
ATTGAAGAAAGAAGAAGCAGAAAGATTGAGCAAATTGTGCAAAGAATTCT
CAGAATCCATTCTACCAGATTCAACAGTTATTAGGAATGTAGACATTGTT
GACGAAATTGTCGATGAAGTAAGTAAGGAACGTAAAGTTGGACTTGAAAA
TGGCACTAAATTAATATGCGATGCTTTGGAGAAAGGTGAATTGGAGAACT
CGAAAGGCAAAGAACTTGTCGAAAGTCTGGAAATTATGAAATCATTGATT
CCAAAATCAAAGGCTGGAGAGAAAGAAAGAAGATTTGTTGAAGAAATAAT
AGACGATTTGAATAGATCATTAGAAAGTGGATCGAAAGTGAAAATTGACA
AATCTATTTGTGAACAATTAAAAGCATTTGGGAAAAAGAGTGAAAAGCGA
TTAGATAATTCCGATGAGGATAGTAACAAAATACTGGAAGCAATTAAATG
TTTATTTGACGACGAAGAATGCGAACAAGAGAAACTGCTGAACCGAAAAG
ACATTGATAATTTACTTGATGGAATAAAAGTCGCTAAAGATGCGTTGAAA
AATGAAATTAGTGAATCGAAACTGATTGAGTTGGAAGAAATTTTATTGAA
AGAAGTTTCCGAAGGAAAAGATCTCGTTAAACTAAAAGCAACAGTCCATG
AGCCTCTGATCGGAATTCTATGTGAAGCTGTCGAAATCCAATCTAGCATT
CCAGATATTGCGGACCGAATTAGAAAATCTCGACAAGACGAAATTGAAAA
CAGTCGACGACCGATTGAAACAATCTTGAAAGAATTAGTAGAAAATTCAA
AGAATGATCAAATAAAATTGAAAGGTCAAGATTTATCAAAATTGTCAAAA
GTTATGGATAAAATTGAAAGTAAAATTAATGAAACGCCAGATGCTGAAAG
ATCCAACGA
back to top

protein sequence of SMED30006006-orf-1

>SMED30006006-orf-1 ID=SMED30006006-orf-1|Name=SMED30006006-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
LKKEEAERLSKLCKEFSESILPDSTVIRNVDIVDEIVDEVSKERKVGLEN
GTKLICDALEKGELENSKGKELVESLEIMKSLIPKSKAGEKERRFVEEII
DDLNRSLESGSKVKIDKSICEQLKAFGKKSEKRLDNSDEDSNKILEAIKC
LFDDEECEQEKLLNRKDIDNLLDGIKVAKDALKNEISESKLIELEEILLK
EVSEGKDLVKLKATVHEPLIGILCEAVEIQSSIPDIADRIRKSRQDEIEN
SRRPIETILKELVENSKNDQIKLKGQDLSKLSKVMDKIESKINETPDAER
SN
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000067goblet cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell