T-complex protein 1 subunit gamma

Overview
NameT-complex protein 1 subunit gamma
Smed IDSMED30006002
Length (bp)1816
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of T-complex protein 1 subunit gamma (SMED30006002) t-SNE clustered cells

Violin plots show distribution of expression levels for T-complex protein 1 subunit gamma (SMED30006002) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of T-complex protein 1 subunit gamma (SMED30006002) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for T-complex protein 1 subunit gamma (SMED30006002) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30006002

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30006002SMESG000066978.1 dd_Smed_v4_435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30006002SMESG000066978.1 dd_Smed_v4_435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006002SMESG000066978.1 Contig39123uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30006002SMESG000066978.1 Contig39123newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
testisSMED30006002SMESG000066978.1 MF669563.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30006002SMESG000066978.1 MF669563.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30006002SMESG000066978.1 MF669563.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30006002SMESG000066978.1 MF669563.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogonial stem cellSMED30006002SMESG000066978.1 MF669563.1smed_ncbi_20200123PMID:29095551
Counts et al., 2017
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
epidermisSMED30006002SMESG000066978.1 dd_Smed_v4_435_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 338/531 (63.65%), Postives = 427/531 (80.41%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D  + D ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+++LC DII++KPD+VITEKG+SDLAQHY ++ANI+ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 529          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 314/487 (64.48%), Postives = 394/487 (80.90%), Query Frame = 2
Query:  203 MLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D  + D ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+++LC DII++KPD+VITEKG+SDLAQHY ++ANI+ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    1 MMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 484          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 309/531 (58.19%), Postives = 392/531 (73.82%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK                                      I V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D  + D ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+++LC DII++KPD+VITEKG+SDLAQHY ++ANI+ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAK--------------------------------------IQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 491          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 329.717 bits (844), Expect = 6.314e-109
Identity = 158/241 (65.56%), Postives = 194/241 (80.50%), Query Frame = 2
Query:  104 NARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGES 826
            N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D  + D ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGES
Sbjct:   37 NTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGES 276          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Match: CCT3 (chaperonin containing TCP1 subunit 3 [Source:HGNC Symbol;Acc:HGNC:1616])

HSP 1 Score: 303.908 bits (777), Expect = 1.537e-99
Identity = 147/235 (62.55%), Postives = 184/235 (78.30%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIEN 775
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIIL GE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D  + D ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+N
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIIL-GEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKN 234          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-3 (T-complex protein 1 subunit gamma [Source:UniProtKB/Swiss-Prot;Acc:Q9N4J8])

HSP 1 Score: 646.736 bits (1667), Expect = 0.000e+0
Identity = 317/531 (59.70%), Postives = 406/531 (76.46%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGG 1675
            P+++L+   +R  G +VQ  NI A K +ADVIRT LGPRAMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEE GDGTTSVIILAGE+++ A   L+QK HPT II AYR+AL+D +++ +      +D  +  E+ KV+KSCLGTK I+KW DLA  I++ AV  +  ++ G +EIDIKRY +IEKIPGG IEDS V+ G++ NKDI+H KMRRRIENPRI+LLD ++EYKKGESQTS+EI  E ++   L+ EE+ + K C +II++KPDLV TEKG+SDLAQH+ +KA I+ LRRL+KTDN R+AR CGA ++ +  + ++ED+GT A LFE+  I DEY+T++T  +   AC+++LRG SKDV+NE+ERNL D++ V RN+M+   LVPGGGALEMA+S  +  +   + GV++  Y A+  ALEVIPRTL QNCG   +R +TELRA HA + A NW+ GVDG  G +VDM KL +WDPL VR QVLKTAIETSV+LLRIDDI+SGTKK  +GG
Sbjct:    8 PIIVLSQGTKRESGHQVQIGNINACKTIADVIRTSLGPRAMLKMLMDPMGGIVMTNDGNAILREITVKHPAAKSMIEIARTQDEETGDGTTSVIILAGEVMAHAQTYLEQKTHPTLIIKAYRQALEDMIQWSENKFSKTVDITDDAEIAKVVKSCLGTKMISKWMDLAVNISIQAVKTIRVEKAGVREIDIKRYCRIEKIPGGRIEDSQVVKGIVVNKDILHAKMRRRIENPRIVLLDCNLEYKKGESQTSLEIMREEDISAILEQEEQAIRKQCDEIIKLKPDLVFTEKGISDLAQHFLLKAGITCLRRLKKTDNNRLARVCGARVVHDTSDLRDEDVGTKAQLFEVVKIADEYYTYVT-AETTTACTVVLRGPSKDVINEVERNLQDSLHVVRNIMINPKLVPGGGALEMALSREIEQQGAKMDGVKKWPYKAIGLALEVIPRTLIQNCGGSTIRKMTELRAIHAQN-AENWTFGVDGTSGDLVDMNKLEIWDPLAVRIQVLKTAIETSVMLLRIDDIVSGTKK-AVGG 535          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-1 (T-complex protein 1 subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P41988])

HSP 1 Score: 296.59 bits (758), Expect = 7.786e-93
Identity = 186/549 (33.88%), Postives = 308/549 (56.10%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCAD-IIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNI-----DECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHA---MDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGD 1681
            M+S    IL    +R  G+ ++ QN+ AA  +A+++++ LGP  + KML+   G +++TNDG  IL+++ VE PA K ++E+A+ QDEEVGDGTTSV+I+A ELL +A  L++QK+HPT II+ YR A  ++++Y+  +     DS  R  ++   K+ + +K I   +D   ++ +DA   V  + NGK    I   V + K  G +  +SV++ G   N  +    M  R++N +I  LD S+   K     S+ + E+   + A++ EE  + K   D I++   ++V+T  G+ DL    FV++    +RR +K+D  R+A+  GA++  ++     DE  +  +   A     + I D+    I   K   A SI+LRG++  +L+E+ER++ D++ V R V+    LV GGGA+E ++S  L   AQ +    Q A    A+AL +IP+ LA N       L+T+LRA H+   + P      W+ G+D EEG I D K+ G+ +P   + + LK A E ++ +LRIDD++   K++ +GG D
Sbjct:    1 MASAGDSILALTGKRTTGQGIRSQNVTAAVAIANIVKSSLGPVGLDKMLVDDVGDVIVTNDGATILKQLEVEHPAGKVLVELAQLQDEEVGDGTTSVVIVAAELLKRADELVKQKVHPTTIINGYRLACKEAVKYISENISFTSDSIGRQSVVNAAKTSMSSKIIGPDADFFGELVVDAAEAVRVENNGKVTYPIN-AVNVLKAHGKSARESVLVKGYALNCTVASQAMPLRVQNAKIACLDFSLMKAKMHLGISVVV-EDPAKLEAIRREEFDITKRRIDKILKAGANVVLTTGGIDDLCLKQFVESGAMAVRRCKKSDLKRIAKATGATLTVSLATLEGDEAFDASLLGHADEIVQERISDDELILIKGPKSRTASSIILRGANDVMLDEMERSVHDSLCVVRRVLESKKLVAGGGAVETSLSLFLETYAQTLSSREQLAVAEFASALLIIPKVLASNAARDSTDLVTKLRAYHSKAQLIPQLQHLKWA-GLDLEEGTIRDNKEAGILEPALSKVKSLKFATEAAITILRIDDLIKLDKQEPLGGDD 546          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 263.848 bits (673), Expect = 2.212e-80
Identity = 160/526 (30.42%), Postives = 288/526 (54.75%), Query Frame = 2
Query:   74 SSMPVMIL--NSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKL-IGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            S  P +++    N +R+ G +  + +I AA+ VA+ +RT LGPR + KML+SP G + +TNDG  I+ ++ V+   AK M+E++++QD E+GDGTT V++LAG LL +A  L+ + IHP KI   +  A   +LE + +        ENR+ +++  ++ LG+K +N+      +IA+DAV  V   E+  K+++ +  +K+E   GG +ED++++ G++ +K + HP+M + ++N ++ +L    E  K +++  ++I    +       E E  E +   +      L I + G  D A H     ++  +R +   +   +A    A I+    E  +E +GT   + EI      +    I +C   KA +I +RG +K +++E +R L DA+ V RN++ ++ +V GGG+ E+A +  +  +A  I G+ Q A+ A A+ALE IP  LA+N G   +  +++L+AK         S+G+D       DMK+  V + L  + + +  A +   ++L+IDD+
Sbjct:   13 SGQPFIVMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDS-ISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIES--KDVNFE-MIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQI--ETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-5 (T-complex protein 1 subunit epsilon [Source:UniProtKB/Swiss-Prot;Acc:P47209])

HSP 1 Score: 263.848 bits (673), Expect = 2.212e-80
Identity = 160/526 (30.42%), Postives = 288/526 (54.75%), Query Frame = 2
Query:   74 SSMPVMIL--NSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKL-IGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            S  P +++    N +R+ G +  + +I AA+ VA+ +RT LGPR + KML+SP G + +TNDG  I+ ++ V+   AK M+E++++QD E+GDGTT V++LAG LL +A  L+ + IHP KI   +  A   +LE + +        ENR+ +++  ++ LG+K +N+      +IA+DAV  V   E+  K+++ +  +K+E   GG +ED++++ G++ +K + HP+M + ++N ++ +L    E  K +++  ++I    +       E E  E +   +      L I + G  D A H     ++  +R +   +   +A    A I+    E  +E +GT   + EI      +    I +C   KA +I +RG +K +++E +R L DA+ V RN++ ++ +V GGG+ E+A +  +  +A  I G+ Q A+ A A+ALE IP  LA+N G   +  +++L+AK         S+G+D       DMK+  V + L  + + +  A +   ++L+IDD+
Sbjct:   13 SGQPFIVMREQENQKRITGVEAVKSHILAARAVANTLRTSLGPRGLDKMLVSPDGDVTITNDGATIMEKMDVQHHVAKLMVELSKSQDHEIGDGTTGVVVLAGALLEEAEKLIDRGIHPIKIADGFDLACKKALETLDS-ISDKFPVENRERLVETAQTSLGSKIVNRSLRQFAEIAVDAVLSVADIES--KDVNFE-MIKMEGKVGGRLEDTILVKGIVIDKTMSHPQMPKELKNAKVAILTCPFEPPKPKTKHKLDITSTEDFKALRDYERETFETMIRQVKESGATLAICQWGFDDEANHLLQANDLPAVRWVGGPEIELLAIATNARIVPRFSELSKEKLGTAGLVREITFGAAKDRMLSIEQCPNNKAVTIFVRGGNKMIIDEAKRALHDALCVIRNLVRDSRIVYGGGSAELAAAIQVAKEADRIDGIEQYAFRAFADALESIPMALAENSGLAPIDALSDLKAKQI--ETGKSSLGIDAVFAGTNDMKEQKVIETLLSKREQISLATQVVRMILKIDDV 532          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Match: cct-4 (T-complex protein 1 subunit delta [Source:UniProtKB/Swiss-Prot;Acc:P47208])

HSP 1 Score: 259.61 bits (662), Expect = 7.200e-79
Identity = 179/513 (34.89%), Postives = 284/513 (55.36%), Query Frame = 2
Query:  125 KKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEK-----GVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            + V+  NI AAK VAD +RT LGPR M KM+ S  G + +TNDG  IL +++V  P AK ++E+++ QD E GDGTT+V+++AG LL  A  LL + IHPT I  +++ A  ++ E +       +D  N   + K+  + L +K +++ S L   +A++AV K+   EN    +++K  +KI K  G  +E+S ++ G L ++  +      RIE  +I L+   I   K + +  + I +   M RAL+ E +Y+ ++C  I     ++++ +K      V++LA H+  K  I  ++ + + D    +R  G   ++++D    + +G    + EI   GD     +T  + P  A SILLRGS+K VL E +R++ DA+ V R ++ +  L+PGGGA EM I+  L   AQ   G  Q  + A A+ALE+IP TLA+N G   +  +TELR  HA     N S GV+  +G + DM +  V  PL V A  +K A E    +L+IDDI+
Sbjct:   30 ESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATILNQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQSAAAEA-EKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSEN-DSNVNLK-MIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPKTDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFLAKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVTGVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLRNLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHA---NGNSSYGVNVRKGYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302371)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/530 (64.91%), Postives = 428/530 (80.75%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P+++L+ N +R  G+KVQ +NI A K +ADVIRTCLGP+AMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+L+ A   LQQ+IHPT II AYREAL+D + ++++   + +D +++ +M  V+K+C+GTKFI KWSDLA KIALDAV  VT  ENG+ E+DIKRY K+EKIPGGAIE+S VL GV+ NKD+ HPKMRR IENPRI+LLD S+EYKKGESQT++EI  E++  R LQ+EEE+V+++CADII +KPDLV TEKGVSDLAQHY +KA I+ +RRLRKTDN+R+AR CGA+I++  +E  E+D+GTGAGLFE+K IGDEYFTF+TECKEPKAC+ILLRG+SKD+LNE ERNL DA+ VARN+++E  LV GGGA+EMA S  LT K        +  Y AVA+ALE+IPRTLAQNCGA  +R +T LRAKHA    +    W  G+DGE G IVDM    +W+PL V+ Q  KTA+ET++LLLRIDDI+SG+KK+
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAW--GIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0302370)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/530 (64.91%), Postives = 428/530 (80.75%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P+++L+ N +R  G+KVQ +NI A K +ADVIRTCLGP+AMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+L+ A   LQQ+IHPT II AYREAL+D + ++++   + +D +++ +M  V+K+C+GTKFI KWSDLA KIALDAV  VT  ENG+ E+DIKRY K+EKIPGGAIE+S VL GV+ NKD+ HPKMRR IENPRI+LLD S+EYKKGESQT++EI  E++  R LQ+EEE+V+++CADII +KPDLV TEKGVSDLAQHY +KA I+ +RRLRKTDN+R+AR CGA+I++  +E  E+D+GTGAGLFE+K IGDEYFTF+TECKEPKAC+ILLRG+SKD+LNE ERNL DA+ VARN+++E  LV GGGA+EMA S  LT K        +  Y AVA+ALE+IPRTLAQNCGA  +R +T LRAKHA    +    W  G+DGE G IVDM    +W+PL V+ Q  KTA+ET++LLLRIDDI+SG+KK+
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAW--GIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0083337)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/530 (64.91%), Postives = 428/530 (80.75%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P+++L+ N +R  G+KVQ +NI A K +ADVIRTCLGP+AMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+L+ A   LQQ+IHPT II AYREAL+D + ++++   + +D +++ +M  V+K+C+GTKFI KWSDLA KIALDAV  VT  ENG+ E+DIKRY K+EKIPGGAIE+S VL GV+ NKD+ HPKMRR IENPRI+LLD S+EYKKGESQT++EI  E++  R LQ+EEE+V+++CADII +KPDLV TEKGVSDLAQHY +KA I+ +RRLRKTDN+R+AR CGA+I++  +E  E+D+GTGAGLFE+K IGDEYFTF+TECKEPKAC+ILLRG+SKD+LNE ERNL DA+ VARN+++E  LV GGGA+EMA S  LT K        +  Y AVA+ALE+IPRTLAQNCGA  +R +T LRAKHA    +    W  G+DGE G IVDM    +W+PL V+ Q  KTA+ET++LLLRIDDI+SG+KK+
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAW--GIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT3 (gene:FBgn0015019 transcript:FBtr0083338)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/530 (64.91%), Postives = 428/530 (80.75%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P+++L+ N +R  G+KVQ +NI A K +ADVIRTCLGP+AMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+L+ A   LQQ+IHPT II AYREAL+D + ++++   + +D +++ +M  V+K+C+GTKFI KWSDLA KIALDAV  VT  ENG+ E+DIKRY K+EKIPGGAIE+S VL GV+ NKD+ HPKMRR IENPRI+LLD S+EYKKGESQT++EI  E++  R LQ+EEE+V+++CADII +KPDLV TEKGVSDLAQHY +KA I+ +RRLRKTDN+R+AR CGA+I++  +E  E+D+GTGAGLFE+K IGDEYFTF+TECKEPKAC+ILLRG+SKD+LNE ERNL DA+ VARN+++E  LV GGGA+EMA S  LT K        +  Y AVA+ALE+IPRTLAQNCGA  +R +T LRAKHA    +    W  G+DGE G IVDM    +W+PL V+ Q  KTA+ET++LLLRIDDI+SG+KK+
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAW--GIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Match: CCT1 (gene:FBgn0003676 transcript:FBtr0084290)

HSP 1 Score: 283.493 bits (724), Expect = 1.090e-87
Identity = 182/535 (34.02%), Postives = 293/535 (54.77%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNM--IRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEED------IGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIG 1672
            R  G  V+ QN+ AA  +++++++ LGP  + KML+   G + +TNDG  ILR + VE PAAK ++E+A+ QDEEVGDGTTSV+ILA ELL  A  L++QKIHPT IIS YR A  ++ +Y+  H    +D   RD ++ + K+ + +K I   ++    + +DA   V  TD  G+    IK  + + K  G +  +SV++ G   N  I   +M ++I N +I  LD S++  K +    + IN+   +  IRA +L  +  ++    I+    ++V+   GV DL   YFV+A    +RR++K+D   +A+  GA+ I+++     E+      +G  A + + ++  DE    I   K   A SI+LRG +    +E+ER++ DA+ V + V+    +V GGG +E A+S +L   A ++    Q A    A +L VIP+TL+ N       L+ +LR+ H             W+ G+D  EGV+ D KK GV +P   + + LK A E ++ +LRIDD++    + K G
Sbjct:   14 RQSGASVRTQNVMAALSISNIVKSSLGPVGLDKMLVDDIGDVTVTNDGATILRLLEVEHPAAKVLVELAQLQDEEVGDGTTSVVILAAELLKNADELVKQKIHPTSIISGYRIACKEACKYISEHLTAPVDELGRDSLINIAKTSMSSKIIGADAEFFSAMVVDAAQSVKITDPRGQAAYSIK-AINVLKAHGKSARESVLIPGYALNCTIASQQMPKKIVNAKIACLDFSLQKTKMKMGVQVLINDPDKLEAIRAREL--DITKERINMILGTGVNVVLVSGGVDDLCMKYFVEAGAMAVRRVKKSDLKIIAKATGAAFITSLTNMDGEESFDASMVGEAAEVAQERICDDE-LILIKGTKARAAASIILRGPNDFYCDEMERSVHDALCVVKRVLESKKVVAGGGCVEAALSIYLENFATSLASREQLAIAEFAKSLLVIPKTLSVNAAKDATDLVAKLRSYHNSSQTKPERSDLKWT-GLDLIEGVVRDNKKAGVLEPAMSKIKSLKFATEAAITILRIDDMIKLNPEDKSG 543          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct3 (chaperonin containing TCP1, subunit 3 (gamma) [Source:ZFIN;Acc:ZDB-GENE-020419-5])

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 339/534 (63.48%), Postives = 428/534 (80.15%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIG 1672
            M   PV++L+ N +R  G+KVQ  NI+AAK +AD+IRTCLGPRAM+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +I AYR+ALDD L  +K      +D  NRD MLK+I S + TK +++WS LAC IALDAV  V  +ENG+KEIDIK+Y K+EK+PGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEYV+++C DIIR+KPDL+ TEKG+SDLAQHY +KANI+ +RR+RKTDN R+AR CGA I S  DE  E+D+GTGAGLFE+K IGDEYFTF+TECK+PKAC+ILLRG+SK++L E+ERNL DAM V RNV+++  L+PGGGA+EM +S  LT +++ + GV Q  Y AVA ALEV+PRTL QNCGA  +R++T LRAKH  +  ++W  GV+GE G + DM++LG+W+PL V+AQ  KTA+ET++LLLRIDDI+SG KK+  G
Sbjct:    1 MMGRPVLVLSQNIKRESGRKVQIGNISAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVIGAYRQALDDMLNILK-DISTPVDVSNRDMMLKIINSAINTKALSRWSTLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLRGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEIAREEDFARILQMEEEYVQQICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELTEDDVGTGAGLFEVKKIGDEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMEVSHRLTERSRAMTGVEQWPYRAVAQALEVVPRTLIQNCGASAIRVLTSLRAKHTQEGNSSW--GVNGETGTLADMEQLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKKGDG 531          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 282.722 bits (722), Expect = 2.890e-87
Identity = 183/559 (32.74%), Postives = 298/559 (53.31%), Query Frame = 2
Query:   65 LRMSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRY----VKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGG 1675
            + M   P+ +L    +R  G+ V+ QN+ AA  +A+++++ LGP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+I+A ELL  A  L++QKIHPT IIS YR A  +++ Y+  +  +  D   R+ +L   K+ + +K I   ++    + +DA   V   D  G     + RY    V + K  G + ++S +++G   N  +    M +R+ N +I  LD S++  K +    + IN+   + +  Q E +  ++    I+    ++V+T  G+ D+   YFV      +RR+ K D  R+A+  GA++ S++   + E+       FE  ++G           D+    I   K   + SI+LRG++  + +E+ER+L DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A +L VIP+TLA N       L+ +LRA H     N       W IG+D   G   D K+ GV++P  V+ + LK A E ++ +LRIDD++     QK GG
Sbjct:    1 MSMIDSPLSVL---GQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKG-----VARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEET------FEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKW-IGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGG 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: tcp1 (t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24])

HSP 1 Score: 282.337 bits (721), Expect = 4.417e-87
Identity = 183/557 (32.85%), Postives = 297/557 (53.32%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRY----VKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGG 1675
            M   P+ +L    +R  G+ V+ QN+ AA  +A+++++ LGP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+I+A ELL  A  L++QKIHPT IIS YR A  +++ Y+  +  +  D   R+ +L   K+ + +K I   ++    + +DA   V   D  G     + RY    V + K  G + ++S +++G   N  +    M +R+ N +I  LD S++  K +    + IN+   + +  Q E +  ++    I+    ++V+T  G+ D+   YFV      +RR+ K D  R+A+  GA++ S++   + E+       FE  ++G           D+    I   K   + SI+LRG++  + +E+ER+L DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A +L VIP+TLA N       L+ +LRA H     N       W IG+D   G   D K+ GV++P  V+ + LK A E ++ +LRIDD++     QK GG
Sbjct:    1 MIDSPLSVL---GQRTTGESVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELAELQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGTDDLGRECLLNAAKTSMSSKIIGVDAEFFANMVVDAAVAVKFVDGKG-----VARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMVKRVANAKIACLDFSLQKTKMKLGVQVVINDPEKLDQIRQRESDITKERVQKILASGANVVLTTGGIDDMCLKYFVDVGAMAVRRVLKKDLKRIAKATGATVCSSLSNLEGEET------FEPSMLGQAEEVVQERVCDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPDRKNLKW-IGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGG 542          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 270.396 bits (690), Expect = 1.375e-82
Identity = 169/532 (31.77%), Postives = 281/532 (52.82%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            M S PV++L       QG      NI A + VA+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IAR+QD EVGDGTTSV +LA E L Q    +++ +HP  II A+R A   +++ +K    V I  +++ E  ++++ C    L +K I    D   K+ +DAV  +        ++   + + ++K+ GGA+E+S +++GV F K   +       +R  NP+I LL++ +E K  +    + +N   +    +  E   +      I +    +V+++  + D+A  YF   ++    R+ + D  R    CG SI +++    ++ +G    LFE   +G E + F   C + K C+I+LRG ++  + E +R+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    A A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D  +  VW+P  VR   L  A E + L+L +D+ +
Sbjct:    1 MMSTPVILLKEGTDTSQGVPQLVSNINACQVVAEAVRTTLGPRGMDKLVVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIK-EIAVTIKKDDKQEQRRLLEKCAATALNSKLIAGQKDFFSKMVVDAVMML-------DDLLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYMNPKIALLNIELELKAEKDNAEVRVNSVEDYQAIVDAEWNILYDKLEKIHKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVVEEDLKRTMMACGGSIQTSVGSLTDDVLGQ-CELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETDRSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDVNNEDIADNFQACVWEPSIVRINALTAASEAACLILSVDETI 520          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 257.684 bits (657), Expect = 6.890e-78
Identity = 164/525 (31.24%), Postives = 289/525 (55.05%), Query Frame = 2
Query:   83 PVMILNSNAR--RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYM-KAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG--DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            P +I+    +  R+ G +  + +I AAK VA+ +RT LGP  + KM++   G + +TNDG  IL  + V+   AK M+E++++QD+E+GDGTT V++LAG LL QA  LL + IHP +I   Y +A   ++E + K      +D  N + +++   + LG+K IN+      +IA++A+  V   E  +K++D +  +K+E   GG +ED+ ++ GV+ +K+  HP+M + +++ +I +L    E  K +++  +++    +     + E++  +++   +     +L I + G  D A H  ++  +  +R +   +   +A   G  I+    E   E +GT AGL +    G   +    I ECK  +A +I +RG +K ++ E +R L DA+ V RN++ +N +V GGGA E+A +  +   A     + Q A  A A+ALEVIP  LA+N G   ++ +TE+RA+   +  NN ++G+D       DMK+  V + L  + Q +  A +   ++L+IDDI
Sbjct:   15 PFIIIKDQDKKSRLTGLEALKSHILAAKAVANTLRTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAAKIAIEQLDKIGDSFPVDPNNTESLVQTAMTTLGSKVINRCHRQMAEIAVNAILTVADME--RKDVDFE-LIKVEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKDKFQEMIRQVKENGANLAICQWGFDDEANHLLLQNELPAIRWVGGPEIELIAIATGGRIVPRFCELTPEKLGT-AGLVKEICFGTTKDRMLVIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEIACALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKE--NNSALGIDCLHLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:394965])

HSP 1 Score: 382.874 bits (982), Expect = 3.455e-129
Identity = 179/279 (64.16%), Postives = 226/279 (81.00%), Query Frame = 2
Query:  827 QTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            QT +EI  E +  R LQ+EEEY++++C DIIR+KPD+VITEKG+SDLAQHY VKANI+ +RR+RKTDN R+AR CGA I S  DE +EED+GTGAGLFEIK IGDEYFTFITECK+PKAC+I+LRG+SK++L E+ERNL DAM V RNV+++  LVPGGGA EM+++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +R++T LRAKH  +    W  GVDGE GV+VDMK+LG+W+PL V+ Q  KTA+ET++LLLRIDDI+SG K++
Sbjct:   13 QTEIEITREEDFARILQMEEEYIQQVCEDIIRLKPDVVITEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIGSRTDELREEDVGTGAGLFEIKKIGDEYFTFITECKDPKACTIVLRGASKEILAEVERNLQDAMQVCRNVVIDPHLVPGGGAAEMSVAHILTEKSKTMTGVEQWPYRAVAQALEVIPRTLVQNCGASTIRVLTSLRAKHTQEGCQTW--GVDGEAGVLVDMKELGIWEPLAVKLQTYKTAVETAILLLRIDDIVSGHKRK 289          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 271.166 bits (692), Expect = 8.604e-83
Identity = 169/541 (31.24%), Postives = 285/541 (52.68%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIG 1672
            M   PV++L       QG      NI A + +A+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IA++QD EVGDGTTSV +LA E + Q    +++ +HP  II AYR A   ++  ++    V +  E+++E   +++ C    L +K I    D   K+ +DAVS +        ++   + + I+K+ GGA+EDS +++GV F K   +       ++ E+P+I LL++ +E K  +    + ++   +    +  E   +      I +    +V+++  + D+A  YF   ++    R+ + D  R    CG SI ++++   ++ +G  A LFE   +G E + F T C + K C+I+LRG ++  + E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    + A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D     VW+P  VR   L  A E + L+L +D+ +   +    G
Sbjct:    1 MMPTPVILLKEGTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIR-EIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDAVSLL-------DDLLQLKMIGIKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELELKAEKDNAEVRVSNIEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETIKNPRSSMDG 529          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 270.011 bits (689), Expect = 1.755e-82
Identity = 172/543 (31.68%), Postives = 290/543 (53.41%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYK--KGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIG 1672
            +   PV++L       QG      NI A + +A+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IA++QD EVGDGTTSV +LA E + Q    +++ +HP  II AYR A   ++  ++    V +  E+++E   +++ C    L +K I    D   K+ +DAVS +        ++   + + I+K+ GGA+EDS +++GV F K   +       ++ E+P+I LL++ +E K  K  +++   +  E N++       + +EK    I +    +V+++  + D+A  YF   ++    R+ + D  R    CG SI ++++   ++ +G  A LFE   +G E + F T C + K C+I+LRG ++  + E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    + A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D     VW+P  VR   L  A E + L+L +D+ +   +    G
Sbjct:    1 LQPTPVILLKEGTDTSQGVPQLVSNINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIR-EIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDAVSLL-------DDLLQLKMIGIKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELELKAEKDNAESVFFVYAEWNILY------DKLEK----IYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETIKNPRSSMDG 521          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: TCP1 (t-complex 1 [Source:NCBI gene;Acc:100487607])

HSP 1 Score: 268.855 bits (686), Expect = 7.476e-82
Identity = 171/529 (32.33%), Postives = 284/529 (53.69%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            R  G+ V+ QN+ AA  +A+++++ LGP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD EVGDGTTSV+I+A ELL  A  L++QKIHPT +I  YR A  +++ Y+  +  ++ D   ++ +L   ++ + +K I   SD    + +DA   V   D  G+    I   + + K  G + ++S++++G   N  +    M +RI N +I  LD S++  K +    + I++   + +  Q E +  ++    I+    ++++T  G+ D+   YFV A    +RR+ K D  R+A+  GA + S +   + E+       FE  ++G           D+    +   K     SI+LRG++  + +E+ER++ DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A AL VIP+TLA N       L+ +LRA H     N       W IG+D   G   D K+ GV++P  V+ + LK A E ++ +LRIDD++
Sbjct:   11 RSTGEAVRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDNEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVIGGYRLACKEAVRYINENLTINTDELGKECLLNAARTSMSSKIIGVDSDFFSAMVVDAALAVKYVDPKGQARYPINS-INVLKAHGRSQKESILVNGYALNCVVGSQSMNKRIVNAKIACLDFSLQKTKMKLGVQVIISDPTKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYFVDAGAMAVRRVLKKDLKRIAKATGAIMCSTLANLEGEES------FEASMLGQAEEVVQERICDDELILVKNTKARTCASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARALLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW-IGLDLLNGKPRDNKQAGVFEPTLVKTKSLKFATEAAITILRIDDLI 531          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:407957])

HSP 1 Score: 265.388 bits (677), Expect = 1.133e-80
Identity = 163/517 (31.53%), Postives = 277/517 (53.58%), Query Frame = 2
Query:  143 NIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIG 1672
            NI A + +A+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IA++QD EVGDGTTSV +LA E + Q    +++ +HP  II AYR A   ++  ++    V +  E+++E   +++ C    L +K I    D   K+ +DAVS +        ++   + + I+K+ GGA+EDS +++GV F K   +       ++ E+P+I LL++ +E K  +    + ++   +    +  E   +      I +    +V+++  + D+A  YF   ++    R+ + D  R    CG SI ++++   ++ +G  A LFE   +G E + F T C + K C+I+LRG ++  + E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    + A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D     VW+P  VR   L  A E + L+L +D+ +   +    G
Sbjct:   18 NINACQVIAEAVRTTLGPRGMDKLIVDDRGKATISNDGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFMKQVKPYVEEGLHPQIIIRAYRTATQLAVGKIR-EIAVTVKKEDKEEQRLLLEKCAATALSSKLIALQKDFFAKMVVDAVSLL-------DDLLQLKMIGIKKVQGGALEDSHLVAGVAFKKTFSYAGFEMQPKKYESPKISLLNVELELKAEKDNAEVRVSNIEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVPEEDLKRTMMACGGSIQTSVNALTDDVLGHCA-LFEEAQVGGERYNFFTGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGSYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDVNNEDIADNFDACVWEPAIVRINALTAASEAACLVLSVDETIKNPRSSMDG 522          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 338/531 (63.65%), Postives = 425/531 (80.04%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NR+ ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+ +LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLK-KISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 529          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 324/513 (63.16%), Postives = 408/513 (79.53%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIE 1609
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NR+ ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+ +LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+E
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKK-ISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVE 511          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 630.558 bits (1625), Expect = 0.000e+0
Identity = 309/531 (58.19%), Postives = 390/531 (73.45%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK                                      I V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NR+ ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+ +LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAK--------------------------------------IQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLK-KISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 491          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Cct3 (chaperonin containing Tcp1, subunit 3 (gamma) [Source:MGI Symbol;Acc:MGI:104708])

HSP 1 Score: 369.392 bits (947), Expect = 4.941e-124
Identity = 186/356 (52.25%), Postives = 241/356 (67.70%), Query Frame = 2
Query:  347 GTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIP 1414
            GTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NR+ ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EK                                                  T +EI  E +  R LQ+EEEY+ +LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIP
Sbjct:    2 GTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLK-KISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEK--------------------------------------------------TDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIP 306          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Match: Tcp1 (t-complex protein 1 [Source:MGI Symbol;Acc:MGI:98535])

HSP 1 Score: 277.33 bits (708), Expect = 3.437e-85
Identity = 178/529 (33.65%), Postives = 287/529 (54.25%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            R  G+ V+ QN+ AA  +A+++++  GP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+I+A ELL  A  L++QKIHPT +IS YR A  +++ Y+  +  ++ D   RD ++   K+ + +K I    D    + +DAV  V  TD  G+    +   V I K  G +  +S++++G   N  +    M +RI N +I  LD S++  K +    + I +   + +  Q E +  ++    I+    ++++T  G+ D+   YFV+A    +RR+ K D   VA+  GASI+S +   + E+       FE+ ++G           D+    I   K   + SI+LRG++  + +E+ER+L DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A +L VIP TLA N       L+ +LRA H     N       W IG+D   G   D K+ GV++P  V+ + LK A E ++ +LRIDD++
Sbjct:   11 RSTGEAVRSQNVMAAASIANIVKSSFGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIINTDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNS-VNILKAHGRSQIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLANLEGEET------FEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW-IGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLI 531          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|Q3T0K2|TCPG_BOVIN (T-complex protein 1 subunit gamma OS=Bos taurus OX=9913 GN=CCT3 PE=1 SV=1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 342/531 (64.41%), Postives = 429/531 (80.79%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD +  +K    + +D+ NRD ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+++LC DII++KPD+VITEKG+SDLAQHY ++ANI+ +RR+RKTDN R+AR CGA I+S  +E +EED+GTGAGL EIK IGDEYFTFITECK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLK-KISIPVDTSNRDTMLNIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREEDVGTGAGLLEIKKIGDEYFTFITECKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 529          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P50143|TCPG_XENLA (T-complex protein 1 subunit gamma OS=Xenopus laevis OX=8355 GN=cct3 PE=2 SV=2)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 345/531 (64.97%), Postives = 427/531 (80.41%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGPRAM+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT IISAYR+ALDD +  +K      +D+ +R+ MLK+I S + TK I  W+D+AC IALDAV  V  +ENG+KEIDIK+Y K+EKIPGG IEDS VL GV+ NKD+ HPKMRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY++++C DIIR+KPD+VITEKG+SDLAQHY VKANI+ +RR+RKTDN R+AR CGA I S  DE +EED+GTGAGLFEIK IGDEYFTFIT+CK+PKAC+I+LRG+SK++L E+ERNL DAM V RNV+++  LVPGGGA EM+++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +R++T LRAKH  +    W  GVDGE GV+ DMK+LG+W+PL V+ Q  KTA+ET++LLLRIDDI+SG KK+
Sbjct:    1 MMGRPVLVLSQNMKRESGRKVQSGNINAAKTIADIIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVIISAYRKALDDMVNTLK-EISTPVDTNDRELMLKIINSAINTKAIKLWADMACGIALDAVKTVELEENGRKEIDIKKYAKVEKIPGGIIEDSCVLRGVMVNKDVTHPKMRRLIKNPRIILLDCSLEYKKGESQTEIEITREEDFARILQMEEEYIQQVCEDIIRLKPDVVITEKGISDLAQHYLVKANITAVRRVRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEIKKIGDEYFTFITDCKDPKACTIVLRGASKEILAEVERNLQDAMQVCRNVVIDPYLVPGGGASEMSVAHILTEKSKTMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRILTSLRAKHTQEGCQTW--GVDGEAGVLADMKELGIWEPLAVKLQTYKTAVETAILLLRIDDIVSGHKKK 528          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P48605|TCPG_DROME (T-complex protein 1 subunit gamma OS=Drosophila melanogaster OX=7227 GN=CCT3 PE=2 SV=2)

HSP 1 Score: 716.842 bits (1849), Expect = 0.000e+0
Identity = 344/530 (64.91%), Postives = 428/530 (80.75%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANN---WSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P+++L+ N +R  G+KVQ +NI A K +ADVIRTCLGP+AMLKMLM P GGIVMTNDGNAILREITV+ PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+L+ A   LQQ+IHPT II AYREAL+D + ++++   + +D +++ +M  V+K+C+GTKFI KWSDLA KIALDAV  VT  ENG+ E+DIKRY K+EKIPGGAIE+S VL GV+ NKD+ HPKMRR IENPRI+LLD S+EYKKGESQT++EI  E++  R LQ+EEE+V+++CADII +KPDLV TEKGVSDLAQHY +KA I+ +RRLRKTDN+R+AR CGA+I++  +E  E+D+GTGAGLFE+K IGDEYFTF+TECKEPKAC+ILLRG+SKD+LNE ERNL DA+ VARN+++E  LV GGGA+EMA S  LT K        +  Y AVA+ALE+IPRTLAQNCGA  +R +T LRAKHA    +    W  G+DGE G IVDM    +W+PL V+ Q  KTA+ET++LLLRIDDI+SG+KK+
Sbjct:    7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDPMGGIVMTNDGNAILREITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYREALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLEVDIKRYAKVEKIPGGAIEESCVLKGVMINKDVTHPKMRRLIENPRIVLLDCSLEYKKGESQTNVEIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEKGVSDLAQHYLLKAGITAIRRLRKTDNLRIARACGATIVNRTEELTEKDVGTGAGLFEVKKIGDEYFTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTRKQV------KGPYTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAW--GIDGESGEIVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|Q6P502|TCPG_RAT (T-complex protein 1 subunit gamma OS=Rattus norvegicus OX=10116 GN=Cct3 PE=1 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 339/531 (63.84%), Postives = 426/531 (80.23%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NRD ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+++LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMVSTLK-KISTPVDVNNRDMMLNIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 529          
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Match: sp|P80318|TCPG_MOUSE (T-complex protein 1 subunit gamma OS=Mus musculus OX=10090 GN=Cct3 PE=1 SV=1)

HSP 1 Score: 714.531 bits (1843), Expect = 0.000e+0
Identity = 338/531 (63.65%), Postives = 425/531 (80.04%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            M   PV++L+ N +R  G+KVQ  NI AAK +AD+IRTCLGP++M+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR ALDD +  +K      +D  NR+ ML +I S + TK I++WS LAC IALDAV  V  +ENG+KEIDIK+Y ++EKIPGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  R LQ+EEEY+ +LC DII++KPD+VITEKG+SDLAQHY ++AN++ +RR+RKTDN R+AR CGA I+S  +E +E+D+GTGAGL EIK IGDEYFTFIT+CK+PKAC+ILLRG+SK++L+E+ERNL DAM V RNV+++  LVPGGGA EMA++  LT K++ + GV Q  Y AVA ALEVIPRTL QNCGA  +RL+T LRAKH  +    W  GV+GE G +VDMK+LG+W+PL V+ Q  KTA+ET+VLLLRIDDI+SG KK+
Sbjct:    2 MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRMALDDMISTLK-KISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETW--GVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKK 529          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A0X3NMS6 (T-complex protein 1 subunit gamma OS=Schistocephalus solidus OX=70667 GN=TCPG PE=3 SV=1)

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 377/531 (71.00%), Postives = 449/531 (84.56%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQ-NIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKK 1660
            M  +PV++LN N +R  G+ VQ  NI A K VADVIRTCLGPRAMLKMLM P GGIVMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIILAGE+LS A   L+++IHPT++ISA+R+AL+D L  +     + ID  +   M+ ++KSC+GTK I+KW DLACK+A+++V +VT  ENG+KEIDIKRY KIEKIPGG+IEDS VL GV+FNKDI+HPKM+RRIENPRILLLD S+EYKKGESQT+MEI+ E++  RAL++EEEY+ K+C DIIR KP +VITEKGVSDLAQH+ VKA ISV+RRLRKTD +R+ RCCGA+I+S  +E KEEDIGT AGLFE+KLIGDEYFTFIT CK PKACSI+LRG+SKDVLNEIERNL DAMSV R+V ME  LVPGGGALEMA++  L+ KA+ ++ G++Q AYLAVA ALEVIPRTLAQNCGA VLR ITELRA HA+DPA NW++G+DGE G +VDMK LGVWDP+ V++Q  KTAIET++LLLRIDDI+SGTKK
Sbjct:    1 MRGVPVVVLNPNTKREHGRDVQIGNIQAGKTVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLSVAEPCLEKQIHPTRVISAFRQALEDILTAIDTKFSIPIDVNDHASMVNLVKSCVGTKIISKWMDLACKLAIESVKRVTILENGRKEIDIKRYAKIEKIPGGSIEDSTVLDGVMFNKDILHPKMKRRIENPRILLLDCSLEYKKGESQTAMEISGEKDFTRALEIEEEYISKICEDIIRHKPTVVITEKGVSDLAQHFLVKAGISVIRRLRKTDCLRIGRCCGATIVSRTEEIKEEDIGTEAGLFEVKLIGDEYFTFITGCKNPKACSIVLRGASKDVLNEIERNLNDAMSVVRSVGMEQRLVPGGGALEMALAQELSQKAKTSVSGIQQVAYLAVAQALEVIPRTLAQNCGANVLRQITELRAYHAIDPAKNWTMGIDGETGQLVDMKTLGVWDPVAVKSQTFKTAIETAILLLRIDDIVSGTKK 531          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A504YS00 (T-complex protein 1 subunit gamma OS=Fasciola gigantica OX=46835 GN=FGIG_02826 PE=3 SV=1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 374/539 (69.39%), Postives = 454/539 (84.23%), Query Frame = 2
Query:   74 SSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIV-GVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVA 1687
            +  PV++LN NAR  +GK VQ  NI A K VADVIRTCLGPRAMLKMLM P GGIVMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIIL GE+L+ A   L+++IHPTKIISA+R+ LDD L  ++ +  V +D+ NRDEM K+IKSC+GTKFIN+W++LAC+IALDAV  V  + +G KEIDIKRY KIEKIPGG+IEDSVV+ GV+FNKD+VHP+M RRIE+PRILLLD S+EYKKGESQTS+EI  +++  +AL++EE Y++++C +II+ +P++VITEKGVSDLAQH+  KA ISV+RRLRKTDN R+AR  GA+I+S  +E KE+DIG GAGLFE+K IGDEYFTFIT+CK PKAC+ILLRG+SKDVLNE+ERNL DAM+VARNVM+E  LVPGGGA+EMA+   LT KA++ V GV+Q AYLA+A ALEVIPRTLA NCGA VLRLITELRAKHA+DPA  W++GVDG  G ++DM++L +WDPL V+AQ LKTA+ET++LLLRIDDI+SG KKQ    GD A
Sbjct:    3 AGAPVLVLNRNARGEKGKSVQLANIEAGKMVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIISAFRKGLDDMLTALRENLSVPVDASNRDEMFKIIKSCVGTKFINQWAELACQIALDAVKTVAVEVDGHKEIDIKRYAKIEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRIEDPRILLLDCSLEYKKGESQTSIEITTDKDFTKALEIEENYIKEVCENIIKHRPNVVITEKGVSDLAQHFLSKAGISVIRRLRKTDNFRIARATGATIVSRPEEIKEDDIGLGAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGRVLTEKAKSTVSGVQQMAYLAMAQALEVIPRTLANNCGANVLRLITELRAKHAVDPAKYWTLGVDGTTGKLIDMRELDIWDPLVVKAQTLKTAVETAILLLRIDDIVSGVKKQS---GDSA 538          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A074ZMD9 (T-complex protein 1 subunit gamma (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13906 PE=3 SV=1)

HSP 1 Score: 775.393 bits (2001), Expect = 0.000e+0
Identity = 372/534 (69.66%), Postives = 447/534 (83.71%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQ-NIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGD 1681
            PV++LN NAR  +GK VQ  NI A K VADVIRTCLGPRAMLKMLM P GGIVMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIIL GE+L+ A   L+++IHPTKII+A+R+ LDD L  +     V +DS N++EM  +IKSC+GTKFIN+WSDLAC+IALDAV  V+ + +G+KEIDIKRY K+EKIPGG+IEDSVV+ GV+FNKD+VHP+M RRIENPRILLLD ++EYKKGESQTS+EI  E++  RAL++EE  ++++C  II+ KPD+VITEKGVSDLAQH+  KA ISV+RRLRKTDN RVAR  GA+I+S  +E KEEDIGT AGLFE+K IGDEYFTFIT+CK PKAC+ILLRG+SKDVLNE+ERNL DAM+VARNVM+E  LVPGGGA+EMA+   L  KA+  + GV+Q AY+A+A ALEVIPRTLA+NCGA VLRLITELRA+HA+DPA  W++GVDG  G + DMK+L VWDPL V+AQ  KTA+ET++LLLRIDD++SG K+Q   GGD
Sbjct:   59 PVLVLNRNARGEKGKSVQLANIEAGKTVADVIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCLEKQIHPTKIIAAFRKGLDDMLSALHDRLSVPVDSNNKEEMYTIIKSCVGTKFINQWSDLACQIALDAVKTVSIEVDGRKEIDIKRYAKVEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRRIENPRILLLDCNLEYKKGESQTSIEITAEKDFTRALEIEEANIKEMCDSIIKHKPDVVITEKGVSDLAQHFLAKAGISVIRRLRKTDNFRVARATGATIVSRTEEIKEEDIGTQAGLFEVKTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLEQRLVPGGGAIEMALGQVLAEKAKLAVSGVQQMAYMAMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPARYWTLGVDGTTGQLADMKQLNVWDPLVVKAQTFKTAVETAILLLRIDDVVSGVKRQ---GGD 589          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A5J4NT18 (T-complex protein 1 subunit gamma OS=Paragonimus westermani OX=34504 GN=DEA37_0007138 PE=3 SV=1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 366/527 (69.45%), Postives = 449/527 (85.20%), Query Frame = 2
Query:   86 VMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIV-GVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            V++LN N+R  + K VQ  NI A K VADV+RTCLGPRAMLKMLM P GGIVMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIIL GE+L+ A   ++++IHPTKIISA+R+ LDD L  ++ +  + +D+ N++EM KVIKSC+GTKFIN+W+DLAC+IALDAV  VT + +G+KEIDIKRY KIEKIPGG+IEDSVV+ GV+FNKD+VHP+M R+IENPRILLLD ++EYKKGESQTS+EI+ E++  RAL++EE Y++ +C +II+ KPD+VITEKGVSDLAQH+  KA ISVLRRLRKTDN R+AR  GA+I+S  +E KE+DIGT AGLFE++ IGDEYFTFIT+CK PKAC+ILLRG+SKDVLNE+ERNL DAM+VARNVM++  LVPGGGA+EMA+   LT KA++ V GV+Q AYL++A ALEVIPRTLA+NCGA VLRLITELRA+HA+DPA  W++GVDG  G + DMK+L VWDPL V++Q  KTAIET++LLLRIDD++SG KKQ
Sbjct:    7 VIVLNRNSRGEKSKSVQLANIEAGKTVADVVRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILGGEMLAVAAPCIERQIHPTKIISAFRKGLDDMLSALRENLSISVDTNNKEEMFKVIKSCVGTKFINQWADLACQIALDAVKTVTIESDGRKEIDIKRYAKIEKIPGGSIEDSVVMDGVMFNKDVVHPRMSRKIENPRILLLDCNLEYKKGESQTSIEISNEKDFTRALEIEENYIKDICDNIIKYKPDVVITEKGVSDLAQHFLAKAGISVLRRLRKTDNFRIARATGATIVSRPEEIKEDDIGTQAGLFEVRTIGDEYFTFITKCKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVMLDQRLVPGGGAIEMALGQVLTEKAKSAVSGVQQMAYLSMAQALEVIPRTLAKNCGANVLRLITELRARHAIDPAKYWTLGVDGTTGKLADMKELNVWDPLVVKSQTFKTAIETAILLLRIDDVVSGVKKQ 533          
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Match: A0A068YCU0 (T-complex protein 1 subunit gamma OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000872100 PE=3 SV=2)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 373/531 (70.24%), Postives = 445/531 (83.80%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQN-IVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKK 1660
            M   PV+ILN N RR  GK VQ  NI A K VADVIRTCLGPRAMLKML+ P G IVMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVI+LAGE+LS A   L+++IHPTKII+A+R+AL+D    + A   + +D  + D M+ ++KSC+GTK INKW DL+C +A+ +V  VT  + G+KEIDIKRY K+EKIPGG+IEDS VL GV+FNKDI+HPKMRRRIE+PRILLLD S+EYKKGESQT+MEI  E++  RAL++EEEYV K+C +IIR KPD+VITEKGVSDLAQH+ VKA ISV+RRLRKTD +R+ RC GA+I+S  DE KEEDIGTGAGLFE+KLIGDEYFTFIT CK+PKAC+ILLRG+SKDVLNEIERNL DAMSV R+  M+  LVPGGGALEMA++  L+ KA++ I GV++ AYLAVA ALEVIPRTLAQNCGA VL+ ITELRA HA+DPA NW++G++GE G +VDMK+LGVWDP+ V++Q  KTAIET++LLLRIDDI+SGTKK
Sbjct:    1 MRGTPVLILNQNTRREHGKDVQFGNIEAGKTVADVIRTCLGPRAMLKMLLDPMGSIVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEVLSVAAPCLEKQIHPTKIITAFRQALEDITTAIDAKLSIPVDVNSHDAMVNLVKSCVGTKIINKWVDLSCNLAISSVKVVTVVDGGRKEIDIKRYAKVEKIPGGSIEDSCVLDGVMFNKDILHPKMRRRIESPRILLLDCSLEYKKGESQTTMEICGEKDFTRALEIEEEYVGKICEEIIRHKPDVVITEKGVSDLAQHFLVKAGISVIRRLRKTDCLRIGRCSGATIVSRTDEIKEEDIGTGAGLFEVKLIGDEYFTFITGCKDPKACTILLRGASKDVLNEIERNLQDAMSVVRSAFMDPRLVPGGGALEMALAQELSQKAKSAISGVQKVAYLAVAQALEVIPRTLAQNCGANVLKQITELRAYHAIDPAKNWTMGINGETGQLVDMKELGVWDPVAVKSQTFKTAIETAILLLRIDDIVSGTKK 531          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:103023813])

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 343/540 (63.52%), Postives = 430/540 (79.63%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE 1690
            M   PV++L+ N +R  G+KVQ  NI AAK +ADVIRTCLGPRAM+KML+ P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT +ISAYR+ALDD L  +K      +D  +R  MLK+I S + TK +++WS LAC IALDAV  V  +ENG+KEIDIK+Y K+EK+PGG IEDS VL GV+ NKD+ HP+MRR I+NPRI+LLD S+EYKKGESQT +EI  E +  + LQ+EEEY++ +C DIIR+KPDL+ TEKG+SDLAQHY +KANI+ +RR+RKTDN R+AR CGA I S  DE +EED+GTGAGLFE+K IGDEYFTF+TECK+PKAC+ILLRG+SK++L E+ERNL DAM V RNV+++  L+PGGGA+EMA+S  LT +++ + GV Q  Y AVA ALEVIPRTL QNCGA  +R++T LRAKH  + + +W  GV+GE G + DM +LG+W+PL V+AQ  KTA+ET++LLLRIDDI+SG KK+    GD AE
Sbjct:    1 MMGRPVLVLSQNMKRESGRKVQTGNINAAKTIADVIRTCLGPRAMMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEQFLEQQMHPTVVISAYRQALDDMLSMLK-EISTPVDQNDRSMMLKIINSAINTKALSRWSSLACNIALDAVRTVELEENGRKEIDIKKYAKVEKVPGGIIEDSCVLKGVMVNKDVTHPRMRRLIKNPRIVLLDCSLEYKKGESQTDIEITREEDFAKILQMEEEYIQLICEDIIRLKPDLIFTEKGISDLAQHYLMKANITAIRRIRKTDNNRIARACGARIASRTDELREEDVGTGAGLFEVKKIGDEYFTFVTECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPYLLPGGGAVEMAVSHRLTERSRALTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGSTSW--GVNGETGTLADMVELGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKK----GDKAE 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:103041096])

HSP 1 Score: 280.796 bits (717), Expect = 1.573e-86
Identity = 181/549 (32.97%), Postives = 294/549 (53.55%), Query Frame = 2
Query:   95 LNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRY----VKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGG 1675
            LN   +R  G+ V+ QN+ AA  +A+++++ LGP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+I+A ELL  A  L++QKIHPT IIS YR A  +++ Y+  +  +  D   R+ ++   K+ + +K I   SD    + +DA   V   D  G     + RY    V + K  G + ++S +++G   N  +    M +R++N +I  LD S++  K +    + I++   + +  Q E +  ++    I+    ++V+T  G+ D+   YFV A    +RR+   D  R+A+  GA+I  ++   + E+       FE  ++G           D+    +   K   + SI+LRG++  + +E+ER+L DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A +L VIP+TLA N       L+ +LRA H     N       W IG+D   G   D K+ GV++P  V+ + LK A E ++ +LRIDD++     QK GG
Sbjct:    8 LNVLGQRTTGESVRTQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKSADELVKQKIHPTSIISGYRLACKEAVRYINENLTIGADDLGRECLVNAAKTSMSSKIIGVDSDFFANMVVDAALAVKFVDGKG-----VARYPINSVNVLKAHGRSQKESFLVNGYALNCTVGSQGMLKRVQNAKIACLDFSLQKTKMKLGVQVVISDPEKLDQIRQRESDITKERIQKILASGANVVLTTGGIDDMCLKYFVDAGAMAVRRVLHRDLKRIAKATGATICPSLSNLEGEET------FEATMLGQAEEVVQERVCDDELILVKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW-IGLDLVNGKPRDNKQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPDQKEGG 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:103028526])

HSP 1 Score: 272.322 bits (695), Expect = 3.178e-83
Identity = 167/533 (31.33%), Postives = 283/533 (53.10%), Query Frame = 2
Query:   68 RMSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            +M   PV++L       QG      NI A + +A+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IAR+QD EVGDGTTSV +LA E L Q    +++ +HP  II A+R A   +++ +K    V +  +N++E  ++++ C    L +K I    +   K+ +DAV  +        E+   + + ++K+ GGA+E+S +++GV F K   +       +R +NP+I LL++ +E K  +    + +    +    +  E   +      I +    +V+++  + D+A  YF   ++    R+++ D  R    CG SI +++    ++ +G    LFE   +G E + F   C + K C+I+LRG ++  + E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    A A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D  +  VW+P  VR   L  A E + L+L +D+ +
Sbjct:   20 KMMPTPVILLKEGTDTSQGVPQLISNINACQVIAEAVRTTLGPRGMDKLIVDNRGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLKQLKPYVEEGLHPQTIIRAFRIATQLAVKKIK-EIAVTVKKDNKEEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMML-------DELLPLKMIGVKKVQGGALEESQLVAGVAFKKTFSYAGFEMQPKRYDNPKIALLNIELELKAEKDNAEVRVKSVEDYQAIVDAEWNILYDKLEKIYKSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGSLTDDVLGQ-CELFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFMEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDVNNEDIADNFQACVWEPAIVRINALTAASEAACLILSVDETI 540          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 258.07 bits (658), Expect = 1.268e-77
Identity = 170/520 (32.69%), Postives = 290/520 (55.77%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGV-----SDLAQHYFVKANISVLRRLRKTDNVRVARCC--GASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS 1648
            R +  +++  NI+A K VAD IRT LGP+ M KM+    G + +TNDG  IL+++ V  PAAK ++E+++ QD E GDGTTSV+++AG LL     LLQ+ IHPT I  ++++A+D  +E + + +   ++  +R+ +L    + L +K ++++S L   +++DAV +V  D      +D+ R + I K  GG I+D  ++ G++  + +V+  +  R+E  +I L+   +   K +    + +++   M R L+ E  Y+  L   I +   ++++ +K +     SDLA H+  K  I V++ + + +       C  G   I++ID+   E +G      E+ L G      IT C  P K  SI++RGS+K V+ E ER++ DA+ V R ++ +  L+ GGGA E+ ++  L   A+++ G+      A A+ALEVIP TLA+N G   +  +TELR +HA       + G++  +G I ++ +  V  PL V    L  A ET   +L+IDD++S
Sbjct:   21 RDKPAQIRYSNISAGKAVADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVLHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDACAKLLQKGIHPTTISESFQKAVDKGVEVLTSIS-QPVELSDRETLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRV-IDPATATSVDL-RDIHIVKKLGGTIDDCELVDGLVLTQRVVNTGV-SRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERAYILNLIKQIKKAGCNVLLIQKSILRDALSDLAVHFLNKMKIMVVKDIEREEIEEQLNICTIGTKPIAHIDQFTPEMLGLAELAEEVSLDGSGKLVKITGCASPGKTVSIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRALIAGGGAPEIELALRLAEFARSLGGMEAYCVRAYADALEVIPSTLAENAGLNPISTVTELRNRHAQ---GEKTAGINVRKGGISNILEELVVQPLLVSISALTLATETVRSILKIDDVVS 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Match: cct5 (chaperonin containing TCP1 subunit 5 [Source:NCBI gene;Acc:103047209])

HSP 1 Score: 253.062 bits (645), Expect = 2.862e-76
Identity = 162/525 (30.86%), Postives = 287/525 (54.67%), Query Frame = 2
Query:   83 PVMILNSNAR--RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYM-KAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG--DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            P +I+    +  R+ G    + +I AAK VA+ ++T LGP  + KM++   G + +TNDG  IL  + V+   AK M+E++++QD+E+GDGTT V++LAG LL QA  LL + IHP +I   Y +A   ++E++ K      +D  N + +++   + LG+K IN+      +IA++A+  V   E  +K++D +  +K+E   GG +ED+ ++ GV+ +K+  HP+M + +++ +I +L    E  K +++  ++I    +     + E+E  +++   +     +L I + G  D A H  ++  +  +R +   +   +A   G  I+    E   E +G  AGL      G   +    I ECK  +A +I +RG +K ++ E +R L DA+ V RN++ +N +V GGGA E++ +  +   A     + Q A  A A+ALEVIP  LA+N G   ++ +TE+RA+   +  +N ++G+D       DMK+  V + L  + Q +  A +   ++L+IDDI
Sbjct:   15 PFIIIKDQDKKFRLTGLDALKSHIMAAKAVANTLKTSLGPNGLDKMMVDKDGEVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRIADGYDQAARIAIEHLDKIGDSFPVDPSNTEPLIQTAMTTLGSKVINRCHRQMAEIAVNAILTVADME--RKDVDFE-LIKMEGKVGGKLEDTQLIKGVIVDKEFSHPQMPKVLKDTKIAILTCPFEPPKPKTKHKLDITSVEDYKALQKYEKEKFQEMIQQVKENGANLAICQWGFDDEANHLLLQNELPAVRWVGGPEIELIAIATGGRIVPRFCELTPEKLG-AAGLVRELCFGTTKDRMLIIEECKNSRAVTIFIRGGNKMIIEEAKRALHDALCVIRNLVRDNRIVYGGGASEISCALAVNEAADKCPSLEQYAMRAFADALEVIPMALAENSGLNPIQTMTEVRARQVKE--SNSALGIDCLRLSTNDMKQQHVIETLIGKKQQISLATQVVKMILKIDDI 533          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002042.1 (pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 gene:ENSPMAG00000001837.1 transcript:ENSPMAT00000002042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 248/380 (65.26%), Postives = 318/380 (83.68%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVL 1222
            PV++L+ N +R  G+KVQ+ NI+AAK +ADVIRTCLGPRAM+KMLM P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE+L+ A   L+Q++HPT IISAYR+AL+D L  +K  + V +D  +R  ML+++KS + TK +++ S+LAC IALDAV  V  ++NG++EIDIK Y KIEK+PGG +E+S VL GV+ NKD+ HP+MRRRIE PRILLLD S+E+KKGESQT +E++ E +  + LQ EE+Y++++CADI+R+KPDL+ TEKG+SDLAQH+ VKANI+ +RR+RKTDN R+AR CGA I+S   + KEED+GTGAGLFE+K IGD+YFTFITECK+PKAC+ILLRG+SKD+L
Sbjct:    8 PVLVLSQNTKRESGRKVQQGNISAAKMIADVIRTCLGPRAMMKMLMDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLAVAEQFLEQQMHPTVIISAYRKALEDMLSTLKDISSVAVDVTDRVMMLRIVKSAIDTKALSRVSELACGIALDAVLTVQREDNGRREIDIKNYAKIEKVPGGILEESCVLRGVMLNKDVTHPRMRRRIETPRILLLDCSLEFKKGESQTDIEMSREEDFAKILQAEEDYIQQICADIVRLKPDLLFTEKGISDLAQHFLVKANITAIRRIRKTDNNRIARACGARIVSRTSDAKEEDVGTGAGLFEVKKIGDDYFTFITECKDPKACTILLRGASKDIL 387          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct4 (chaperonin containing TCP1, subunit 4 (delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1421])

HSP 1 Score: 253.832 bits (647), Expect = 4.077e-77
Identity = 165/513 (32.16%), Postives = 285/513 (55.56%), Query Frame = 2
Query:  131 VQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGV-----SDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSG 1651
            ++  NI AAK +AD IRT LGP+ M KM+    G + +TNDG  IL+++ V  PAAK ++E+++ QD E GDGTTSV+++AG LL  +  LLQ+ IHPT I  ++++AL+ + E +++ + + ++  +R  +L    + L +K +++++ L   +++DAV KV  D      +D+     I K+ GG I+D  ++ G++  + I +  +  R+E  +I L+   +   K + +  + +++   M R L+ E  Y   L   + +   ++++ +K +     SDLA H+  K  I V++ + + D   + +  G   I+++D    E + + A L E   +G      +T C  P K  SIL+RGS+K VL E ER+L DA+ V R ++ +  L+ GGGA E+ +S  LT  A+ +  +      A   A+EVIP TLA+N G   +  +TELR +HA       + G++  +G I ++ +  V  PL V    +  + ET   +L+IDDI++ 
Sbjct:   40 IRSSNICAAKAIADAIRTSLGPKGMDKMIQDGKGDVTITNDGATILKQMQVTHPAAKMLVELSKAQDIEAGDGTTSVVVIAGALLDASAKLLQKGIHPTIISESFQKALEKAQEILESMS-LPLELSDRQSLLNSATTALNSKVVSQYASLLAPMSVDAVMKV-IDPATATSVDLNDIKLIRKL-GGTIDDCELVEGLVLTQRISNTGI-IRVEKAKIGLIQFCLSPPKTDMENQIVLSDYTQMDRVLREERTYTLNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREDIEFICKTIGTKPIASVDHFTAEMLAS-AELVEEVSVGSSKVVKVTGCANPGKTMSILVRGSNKLVLEEAERSLHDALCVIRCLVKKRALIAGGGAPEIELSLRLTEYARTLSSMEAYCVRAYGEAMEVIPYTLAENAGLNPISTVTELRNRHAQ---GEKTAGINVRKGGISNILEELVVQPLLVSLSAVSLSTETVRSILKIDDIVNA 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct5 (chaperonin containing TCP1, subunit 5 (epsilon) [Source:ZFIN;Acc:ZDB-GENE-030131-977])

HSP 1 Score: 250.751 bits (639), Expect = 4.834e-76
Identity = 159/528 (30.11%), Postives = 282/528 (53.41%), Query Frame = 2
Query:   83 PVMILNSNAR--RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKA-HTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKL-IGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGV--DGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS 1648
            P +I+    R  R+ G    + +I AAK VA  +RT LGP+ + KM++S  G I +TNDG  IL  + VE   AK M+E++R+QD+E+GDGTT V++LAG LL QA  LL + IHP +I   Y +A   ++ ++ +      +D  N + ++    + LG+K +N+   +  +IA++AV  V   E  +K++D +  +K+E   GG ++D+ ++ GV+ +KD  HP+M + + N +I +L    E  K +++  +++    +    LQ E+E   ++   +     +L I + G  D A H  ++  +  +R +   +   +A   G  I+    E   + +G    + E+      ++   I +C   +A +I +RG +K ++ E +R++ DA+ V RN++ +N +V GGG+ E++ S  ++  A     + Q A  A A+ALEVIP  LA+N G   +  + E+R++   +      I       +G   DMK+  V + L  + Q +  A +   ++L+IDDI S
Sbjct:   15 PFIIIKDQDRKSRLSGLDALKSHIMAAKSVASTLRTSLGPKGLDKMMVSQDGDITVTNDGATILGMMDVEHQVAKLMVELSRSQDDEIGDGTTGVVVLAGALLEQAEQLLDRGIHPIRISDGYEQAARVAIAHLDSIAESYPVDPANTESLVLTAMTTLGSKIVNRCQRMMAEIAVNAVLSVADLE--RKDVDFE-LIKVEGKVGGRLDDTALIKGVVVDKDFSHPQMPKEVINAKIAILTCPFEPPKPKTKHKLDVTCVEDYKALLQYEKEKFAEMVRQVKETGANLAICQWGFDDEANHLLLQNQLPAVRWVGGHEIELIAIATGGRIVPRFSELTADKLGHAGIVRELSFGTTKDHMLVIEQCHNSRAVTIFIRGGNKMIIEEAKRSIHDALCVIRNLVRDNRVVYGGGSAEISCSLAVSEAADKCATLEQYAMRAFADALEVIPMALAENSGLNSIGALAEVRSRQLAEKKPYLGINCMQSSSKG---DMKEQHVIETLIGKKQQISLATQMVKMILKIDDIRS 536          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: cct7 (chaperonin containing TCP1, subunit 7 (eta) [Source:ZFIN;Acc:ZDB-GENE-020419-7])

HSP 1 Score: 228.794 bits (582), Expect = 1.473e-68
Identity = 143/459 (31.15%), Postives = 240/459 (52.29%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCG 1438
            P+++L       QG      NI A   VAD +RT LGPR M K+++   G   ++NDG  IL+ + V  PA K++++IAR+QD EVGDGTTSV +LA ELL Q    +++ +HP  I  A+R+A   ++E +K    V +  E++ E+  ++  C    L +K +++  D    + +DAVS +        E+     + ++K+ GG +EDS +++GV F K   +       +    P+I LL++ +E K       + +   ++    +  E   +    A I      +V+++  + D+A  YF   ++    R+ + D  R    CG SI +++    ++ +G    LFE   IG + + F   C + K C+I+LRG ++  ++E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G  Q    A A ALEV PR L  N G
Sbjct:    4 PIILLKEGTDTSQGIPQLLSNITACLVVADAVRTTLGPRGMDKLIIDDRGKSTISNDGATILKLLEVVHPAGKTLVDIARSQDAEVGDGTTSVTLLAAELLKQVRQYVEEGMHPQIITRAFRKATGLAIEKIK-EISVPVKKEDKGELRALLVKCAATALSSKLVSQQKDFFAAMVVDAVSML-------DELMPLNMIGMKKVQGGGLEDSHLVAGVAFKKTFSYAGFEMQPKTYAQPKIALLNVELELKAERENAEVRVTNVQDYQAIVDAEWGILYDKLAKIEASGARVVLSKLPIGDVATQYFADRDMFCAGRVVEEDLKRTMMACGGSIQTSVSSMTDDVLGR-CELFEEVQIGGDRYNFFKGCPQAKTCTIILRGGAEQFMDETERSLHDAIMIVRRAIKNDSVVGGGGAVEMEVSRYLRDVSRTIPGKEQMLLGAYARALEVPPRQLCDNAG 453          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002094.1 (pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gene:ENSPMAG00000001904.1 transcript:ENSPMAT00000002094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 3.278e-29
Identity = 66/187 (35.29%), Postives = 113/187 (60.43%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLM-SPTGG---IVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYRE---ALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAV 610
            +S  P+ IL S A   + +  +  +   A ++ D++++ LGP+ M K+L+ S + G   + +TNDG  IL+ I V+ PAAK ++++++ QD+EVGDGTTSV +LA ELL +A  L+ +KIHP  II+ +R+   A   +LE + A    H   +   ++L + ++ L +K +    D   K+A++AV
Sbjct:    2 VSLAPINILKSGADEEKAETARLSSFIGAIYIGDLVKSTLGPKGMDKILLGSSSSGEAIVTVTNDGATILKSIGVDNPAAKILVDMSKVQDDEVGDGTTSVTVLAAELLREAEILIAKKIHPQTIITGWRKSTAAAGKALE-LAAVDHGHDKEKFHVDLLNISRTTLSSKLLTHHKDHFAKLAVEAV 187          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT3 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; capable of binding Q/N rich proteins and mediating their folding [Source:SGD;Acc:S000003551])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 305/535 (57.01%), Postives = 409/535 (76.45%), Query Frame = 2
Query:   83 PVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQ-ATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKV------TTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQK 1666
            PV+ +N++  R  G++ Q  NI AAK VADVIRTCLGP+AMLKML+ P GG+V+TNDG+AILREI V  PAAKSM+E++RTQDEEVGDGTT+VIILAGE+L+Q A  L+++ IHP  II A ++AL D+LE +K      +D EN   M K+I++ +GTK++  WS+  C++ALDAV  V      T +     EIDIKRYV++EKIPGG + DS VL GVL NKD+VHPKM R IENPR++LLD  +EYKKGESQT++EI +E +  R LQ+EEE V+ +C  I+ ++P LVITEKGVSDLAQHY +K   SVLRR++K+DN R+AR  GA+I++ +++ KE D+GT  GLF++++IGDEYF+F+  CKEPKAC+I+LRG SKD+LNEI+RNL DAM+VARNVM+  +L PGGGA EMA+S  L  KA+ + G++Q  Y AVA+A+E IPRTL QN G   +RL+++LRAKHA     N++ G+DG++G IVDM   G+W+P  ++ Q +KTAIE++ LLLR+DDI+SG +KQ+
Sbjct:    4 PVVFMNASQERTTGRQAQISNITAAKAVADVIRTCLGPKAMLKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGEILAQCAPYLIEKNIHPVIIIQALKKALTDALEVIK-QVSKPVDVENDAAMKKLIQASIGTKYVIHWSEKMCELALDAVKTVRKDLGQTVEGEPNFEIDIKRYVRVEKIPGGDVLDSRVLKGVLLNKDVVHPKMSRHIENPRVVLLDCPLEYKKGESQTNIEIEKEEDWNRILQIEEEQVQLMCEQILAVRPTLVITEKGVSDLAQHYLLKGGCSVLRRVKKSDNNRIARVTGATIVNRVEDLKESDVGTNCGLFKVEMIGDEYFSFLDNCKEPKACTIMLRGGSKDILNEIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAMECIPRTLIQNAGGDPIRLLSQLRAKHAQ---GNFTTGIDGDKGKIVDMVSYGIWEPEVIKQQSVKTAIESACLLLRVDDIVSGVRKQE 534          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT5 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000003825])

HSP 1 Score: 260.766 bits (665), Expect = 8.887e-80
Identity = 162/540 (30.00%), Postives = 305/540 (56.48%), Query Frame = 2
Query:   83 PVMIL--NSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSEN----RDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRI------ENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKL-IGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            P +I+    N +R  G + ++ +I AA+ VA +I+T LGPR + K+L+SP G I +TNDG  IL ++ ++   AK +++++++QD+E+GDGTT V++LA  LL QA  L+Q+ IHP KI + + EA   ++  ++  TC  I + N    RD +L+  K+ LG+K ++K  D   ++A++AV  V   +  +K++D    +K++   GG+I DS +++GV+ +KD  HP+M + +      +  ++ +L    E  K +++  ++I+      +    E++  +++  D+ +   D+VI + G  D A H  ++ ++  +R +   +   +A      I+    +  ++ +GT + ++E +     +    I + KE K  +  +RGS+K +++E ER L D++ V RN++ ++ +V GGGA E+ +S  ++ +A    G+ Q A+   A AL+ IP TLA+N G   +  ++ L++K   +  +N  IGVD       DMK+L V DP   + Q +  A +   ++L+ID+++   K +
Sbjct:   28 PFIIVKDQGNKKRQHGLEAKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGFDEAAKLAISKLE-ETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRFAEMAVEAVINVM--DKDRKDVDFD-LIKMQGRVGGSISDSKLINGVILDKDFSHPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQTYEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQELEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKETKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTMSLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKSKQLKEKISN--IGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILKIDNVIISGKDE 561          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT7 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo; mutant has increased aneuploidy tolerance [Source:SGD;Acc:S000003647])

HSP 1 Score: 257.684 bits (657), Expect = 8.411e-79
Identity = 166/543 (30.57%), Postives = 283/543 (52.12%), Query Frame = 2
Query:   86 VMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSE---NRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLG------VWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGG 1678
            +++L       QGK     NI A   V + ++  LGP     ++++      ++NDG  IL+ + V  PAAK++++I+R QD EVGDGTTSV ILAGEL+ +A   L++ I    I+  YR+A+  ++E +     V I SE    R+ + +  ++ + +K I+  +D   K+ +DAV  ++ D N   ++D  + + I+KIPGGA+E+S+ ++GV F K   +       ++  NP+IL L++ +E K  +    + +    +    +  E + + +    +     ++V+++  + DLA  +F   NI    R+   D  RV +  G SI S   + K E +GT A LFE   IG E +     C + K C++LLRG ++ V+ E+ER+L DA+ + +  +    +V GGGA EM +S  L   ++ I G +Q    A A ALEVIPR L +N G   + ++ +LR  H+      W        GV+ + + +G      VW+P  V+   L +A E + L+L +D+ ++    +    G
Sbjct:   10 IVVLKEGTDASQGKGQIISNINACVAVQEALKPTLGPLGSDILIVTSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVTILAGELMKEAKPFLEEGISSHLIMKGYRKAVSLAVEKIN-ELAVDITSEKSSGRELLERCARTAMSSKLIHNNADFFVKMCVDAV--LSLDRN---DLD-DKLIGIKKIPGGAMEESLFINGVAFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQAIVDAEWQLIFEKLRQVEETGANIVLSKLPIGDLATQFFADRNIFCAGRVSADDMNRVIQAVGGSIQSTTSDIKPEHLGTCA-LFEEMQIGSERYNLFQGCPQAKTCTLLLRGGAEQVIAEVERSLHDAIMIVKRALQNKLIVAGGGATEMEVSKCLRDYSKTIAGKQQMIINAFAKALEVIPRQLCENAGFDAIEILNKLRLAHS--KGEKWY-------GVVFETENIGDNFAKFVWEPALVKINALNSATEATNLILSVDETITNKGSESANAG 535          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: TCP1 (Alpha subunit of chaperonin-containing T-complex; complex mediates protein folding in the cytosol; involved in actin cytoskeleton maintenance; overexpression in neurons suppresses formation of pathogenic conformations of huntingtin protein [Source:SGD;Acc:S000002620])

HSP 1 Score: 258.07 bits (658), Expect = 8.573e-79
Identity = 168/530 (31.70%), Postives = 286/530 (53.96%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIK-RYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIE--NPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEED------IGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPA---------NNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS 1648
            ++ G  ++ QN+ A   VA+V+++ LGP  + KML+   G   +TNDG  IL  + V+ PA K ++E+A+ QD E+GDGTTSV+I+A ELL +A  L++ KIHPT II+ +R AL +++ ++       +D+  ++ ++ + K+ + +K I   SD    + +DA+  V T +N K EI    + V + K  G +  +S+++ G   N  +    M +RI   N +I  LDL+++  +      + I++   + +  + E   V +    II     +V+T KG+ DL    FV+A I  +RR +K D  R+AR  GA+++S++   + E+      +G    + + K   DE    I    +  + SI+LRG++   L+E+ER+L D++SV +  +    +VPGGG +E A++ +L   A  +    Q A    A AL +IP+TLA N       L+ +LR+ HA             +  + G+D   G IVD    GV +P   + + LK+A+E  V +LRID +++
Sbjct:   19 KISGDDIRNQNVLATMAVANVVKSSLGPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVLSTSVDTLGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKT-QNSKGEIKYPVKAVNVLKAHGKSATESLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLEGEETFESSYLGLCDEVVQAKFSDDECI-LIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLSVVKRTLESGNVVPGGGCVEAALNIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSSELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACVAILRIDTMIT 546          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Match: CCT4 (Subunit of the cytosolic chaperonin Cct ring complex; related to Tcp1p, required for the assembly of actin and tubulins in vivo [Source:SGD;Acc:S000002302])

HSP 1 Score: 247.284 bits (630), Expect = 4.828e-75
Identity = 162/514 (31.52%), Postives = 294/514 (57.20%), Query Frame = 2
Query:  125 KKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPK-MRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEK-----GVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEY--FTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            ++V++ NI AA+ VAD IRT LGP+ M KM+ +  G I+++NDG+ IL+++ +  P A+ ++E++  QD E GDGTTSV+IL G LL  A  LL + IHPT I  +++ A   S++ +    C  +   +R+++++   + L +K ++++S     +A+D+V K+ +DEN K  +D+     ++K+ GG I+D+ ++ GV+  +  +       R E  +I L+   I   K +++ ++ +N+ R M + L+ E  Y+  +C  I + K ++++ +K      V+DLA H+  K NI V++ + + +   +++  G   I++I+   E+ +G+   + EI   G +    T I         S+++RG++  +++E ER+L DA+ V R ++ E  L+ GGGA E+ IS  L+ +A+++ GV+   +   A+ALEVIP TLA+N G   ++++TELR+KH     N+   G+        +  +  +  P+ V    +  A E    +LRIDDI
Sbjct:   18 QEVRKANIIAARSVADAIRTSLGPKGMDKMIKTSRGEIIISNDGHTILKQMAILHPVARMLVEVSAAQDSEAGDGTTSVVILTGALLGAAERLLNKGIHPTIIADSFQSAAKRSVDIL-LEMCHKVSLSDREQLVRAASTSLSSKIVSQYSSFLAPLAVDSVLKI-SDENSKN-VDLNDIRLVKKV-GGTIDDTEMIDGVVLTQTAIKSAGGPTRKEKAKIGLIQFQISPPKPDTENNIIVNDYRQMDKILKEERAYLLNICKKIKKAKCNVLLIQKSILRDAVNDLALHFLSKLNIMVVKDIEREEIEFLSKGLGCKPIADIELFTEDRLGSADLVEEIDSDGSKIVRVTGIRNNNARPTVSVVIRGANNMIIDETERSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLSKEARSMEGVQAFIWQEFASALEVIPTTLAENAGLNSIKVVTELRSKHENGELND---GISVRRSGTTNTYEEHILQPVLVSTSAITLASECVKSILRIDDI 524          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO35415 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL4])

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 348/527 (66.03%), Postives = 431/527 (81.78%), Query Frame = 2
Query:   80 MPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKK 1660
            M V++LN N +R  G+KVQ  N+ AAK +AD+IRTCLGPRAMLKMLM P GGIVMTNDGNAILREI V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE +S A   L+Q++HPT+II+AYR A+DD ++ +K    V +D +NR+EMLK+I+S +GTKFINKW DLAC IALDAV  V  D   +KEIDIK Y K+EK+PGG IEDS VL+GV+ NKD+ H +M+RRIENPRI+LLD ++EYKKGESQTS+E++ + +  R LQLEEE+++K+C ++I +KPDLVITEKG+SDLAQH+ +KANI+ +RR+RKTDN R+AR CGA+I++  +E KEEDIGTGAGLFE+   GDEYFTFITEC  PKAC+ILLRG+SKDVLNE+ERNL DAM+VARNV+++  LVPGGGA EMA++  LT KA+ + GV+Q  Y AVA  LEVIPRTL QNCGA  +R IT LRAKHA +   +W  G+DGE G IVDM++LGVWD   V+AQ  KTA+ET++LLLRIDDI+SGTKK
Sbjct:    1 MSVIVLNQNTKRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLKMLMDPMGGIVMTNDGNAILREIQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISVPVDIDNREEMLKIIRSSVGTKFINKWGDLACNIALDAVKTVALDRGDRKEIDIKNYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECNNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRAKHAAEGNTSW--GIDGESGQIVDMQELGVWDTYAVKAQTFKTALETAMLLLRIDDIVSGTKK 525          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO31685 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX65])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 292/545 (53.58%), Postives = 372/545 (68.26%), Query Frame = 2
Query:   80 MPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCV---------------HIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSI---GVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKK 1660
            M V++LN N +R  G+KVQ  N+ AAK +AD+IRTCLGPRAMLK                     I V+ PAAKSMIEI+RTQDEEVGDGTTSVIILAGE +S A   L+Q++HPT+II+AYR A+DD ++ +K                         + D+++           +N+W DLAC IALDAV  V  D   +KEIDIK Y K+EK+PGG IEDS VL+GV+ NKD+ H +M+RRIENPRI+LLD ++EYKKGESQTS+E++ + +  R LQLEEE+++K+C ++I +KPDLVITEKG+SDLAQH+ +KANI+ +RR+RKTDN R+AR CGA+I++  +E KEEDIGTGAGLFE+   GDEYFTFITECK PKAC+ILLRG+SKDVLNE+ERNL DAM+VARNV+++  LVPGGGA EMA++  LT KA+ + GV+Q  Y AVA  LEVIPRTL QNCGA  +R IT LR          W++    +DG                            +T++LLLRIDDI+SGTKK
Sbjct:    1 MSVIVLNQNTKRESGRKVQLGNVQAAKTIADIIRTCLGPRAMLK---------------------IQVKHPAAKSMIEISRTQDEEVGDGTTSVIILAGEFMSVAEPFLEQQMHPTQIIAAYRLAMDDMIDILKQQISRHHHCHHHHHHHPDYRQHHKHHHDQLI----------LLNQWGDLACNIALDAVKTVALDRGDRKEIDIKSYAKVEKVPGGEIEDSKVLTGVMINKDVTHGRMKRRIENPRIMLLDCNLEYKKGESQTSLELSSDTDFSRVLQLEEEFIKKMCDEVIALKPDLVITEKGISDLAQHFLMKANITAIRRVRKTDNNRIARACGATIVNRTEELKEEDIGTGAGLFEVNKFGDEYFTFITECKNPKACTILLRGASKDVLNEVERNLQDAMNVARNVIVDPRLVPGGGACEMALAHALTEKAKLVAGVQQWPYKAVAKGLEVIPRTLIQNCGANTIRTITALRTS-----GGGWTVIQRRIDG----------------------------QTAMLLLRIDDIVSGTKK 481          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO39756 (T-complex protein 1 subunit alpha [Source:UniProtKB/TrEMBL;Acc:A7S924])

HSP 1 Score: 266.159 bits (679), Expect = 4.269e-82
Identity = 167/494 (33.81%), Postives = 275/494 (55.67%), Query Frame = 2
Query:  236 IVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEED------IGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGG 1678
            + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+ILA ELL  A  L++QKIHPT IIS YR A  ++ +Y++ H  + +D   RD ++    + L +K I +  D    + +DAV  V  T   G+ +  IK  + + K  GG+ ++S+++ G   N  I    M +++ N +I  LD +++  K     S+ +++   +    + E +  ++    I+    ++V++  G+ DL   YFV+     +RR++K D  R+AR  GA+++ ++   + E+      +G    + + ++  DE    I   K   + SI+LRG++  +L+E+ER++ DA+ V + V+   TLVPGGGA+E A+S +L   A ++    Q A    AN+L VIP+ L+ N       L+ +LRA H     N       W IG+D  EG + D KK GV++P   + + LK A E ++ +LRIDD++  T ++K  GG
Sbjct:    2 VTVTNDGATILKLLEVEHPAAKILCELADLQDQEVGDGTTSVVILAAELLKGANELVKQKIHPTSIISGYRLACKEACKYIQEHMTISVDELGRDCIVSAANTALSSKLIGQQGDFFANMIVDAVMAVKRTGNKGEAKYPIKA-INVLKAHGGSAKESILVDGYALNCTIASQAMPKQVTNAKIACLDFTLQKAKMHLGVSVVVDDPEKLEAIRKRESDITKERIQKILASGANVVLSTGGIDDLCLKYFVECGAMAVRRVKKGDLKRIARSTGATMVLSLANLEGEESFDASMLGQAEEVCQQRICDDE-LIVIKGTKARSSSSIILRGANDYMLDEMERSMHDAICVVKRVLESKTLVPGGGAVEAALSIYLENFATSLGSREQLAIAEFANSLLVIPKILSVNAAKDSADLVAKLRAFHNTSQINAERSHLKW-IGLDLVEGTVRDNKKAGVFEPAICKIKSLKFATEAAITILRIDDMIKLTPEKKEEGG 492          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO48692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIF0])

HSP 1 Score: 267.314 bits (682), Expect = 5.401e-82
Identity = 161/539 (29.87%), Postives = 286/539 (53.06%), Query Frame = 2
Query:   86 VMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHP--KMRRRIENP-RILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGD 1681
            +++L       QG      NI A + +AD +RT LGPR M K+++   G   ++NDG  I+  + +  PAAK++++IA++QD EVGDGTTSV +L GE L Q    +++ +HP  I+ +YR+A + +++ +K    VH+   +  EM ++++ C    L +K I    +   K+ +DAV  +        E+     + ++K+ GGA+EDS+++ GV F K   +   +M+ +  N  +I LL++ +E K  +    + ++  ++    +  E + +      +++    +V+++  + D+A  YF   ++    R+ + D  R  + CG +I ++++   ++ +G    LFE K +G E + F + CK+   C+I++RG ++  + E ER+L DA+ + R  M  + +V GGGA+EM +S +L   ++ I G  Q    A+A A E+IPR L  N G     ++ +LR KH       W  GVD     I D  +  VW+P  V+   +  A E S L+L +D+ +   K     GGD
Sbjct:    5 IILLKEGTDASQGIPQLISNIDACQFIADAVRTTLGPRGMDKLIVDGRGKATISNDGATIINLLDIVHPAAKTLVDIAKSQDAEVGDGTTSVTLLTGEFLKQVKQFVEEGVHPQIIVKSYRKAANLAIKRIK-ELAVHVKKNDAGEMRQLLERCAATALSSKLIATQKEFFAKMVVDAVMML-------DELLPLDMIGMKKVSGGALEDSMLIEGVAFKKTFSYAGFEMQPKTYNHCKIALLNVELELKAEKENAEVRLDNVKDYQSIVDAEWDILYDKLDKVVKSGAKVVLSKLPIGDVATQYFADRDMFCAGRVTEEDLKRTMKACGGAIQTSVNSMTDDVLGR-CDLFEEKQVGGERYNFFSGCKQSTTCTIIMRGGAEQFMEETERSLHDAIMIVRRAMKNDAVVAGGGAIEMELSKYLRDYSRTIAGKEQLLIGAMAKAFEIIPRQLCDNAGFDATNILNKLRQKHFQ--GGQW-YGVDINREDIADNFEACVWEPAVVKINAITAATEASCLILSVDETIKNPKS----GGD 527          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Match: EDO49571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP0])

HSP 1 Score: 260.381 bits (664), Expect = 1.940e-79
Identity = 158/524 (30.15%), Postives = 290/524 (55.34%), Query Frame = 2
Query:   83 PVMILNSN--ARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKA-HTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKL-IGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDI 1642
            P +IL      +R+ G + Q+ +I AA+ VA +++T LGP+ M KM++SP G + +TNDG  IL  + V+   AK M+E++++QD E+GDGTT V++LAG LL  A  LL   IHP +I   Y  A   +LE+M +      +D +N++ +++   + LG+K +++      +IA+DAV  V   E  +K++D +  +K+E   GG ++D+V++ GV+ +KD+ HP+M + +++ +I +L    E  K +++  +++    +  +  + E E   ++   +     +L I + G  D A H  ++ ++  +R +   +   +A   G  I+    E   E +G    + E+      +    I EC   +A +I +RG +K ++ E +R++ DA+ V RN++ ++ +V GGGA E++ S  +  +A  I  + Q A  A A+AL+ IP  LA+N G   ++ + +++++   +   N  +GVD  +  I DMK   V + L  + Q +  A +   ++L+IDDI
Sbjct:   21 PFIILKEQEEQKRLTGLEAQKSHILAARAVASILKTSLGPKGMDKMMVSPDGEVTVTNDGATILGMMEVDHQIAKLMVELSKSQDNEIGDGTTGVVVLAGALLEHAEQLLDWGIHPIRIADGYELAAKIALEHMDSIADNFPVDKDNKESLIQTAMTTLGSKIVSRCHRPLAEIAVDAVLSVADLE--RKDVDFE-LIKVEGKEGGKLDDTVLVKGVVVDKDMSHPQMPKVVKDAKIAILTCPFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQVKDTGANLAICQWGFDDEANHLLLQNHLPAVRWVGGPEIELIAIATGGRIVPRFSELTSEKLGKAGIVRELSFGTTKDKMLVIEECHNSRAVTIFIRGGNKMIVGEAKRSIHDALCVVRNLVRDSRVVYGGGATELSCSIAIAKEADKISTIEQYAMRAYADALDNIPLALAENSGLNPIQTVADIKSRQVAE--KNPRLGVDCMDSGINDMKTQHVIETLIGKKQQISLATQLVKMILKIDDI 539          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 342/540 (63.33%), Postives = 431/540 (79.81%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE 1690
            M    V++LN N +R  G+KVQ  NI+AAK +ADVIRTCLGPRAM+KML+ PTGGIVMTNDGNAILREI V+ PAAK+MIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT IISAYR+AL+D LE +K      +D+ +R  MLK++ S + TK + +WSDLAC IALDAV  V  +ENG+KEIDIK Y K+EK+PGG IEDS VL GV+ NKD+ HPKMRR I+NPRI+LLD S+EYKKGESQT +EI++E +  R LQ+EE+Y++++C DI+R+KPDL+ TEKG+SDLAQHY VKANI+ +RR+RKTDN R+AR CGA I+S  DE +EED+G GAGLFE+K IGDEYFTFITECK+PKAC+ILLRG+SK++L E+ERNL DAM V RNV+++  L+PGGGA+EMA+S  LT +++ + G+ Q  Y AVA ALEVIPRTL QNCGA  +R++T LRAKH  +    W  G++GE G + DM  LG+W+PL V+AQ  KTA+ET++LLLRIDDI+SG KK+    G  AE
Sbjct:    1 MMGQQVLVLNQNVKRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALK-EVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRAKHTQEGNVGW--GINGESGCLTDMSTLGIWEPLAVKAQTYKTAVETAILLLRIDDIVSGHKKKDKADGQGAE 537          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct3 (chaperonin containing TCP1 subunit 3 [Source:NCBI gene;Acc:105355033])

HSP 1 Score: 680.633 bits (1755), Expect = 0.000e+0
Identity = 326/547 (59.60%), Postives = 411/547 (75.14%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELR----------------------------------AKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIE 1609
            M    V++LN N +R  G+KVQ  NI+AAK +ADVIRTCLGPRAM+KML+ PTGGIVMTNDGNAILREI V+ PAAK+MIEI+RTQDEEVGDGTTSVIILAGE+LS A   L+Q++HPT IISAYR+AL+D LE +K      +D+ +R  MLK++ S + TK + +WSDLAC IALDAV  V  +ENG+KEIDIK Y K+EK+PGG IEDS VL GV+ NKD+ HPKMRR I+NPRI+LLD S+EYKKGESQT +EI++E +  R LQ+EE+Y++++C DI+R+KPDL+ TEKG+SDLAQHY VKANI+ +RR+RKTDN R+AR CGA I+S  DE +EED+G GAGLFE+K IGDEYFTFITECK+PKAC+ILLRG+SK++L E+ERNL DAM V RNV+++  L+PGGGA+EMA+S  LT +++ + G+ Q  Y AVA ALEVIPRTL QNCGA  +R++T LR                                  AKH  +    W  G++GE G + DM  LG+W+PL V+AQ  KTA+E
Sbjct:    1 MMGQQVLVLNQNVKRESGRKVQTGNISAAKMIADVIRTCLGPRAMMKMLLDPTGGIVMTNDGNAILREIQVQHPAAKTMIEISRTQDEEVGDGTTSVIILAGEMLSIAEHFLEQQMHPTVIISAYRQALEDMLEALK-EVSTPVDTSDRSMMLKIVNSAINTKALFRWSDLACTIALDAVRTVELEENGRKEIDIKNYAKVEKVPGGFIEDSCVLKGVMINKDVTHPKMRRMIKNPRIVLLDCSLEYKKGESQTDIEISKEEDFSRILQMEEDYIQQICEDIVRLKPDLIFTEKGISDLAQHYLVKANITAIRRVRKTDNNRIARACGARIVSRTDELREEDVGLGAGLFEVKKIGDEYFTFITECKDPKACTILLRGASKEILAEVERNLQDAMQVCRNVLLDPFLLPGGGAVEMAVSKRLTERSRALTGIEQWPYRAVAQALEVIPRTLIQNCGASTIRVLTSLRVQKTQNINILLFLMASGVIFFLFKNFKKIIFLVQAKHTQEGNVGW--GINGESGCLTDMSTLGIWEPLAVKAQTYKTAVE 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: tcp1 (t-complex 1 [Source:NCBI gene;Acc:101175451])

HSP 1 Score: 276.174 bits (705), Expect = 9.497e-85
Identity = 177/545 (32.48%), Postives = 292/545 (53.58%), Query Frame = 2
Query:   95 LNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVT-TDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIG-----------DEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPAN------NWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGG 1675
            LN   +R  G+ V+ QN+ AA  +A+++++ LGP  + KML+   G + +TNDG  IL+ + VE PAAK + E+A  QD+EVGDGTTSV+ILA ELL  A  L++QKIHPT +I+ YR A  +++ Y+  +  +  D   R+ ++   K+ + +K I   SD    + +DA   V   D  G  +  I   V + K  G + E+S +++G   N  +    M +RI N +I  LD S++  K +    + I++   + +  Q E +  ++    I+    ++V+T  G+ D+   YFV +    +RR+ K D  R+A+  GA +  ++   + E+       FE  ++G           D+    +   K   + SI+LRG++  + +E+ER++ DA+ V + V+   ++VPGGGA+E A+S +L   A ++    Q A    A +L VIP+TLA N       L+ +LRA H     N       W IG+D   G   D ++ GV++P  V+ + LK A E ++ +LRIDD++    + K GG
Sbjct:    8 LNVFGQRSTGESVRTQNVMAAASIANIVKSSLGPYGLDKMLVDDIGDVTITNDGATILKMLEVEHPAAKVLCELADLQDKEVGDGTTSVVILAAELLKSADELVKQKIHPTSVINGYRLACKEAVRYINENLTIGTDDLGRECLINAAKTSMSSKIIKVDSDFFANMVVDAALAVKFVDSKGVAKYPINS-VNVLKAHGRSQEESFLVNGYALNCTVGSQGMVKRIVNAKIACLDFSLQKAKMKMGVQVIISDPEKLDQIRQRESDITKERIQKILAAGANVVLTTGGIDDMCLKYFVDSGAMAVRRVLKRDLKRIAKATGAIVCPSLSNLEGEET------FETTMLGQAEEVVQERICDDELILVKNTKVRSSASIILRGANDFMCDEMERSVHDALCVVKRVLESKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPKTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKW-IGLDLLNGKPRDNRQAGVYEPTMVKTKSLKFATEAAITILRIDDLIKLFPEPKEGG 544          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct7 (chaperonin containing TCP1 subunit 7 [Source:NCBI gene;Acc:101173660])

HSP 1 Score: 274.633 bits (701), Expect = 5.004e-84
Identity = 171/540 (31.67%), Postives = 281/540 (52.04%), Query Frame = 2
Query:   47 KYLTYQLRMSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSC----LGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMR---RRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDIL 1645
            K L    +M   PV++L       QG      NI A + +A+ +RT LGPR M K+++   G   ++NDG  IL+ + V  PAAK++++IAR+QD EVGDGTTSV +LA E L Q    +++ +HP  II A+R A + ++  +K    V +  +++ E  ++++ C    L +K I    +   K+ +DAV  +        E+   + + I+K+ GGA+EDS ++SGV F K   +       +R +NP+I LL++ +E K  +    + +         +  E   +      I +    +V+++  + D+A  YF   ++    R+++ D  R    CG SI +++    E+ +G    +FE   +G E + F   C + K C+I+LRG ++    E ER+L DA+ + R  +  +++V GGGA+EM +S +L   ++ I G +Q    A A ALE+IPR L  N G     ++ +LRAKHA      W  GVD     I D     VW+P  VR   L  A E + L+L +D+ +
Sbjct:   20 KLLERTAKMMPTPVILLKEGTDSSQGIPQLVSNINACQVIAEAVRTTLGPRGMDKLMVDARGKATISNDGATILKLLDVVHPAAKTLVDIARSQDAEVGDGTTSVTLLAAEFLRQLKPFVEESLHPQTIIRAFRTATNLAVSKIK-EIAVSVKKDDKQEQRQLLEKCAATALNSKLIAGQKEFFSKMVVDAVMSL-------DELLSLKMIGIKKVQGGALEDSQLVSGVAFKKTFSYAGFEMQPKRYDNPKIALLNVELELKAEKDNAEVRVKSVEEYQAIVDAEWNILYDKLEKIYQSGAKVVLSKLPIGDVATQYFADRDLFCAGRVQEEDLKRTMMACGGSIQTSVGALTEDVLGL-CEVFEEVQVGGERYNFFKGCPKAKTCTIILRGGAEQFTEETERSLHDAIMIVRRAIKNDSIVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRAKHAQ--GGMW-YGVDINNEDIADNFAAFVWEPSIVRINALTAASEAACLILSVDETI 547          
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Match: cct4 (chaperonin containing TCP1 subunit 4 [Source:NCBI gene;Acc:101174887])

HSP 1 Score: 261.536 bits (667), Expect = 1.548e-79
Identity = 167/518 (32.24%), Postives = 290/518 (55.98%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGV-----SDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS 1648
            R +  +++  NI+AAK VAD +RT LGP+ M KM+    G + +TNDG  IL+++ V  P+AK ++E+++ QD E GDGTTSV+I+AG LL   + LLQ+ IHPT I  ++++A+D  +E +   +   ++  +R+ +L    + L +K ++++S L   +++DAV +V  D      +D+   +KI K  GG I+D  ++ G++  + +    +  R+E  +I L+   +   K +    + +++   M R L+ E  Y+  L   + +   ++++ +K +     SDLA H+  K  I V++ + + +   + +  G   I++ID    E +GT     EI L G      IT C  P K  SI++RGS+K V++E ER++ DA+ V R ++ +  L+ GGGA E+ ++  LT  ++ + G+      A  +ALEVIP TLA+N G   +  +TELR KHA     +   G++  +G I ++ +  V  P+ V    L  A ET   +L+IDD+++
Sbjct:   24 RDKPAQIRFSNISAAKAVADAVRTSLGPKGMDKMIQDEKGDVTITNDGATILKQMQVLHPSAKMLVELSKAQDVEAGDGTTSVVIIAGALLEACSKLLQKGIHPTIISESFQKAVDKGVEVLNGMS-RPVELSDRESLLNSATTSLCSKVVSQYSSLLAPMSVDAVMRV-IDPATATGVDLNN-IKIIKKLGGTIDDCELVEGLVLTQRVASTGV-TRVEKAKIGLIQFCLSPPKTDMDNQIVVSDYAQMDRVLREERSYILNLVKQVKKAGCNVLLIQKSILRDALSDLALHFLNKMKIMVVKDIEREEIEFICKTIGTKPIAHIDHFTPEMLGTAELAEEISLDGSGKLVKITGCSSPGKTVSIVVRGSNKLVIDEAERSIHDALCVIRCLVKKRALIAGGGAPEIELAVRLTEYSRTLAGMEAYCVRAYGDALEVIPSTLAENAGLNPISTVTELRNKHAQ---GDKMAGINVRKGGISNILEELVVQPVLVSISALTLATETVRSILKIDDVVN 534          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000066978.1 (SMESG000066978.1)

HSP 1 Score: 1100.89 bits (2846), Expect = 0.000e+0
Identity = 539/540 (99.81%), Postives = 540/540 (100.00%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE 1690
            MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVH+DSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE
Sbjct:    1 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHVDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE 540          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000075311.1 (SMESG000075311.1)

HSP 1 Score: 763.066 bits (1969), Expect = 0.000e+0
Identity = 364/530 (68.68%), Postives = 441/530 (83.21%), Query Frame = 2
Query:   74 SSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSGTKKQ 1663
            S +P+++L++N +R QGKKVQ  NI A K VADVIRTCLGPRAMLKMLM P GG VMTNDGNAILREITVE PAAKSMIEIARTQDEEVGDGTTSVIILAGE+L QA   L+ +IHPTKIISAYREAL+D LEYMK    +  D+ N  EM+K++KSCLGTKFI+KWSD+ACKI+L+AV +VT  ++G+KEIDIKR+ +IEKIPGGAIED  VL GV+FNKD +H +MRRRIENPRILLLD ++EYKKGESQT++E  +E +M RAL++EEEY+EK+C DIIR KPD+VITEK VSD AQH+ +KANI+V+RR+RK D  R+AR CGA+I++  +E KEEDIGTGAGLFE++ IGDEYFT++T+CK PKAC+I+LRG+SKD+LNE+ERNL DAM+VARNV++E  LVPGGGA+EMAIS  L    +  + V Q  YLAVA ALEVIPRTL QNCG  VLR ITELR+KH++D     + G+DG  GVI DMK+L + DPL V+ QV KTAIET++LLLRIDDI+SGTKKQ
Sbjct:    4 SGVPILVLSNNTKRTQGKKVQLVNIEAGKAVADVIRTCLGPRAMLKMLMDPMGGTVMTNDGNAILREITVEHPAAKSMIEIARTQDEEVGDGTTSVIILAGEMLCQAGPSLEMQIHPTKIISAYREALEDMLEYMKNDCSIEADTSNEAEMIKIVKSCLGTKFISKWSDMACKISLEAVRRVTIVQDGRKEIDIKRFARIEKIPGGAIEDCEVLDGVMFNKDPIHSRMRRRIENPRILLLDCNLEYKKGESQTAIEFVKELDMYRALKIEEEYIEKICEDIIRCKPDVVITEKSVSDYAQHFLIKANITVIRRIRKPDQARLARACGATIVNRTEEIKEEDIGTGAGLFEVRTIGDEYFTYVTKCKNPKACTIVLRGASKDILNELERNLQDAMNVARNVLLEERLVPGGGAVEMAISCFLKENVKTKLNVHQIPYLAVATALEVIPRTLIQNCGGDVLRTITELRSKHSLDNQKFVNYGIDGHNGVIADMKELEIMDPLQVKGQVFKTAIETAILLLRIDDIVSGTKKQ 533          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000078668.1 (SMESG000078668.1)

HSP 1 Score: 270.781 bits (691), Expect = 3.057e-83
Identity = 171/519 (32.95%), Postives = 289/519 (55.68%), Query Frame = 2
Query:  113 RVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEI-DIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEK-----GVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEPKA-CSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS 1648
            + +G  V+  NIAAAK VAD +RT LGPR M KM+    G + +TNDG  IL+ + +  PAA+ M++++++QD E GDGTTSV+++AG LL+  + LL + IHPT I  A+++A + + E +K H+   +D  NR+ +LK+  + L +K + ++S +   IA+DAV +     +    + DIK  +K     GG +ED+V++ G++ ++ +      +R+E  +I L++  I   K     S+ ++E   M R +  E +Y+  +   I     ++++ +K      ++DLA H+F K NI V++ + + D     +      I+++D     D+   A L E    G      ++    P    SIL+ GS+  VL+E ER+L DA+ V R ++ +  L+ GGGA E+A+S ++   +  + G+ Q    A A+ALE+IP TLA+N G   ++ +TELR +HA    N    G++ + G + D+    V  PL +    +  A ET   LL+IDDI++
Sbjct:   13 KSKGSAVRSSNIAAAKAVADTVRTSLGPRGMDKMIQESKGDVTVTNDGATILKRMKLLHPAAQMMVQLSQSQDIEAGDGTTSVVVIAGSLLTACSKLLDKGIHPTVISEAFQKAAEIACEVLKNHS-QEMDISNREILLKIASTSLNSKVVGQYSSVLAPIAVDAVLRAIDKTSHSVNLNDIKITMKF----GGTVEDTVLVDGLIIDRHVESICNVKRVEKAKIALIEFCISPPKTNMDHSVVVSEYSQMDRVISEERKYILNIAKTIKSSGCNVLLIQKSILRDAITDLALHFFSKLNIMVIKDIERNDVELYCKALNCKPIASLDHF-NPDMFAKADLVEEISAGTSRIVKVSGIVNPGPIVSILMFGSNHMVLHEAERSLHDALCVIRCLVKKPALIAGGGAPEIAMSQYIANYSTQVGGLMQYCLRAYADALEIIPYTLAENSGLSPIQTVTELRNRHARGEVN---AGINMKRGCVSDILADDVMQPLLINHSAITLATETVCALLKIDDIVN 522          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000067696.1 (SMESG000067696.1)

HSP 1 Score: 269.24 bits (687), Expect = 2.495e-82
Identity = 174/551 (31.58%), Postives = 294/551 (53.36%), Query Frame = 2
Query:   71 MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKV-TTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGL-----FEIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAM-----DPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILS---GTKKQKIGGGD 1681
            MSS     L     R  G  V+ QN+ A++ +A++++T LGP  + KML+   G + ++NDG  IL+ + VE PAAK ++E+A+ QDEEVGDGTTSV+I+A ELL  A   ++QKIHPT IIS YR A  ++ +Y++ +  + +D   ++ +    K+ + +K I   SD    +A++A   V  +D  G     IK  + + K  G ++++S+++ G   N  I   +M R I+  +I LLD S++  K +    + + +   +    + E +  ++    I++   ++++T  G+ D+   YFV+A    +RR +K D  R+A+  G S+  ++     E+    A L        + I D+    I  CK   A S++LRG++   ++E+ER++ D+  V + V+   ++VPGGGA E A+  +L   A  I    Q A    A AL VIP+ LA N       ++ +LRA H       D A+    G+D     + + K+ G+++P   + + LK A E ++ +LRIDD++      K +K G GD
Sbjct:    1 MSSNVTSNLAIGGERTTGDNVRRQNVLASQTIANIVKTSLGPVGLDKMLVDDVGEVTISNDGATILKLLEVEHPAAKILVELAQLQDEEVGDGTTSVVIIAAELLKLAEEQIKQKIHPTTIISGYRIACREACKYLQNNLTIDVDKLGKECITSAAKTSMSSKLIGIDSDFFANMAVEATMAVKVSDGKGGFRYPIKA-INVLKAHGKSMKESMLIHGYALNCTIASQQMPRTIKGAKIALLDFSLQKAKLKLGVQVLVTDPEKLEEIRKRESDITKEKIEKILKTGANVILTTGGIDDMCMKYFVEAKAMAVRRCKKVDLKRIAKATGGSLCVSLATMDGEEAFDQANLGYAEDVSQERICDDELILIKGCKARSAASVILRGANDFYVDEMERSIHDSFCVVKRVLESKSVVPGGGACEAALHVYLEKYAMTISSREQIAIAEFAKALLVIPKQLAVNAALDSTEMVAKLRALHHSSQQFPDLAHFKWYGLDLTNFNVSNNKEAGIFEPSMSKIKSLKFATEAAITILRIDDMVKLDEEKKPRKPGCGD 550          
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Match: SMESG000060610.1 (SMESG000060610.1)

HSP 1 Score: 263.077 bits (671), Expect = 3.618e-80
Identity = 162/513 (31.58%), Postives = 288/513 (56.14%), Query Frame = 2
Query:  131 VQEQNIAAAKHVADVIRTCLGPRAMLKMLMSPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIILAGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRDEMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVKIEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKGESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEK-----GVSDLAQHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLFEIKLIGDEYFTFITECKEP-KACSILLRGSSKDVLNEIERNLGDAMSVARNVMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRTLAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDPLPVRAQVLKTAIETSVLLLRIDDILSG 1651
            ++  NI AAK VAD IRT LGP+ M KM+    G + +TNDG  IL+ + +  PAA+ ++E+++ QD E GDGTT+V++LAG  L   + LL + IHPT I  ++  A   + E ++  +C  +D  +R+ +LK+  + L +K ++++S +   IA+DAV ++  D++    +++     + K+ GG +ED+ ++ G++ ++ +        +EN +I  +   I   K E + S+ +++   M R L+ E +Y+ ++   I     ++++ +K      VSDLA H+F K NI +++ + K     + +  G   I+N++    E +G    + E+  +G      +T  +   +  SILLRGS+K VL+E ER+L DA+ V R ++ +  LV GGGA E+ +   +   + ++ G  Q  + A A+A++VIP TLA+N G   +  +TELR  HA    N    G++ ++G ++++    V  PL V    +  A ET   +L+IDD+++G
Sbjct:   28 IRNSNILAAKAVADAIRTSLGPKGMDKMIQEGKGDVTITNDGATILKRMKLVHPAARMLVELSKAQDIEAGDGTTTVVVLAGSFLDACSKLLSKGIHPTTISDSFNLAASKAAEIIEGMSC-PVDLNDRNNLLKIASTSLNSKVVSQYSSVLSPIAVDAVLRI-QDDSLPNCVNLDDLNIVNKL-GGTVEDTELVDGLIIDRRVESLCNVFTVENAKIGFIQFCIAPPKAEMEQSIVVSDYTQMDRVLKDERKYILEIVKKIKASGCNVLLVQKNVLRDSVSDLALHFFNKMNIMIVKAIAKEKVEFICKTIGCKPIANVEYFNAECLGFAKRVEEVP-VGASRIVHVTGIEHHYQTVSILLRGSNKLVLDEAERSLHDALCVVRCLVKKKALVAGGGAPEIEVGQKMAAYSNSLSGKSQYCFRAFADAMDVIPYTLAENAGLNPIETVTELRHMHANGHIN---AGINIKKGCVINIMDEDVMQPLLVSLNAVSLAAETVCSILKIDDVVAG 533          
The following BLAST results are available for this feature:
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+063.65chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT30.000e+064.48chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT30.000e+058.19chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT36.314e-10965.56chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
CCT31.537e-9962.55chaperonin containing TCP1 subunit 3 [Source:HGNC ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct-30.000e+059.70T-complex protein 1 subunit gamma [Source:UniProt... [more]
cct-17.786e-9333.88T-complex protein 1 subunit alpha [Source:UniProt... [more]
cct-52.212e-8030.42T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-52.212e-8030.42T-complex protein 1 subunit epsilon [Source:UniPr... [more]
cct-47.200e-7934.89T-complex protein 1 subunit delta [Source:UniProt... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+064.91gene:FBgn0015019 transcript:FBtr0302371[more]
CCT30.000e+064.91gene:FBgn0015019 transcript:FBtr0302370[more]
CCT30.000e+064.91gene:FBgn0015019 transcript:FBtr0083337[more]
CCT30.000e+064.91gene:FBgn0015019 transcript:FBtr0083338[more]
CCT11.090e-8734.02gene:FBgn0003676 transcript:FBtr0084290[more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+063.48chaperonin containing TCP1, subunit 3 (gamma) [Sou... [more]
tcp12.890e-8732.74t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
tcp14.417e-8732.85t-complex 1 [Source:ZFIN;Acc:ZDB-GENE-990714-24][more]
cct71.375e-8231.77chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
cct56.890e-7831.24chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct33.455e-12964.16chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct78.604e-8331.24chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct71.755e-8231.68chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
TCP17.476e-8232.33t-complex 1 [Source:NCBI gene;Acc:100487607][more]
cct71.133e-8031.53chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cct30.000e+063.65chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct30.000e+063.16chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct30.000e+058.19chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Cct34.941e-12452.25chaperonin containing Tcp1, subunit 3 (gamma) [Sou... [more]
Tcp13.437e-8533.65t-complex protein 1 [Source:MGI Symbol;Acc:MGI:985... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3T0K2|TCPG_BOVIN0.000e+064.41T-complex protein 1 subunit gamma OS=Bos taurus OX... [more]
sp|P50143|TCPG_XENLA0.000e+064.97T-complex protein 1 subunit gamma OS=Xenopus laevi... [more]
sp|P48605|TCPG_DROME0.000e+064.91T-complex protein 1 subunit gamma OS=Drosophila me... [more]
sp|Q6P502|TCPG_RAT0.000e+063.84T-complex protein 1 subunit gamma OS=Rattus norveg... [more]
sp|P80318|TCPG_MOUSE0.000e+063.65T-complex protein 1 subunit gamma OS=Mus musculus ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NMS60.000e+071.00T-complex protein 1 subunit gamma OS=Schistocephal... [more]
A0A504YS000.000e+069.39T-complex protein 1 subunit gamma OS=Fasciola giga... [more]
A0A074ZMD90.000e+069.66T-complex protein 1 subunit gamma (Fragment) OS=Op... [more]
A0A5J4NT180.000e+069.45T-complex protein 1 subunit gamma OS=Paragonimus w... [more]
A0A068YCU00.000e+070.24T-complex protein 1 subunit gamma OS=Echinococcus ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+063.52chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp11.573e-8632.97t-complex 1 [Source:NCBI gene;Acc:103041096][more]
cct73.178e-8331.33chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct41.268e-7732.69chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct52.862e-7630.86chaperonin containing TCP1 subunit 5 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002042.10.000e+065.26pep scaffold:Pmarinus_7.0:GL484258:8021:13282:1 ge... [more]
cct44.077e-7732.16chaperonin containing TCP1, subunit 4 (delta) [Sou... [more]
cct54.834e-7630.11chaperonin containing TCP1, subunit 5 (epsilon) [S... [more]
cct71.473e-6831.15chaperonin containing TCP1, subunit 7 (eta) [Sourc... [more]
ENSPMAT00000002094.13.278e-2935.29pep scaffold:Pmarinus_7.0:GL480883:687:24332:1 gen... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CCT30.000e+057.01Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT58.887e-8030.00Subunit of the cytosolic chaperonin Cct ring compl... [more]
CCT78.411e-7930.57Subunit of the cytosolic chaperonin Cct ring compl... [more]
TCP18.573e-7931.70Alpha subunit of chaperonin-containing T-complex; ... [more]
CCT44.828e-7531.52Subunit of the cytosolic chaperonin Cct ring compl... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354150.000e+066.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316850.000e+053.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397564.269e-8233.81T-complex protein 1 subunit alpha [Source:UniProt... [more]
EDO486925.401e-8229.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495711.940e-7930.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cct30.000e+063.33chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
cct30.000e+059.60chaperonin containing TCP1 subunit 3 [Source:NCBI ... [more]
tcp19.497e-8532.48t-complex 1 [Source:NCBI gene;Acc:101175451][more]
cct75.004e-8431.67chaperonin containing TCP1 subunit 7 [Source:NCBI ... [more]
cct41.548e-7932.24chaperonin containing TCP1 subunit 4 [Source:NCBI ... [more]
back to top
BLAST of T-complex protein 1 subunit gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066978.10.000e+099.81SMESG000066978.1[more]
SMESG000075311.10.000e+068.68SMESG000075311.1[more]
SMESG000078668.13.057e-8332.95SMESG000078668.1[more]
SMESG000067696.12.495e-8231.58SMESG000067696.1[more]
SMESG000060610.13.618e-8031.58SMESG000060610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30006002 ID=SMED30006002|Name=T-complex protein 1 subunit gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=1816bp
ATAAGATTATTCTAGAATAACACTTGTTTTAATTAGTCTAATTTCAAAAT
ATTTAACTTATCAACTGAGAATGTCTTCAATGCCTGTAATGATTTTAAAT
TCAAACGCTAGGCGTGTGCAAGGTAAAAAAGTTCAAGAACAGAATATAGC
AGCCGCTAAGCATGTTGCAGATGTTATTAGAACCTGCTTAGGTCCAAGAG
CTATGTTAAAAATGTTAATGAGTCCAACTGGAGGCATTGTAATGACTAAT
GATGGAAATGCAATTTTAAGAGAAATTACTGTTGAACAACCAGCAGCAAA
ATCAATGATTGAAATTGCCAGAACACAAGATGAAGAAGTTGGTGATGGTA
CAACATCTGTTATTATTCTTGCCGGAGAATTATTAAGTCAAGCGACTGCA
TTATTACAACAGAAAATCCACCCGACTAAAATTATAAGCGCTTATCGAGA
AGCTCTAGATGATTCCTTGGAATACATGAAAGCCCACACTTGTGTCCACA
TTGATTCAGAAAATCGCGATGAAATGCTTAAAGTTATCAAAAGTTGTCTA
GGTACAAAATTTATTAACAAATGGTCGGATTTAGCTTGTAAAATTGCTCT
GGATGCCGTTTCTAAAGTAACTACTGATGAAAATGGTAAAAAAGAAATTG
ATATTAAACGTTATGTGAAAATTGAAAAAATTCCCGGTGGTGCCATTGAA
GATTCCGTCGTTTTGAGTGGAGTTTTGTTTAACAAGGATATTGTTCACCC
AAAAATGAGACGCAGAATTGAAAATCCTAGAATTCTTCTACTGGATTTGA
GTATTGAATACAAAAAGGGTGAATCGCAAACCTCTATGGAAATTAATGAA
GAACGTAATATGATTAGAGCTTTGCAATTGGAAGAAGAGTATGTCGAGAA
ATTGTGTGCAGATATTATCAGAATGAAACCTGATCTTGTTATAACTGAAA
AAGGTGTATCGGATTTAGCGCAACATTATTTCGTAAAGGCCAATATCAGT
GTTTTGAGGCGGCTAAGAAAAACTGATAACGTAAGAGTCGCCCGCTGCTG
TGGAGCAAGCATTATCAGTAACATCGATGAATGTAAAGAAGAAGATATTG
GAACAGGAGCTGGTTTATTCGAGATTAAATTGATTGGAGATGAATATTTC
ACTTTCATCACCGAATGCAAGGAACCGAAGGCTTGTTCGATTTTGTTGAG
AGGTAGCAGCAAAGATGTTTTGAATGAAATTGAGAGAAATCTCGGGGATG
CTATGTCTGTAGCGAGAAACGTTATGATGGAAAATACTCTCGTTCCTGGT
GGAGGAGCATTGGAGATGGCAATATCAACTCACTTGACCCTTAAAGCTCA
GAATATTGTCGGAGTACGACAAAATGCGTATTTGGCTGTTGCTAATGCAT
TGGAGGTTATTCCAAGGACTTTGGCCCAAAATTGTGGAGCAAAGGTGTTA
AGGTTAATAACGGAATTAAGAGCGAAGCACGCTATGGACCCGGCTAACAA
TTGGAGTATCGGTGTTGATGGAGAGGAGGGAGTTATTGTCGATATGAAGA
AATTGGGAGTCTGGGACCCGCTACCAGTTCGAGCTCAGGTCCTCAAAACT
GCCATTGAAACATCAGTTCTTTTATTGAGAATTGATGACATTCTTTCTGG
AACGAAAAAACAGAAAATTGGAGGTGGAGATGTCGCTGAATAATCGTGTT
TATATTTTGGAATATATTTTTCAGAAATTTAAAAAAAAAAACAGAAAATT
GGAGGTGGAGATGTCGCTGAATAATCGTGTTTATATTTTGGAATATATTT
TTCAGAAATTTAAAAA
back to top

protein sequence of SMED30006002-orf-1

>SMED30006002-orf-1 ID=SMED30006002-orf-1|Name=SMED30006002-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MSSMPVMILNSNARRVQGKKVQEQNIAAAKHVADVIRTCLGPRAMLKMLM
SPTGGIVMTNDGNAILREITVEQPAAKSMIEIARTQDEEVGDGTTSVIIL
AGELLSQATALLQQKIHPTKIISAYREALDDSLEYMKAHTCVHIDSENRD
EMLKVIKSCLGTKFINKWSDLACKIALDAVSKVTTDENGKKEIDIKRYVK
IEKIPGGAIEDSVVLSGVLFNKDIVHPKMRRRIENPRILLLDLSIEYKKG
ESQTSMEINEERNMIRALQLEEEYVEKLCADIIRMKPDLVITEKGVSDLA
QHYFVKANISVLRRLRKTDNVRVARCCGASIISNIDECKEEDIGTGAGLF
EIKLIGDEYFTFITECKEPKACSILLRGSSKDVLNEIERNLGDAMSVARN
VMMENTLVPGGGALEMAISTHLTLKAQNIVGVRQNAYLAVANALEVIPRT
LAQNCGAKVLRLITELRAKHAMDPANNWSIGVDGEEGVIVDMKKLGVWDP
LPVRAQVLKTAIETSVLLLRIDDILSGTKKQKIGGGDVAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000208testis
PLANA:0000219spermatogonial stem cell
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
Vocabulary: INTERPRO
TermDefinition
IPR012719Chap_CCT_gamma
IPR017998Chaperone_TCP-1
IPR027410TCP-1-like_intermed_sf
IPR027409GroEL-like_apical_dom_sf
IPR027413GROEL-like_equatorial_sf
IPR002423Cpn60/TCP-1
IPR002194Chaperonin_TCP-1_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0051082unfolded protein binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017998Chaperone tailless complex polypeptide 1 (TCP-1)PRINTSPR00304TCOMPLEXTCP1coord: 56..74
score: 38.56
coord: 407..419
score: 43.26
coord: 34..50
score: 33.7
coord: 86..105
score: 50.28
coord: 373..395
score: 29.96
IPR002423Chaperonin Cpn60/TCP-1 familyPFAMPF00118Cpn60_TCP1coord: 32..526
e-value: 6.9E-159
score: 529.6
IPR027410TCP-1-like chaperonin intermediate domain superfamilyGENE3DG3DSA:3.30.260.10coord: 144..404
e-value: 1.4E-175
score: 586.8
IPR027410TCP-1-like chaperonin intermediate domain superfamilySUPERFAMILYSSF54849GroEL-intermediate domain likecoord: 144..404
IPR027409GroEL-like apical domain superfamilyGENE3DG3DSA:3.50.7.10coord: 216..368
e-value: 1.4E-175
score: 586.8
IPR027409GroEL-like apical domain superfamilySUPERFAMILYSSF52029GroEL apical domain-likecoord: 211..378
IPR027413GroEL-like equatorial domain superfamilyGENE3DG3DSA:1.10.560.10coord: 25..524
e-value: 1.4E-175
score: 586.8
IPR027413GroEL-like equatorial domain superfamilySUPERFAMILYSSF48592GroEL equatorial domain-likecoord: 14..526
IPR012719T-complex protein 1, gamma subunitTIGRFAMTIGR02344TIGR02344coord: 5..531
e-value: 1.7E-258
score: 856.4
IPR012719T-complex protein 1, gamma subunitCDDcd03337TCP1_gammacoord: 5..527
e-value: 0.0
score: 821.541
NoneNo IPR availablePANTHERPTHR11353:SF24T-COMPLEX PROTEIN 1 SUBUNIT GAMMAcoord: 5..531
NoneNo IPR availablePANTHERPTHR11353CHAPERONINcoord: 5..531
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00995TCP1_3coord: 86..94
IPR002194Chaperonin TCP-1, conserved sitePROSITEPS00750TCP1_1coord: 37..49