Cyclic nucleotide gated channel alpha 3

Overview
NameCyclic nucleotide gated channel alpha 3
Smed IDSMED30005978
Length (bp)2073
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30005978h1SMcG0004190 SmedASXL_015383SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005978h1SMcG0004190 SmedASXL_015384SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005978h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005978h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005978h1SMcG0004190 dd_Smed_v4_12825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005978h1SMcG0004190 dd_Smed_v6_12825_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30005978h1SMcG0004190 SMED30010168smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30005978h1SMcG0004190 OX_Smed_1.0.22394ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 526.554 bits (1355), Expect = 9.347e-179
Identity = 270/526 (51.33%), Postives = 378/526 (71.86%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  141 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 651          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA3 (cyclic nucleotide gated channel subunit alpha 3 [Source:HGNC Symbol;Acc:HGNC:2150])

HSP 1 Score: 526.168 bits (1354), Expect = 1.848e-178
Identity = 270/526 (51.33%), Postives = 378/526 (71.86%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  159 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 517.309 bits (1331), Expect = 5.983e-175
Identity = 265/525 (50.48%), Postives = 379/525 (72.19%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1999
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  156 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 517.309 bits (1331), Expect = 5.983e-175
Identity = 265/525 (50.48%), Postives = 379/525 (72.19%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1999
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  156 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Match: CNGA1 (cyclic nucleotide gated channel subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:2148])

HSP 1 Score: 517.309 bits (1331), Expect = 5.983e-175
Identity = 265/525 (50.48%), Postives = 379/525 (72.19%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1999
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W I DY+ DIV +ID+F+ +RTG+LE GL+V +  K++  Y S L FKLD   ++P +L          +Y   R NRL +  ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C F+ IS +IG G+D +VYP             + +P + +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE+EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+DL  + N   +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  156 VVIDPSGNTYYNWLFCITLPVMYNWTMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNLQFKLDVLSLIPTDLLYF---KLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPD------------INDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILMKDGLLDLNIA-NAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 664          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-4 (Cyclic nucleotide-gated cation channel [Source:UniProtKB/Swiss-Prot;Acc:Q03611])

HSP 1 Score: 473.396 bits (1217), Expect = 9.226e-158
Identity = 256/504 (50.79%), Postives = 357/504 (70.83%), Query Frame = 2
Query:  548 YRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY---RFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQFTVI 2050
            +R +W  FD L+D V +ID F+  R G+++ GL+V + EK+ K Y     +++D   ++PL+ + L  P   I++      R NRL +  ++   ++RT+TR++ PN FR+  ++ +++IIIHWN C +F+IS  IGLG+D +VY    +    ++   +T   D     Y+Y+F+WSTL LTTI EVP PV N E+  +T++L+ GVLIFA+IVGNVGSMISN++A +T+FQ KMDG+K+YME R VSK+LE R+I WFDYLW NKQSL +++VL  LPDKL+AEIA+ VH+ET+R V +FQDCE  LL +L+LKL+LQVFSPGD+IC+KGDIG+EMYIVKRG+L VV +DG KVFVTL EGSVFGELSILNI GSK+GNRRTANVRSVGY+DLF L+K DLW+ L EYPDA+  L+ +G+EIL KDNL+D    EN       +E I   + +++K   +++++LI +    HSS + KL K  + +     EKH S++  +
Sbjct:  200 FRMLWVFFDLLMDCVYLIDTFLNYRMGYMDQGLVVREAEKVTKAYWQSKQYRIDGISLIPLD-YILGWPIPYINWRGLPILRLNRLIRYKRVRNCLERTETRSSMPNAFRVVVVVWYIVIIIHWNACLYFWISEWIGLGTDAWVY---GHLNKQSLPDDIT---DTLLRRYVYSFYWSTLILTTIGEVPSPVRNIEYAFVTLDLMCGVLIFATIVGNVGSMISNMSAARTEFQNKMDGIKQYMELRKVSKQLEIRVIKWFDYLWTNKQSLSDQQVLKVLPDKLQAEIAMQVHFETLRKVRIFQDCEAGLLAELVLKLQLQVFSPGDFICKKGDIGREMYIVKRGRLQVVDDDGKKVFVTLQEGSVFGELSILNIAGSKNGNRRTANVRSVGYTDLFVLSKTDLWNALREYPDARKLLLAKGREILKKDNLLD----ENAPEEQKTVEEIAEHLNNAVKVLQTRMARLIVE----HSSTEGKLMKRIEML-----EKHLSRYKAL 683          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-1 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:A8WI01])

HSP 1 Score: 335.88 bits (860), Expect = 1.368e-105
Identity = 213/577 (36.92%), Postives = 323/577 (55.98%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFI--FDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGS----------DGFVYPPRS-------------NSTDMTIA-IPVTE----------PWDQ---------FPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQS-LDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNG-MENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*E 2023
            VD  SN +Y W G +++  L  ++      A  + Q  + ++      + L+D+VNI+DL   +R  ++E G+ V +  K++ + +    F LD   ++P E   +   S    + W R NRLTK Y+LF+F  +TDTRT  P+ F +  LI   ++I HWNGC +F+IS      +          D  + P  +             ++ D+ I  +P  E           W+          F   Y  +F+WS LTL T+ E P P   F+      + L G++IFA IVG+VG+M+  +N  K++F+  +DG KR+M +R V   L K+ + +F Y+W +  + +DEEE+   LP +L  EIA+ +H +T++ V +F+ C+  LL +LILKL+L+V+SP DYIC+KGD+G EMYIVK G + VV+EDG  +FVTL  G VFGELSILNIPG+K+ N RTA+VRS GYSDL+ L+K+DLW+ L EYP AK  LIQ+G +IL KD +ID    ++   + NG +E+ +  +E  I      I Q  +    ++  MK +L  +E  +   I E
Sbjct:   73 VDEHSNTFYLWTGLVSLVALHPLVF----TALSVFQDVHPFLRNTGPLNLLLDLVNILDLIAHTRIEYVENGVAVKNLSKLMHHRLKSTFFILDVIAVVPAESLHIFGDS----FFWSRINRLTKCYRLFDFSTQTDTRTTSPHAFGLFKLIFICVVIFHWNGCLYFYISKVYNYTTARLEHWIFSYDKIINPILATCVTDIPNHRDFCDTDDLLITHLPENEVQFTVTDYMTTWENKTTTIKFANFFRQYALSFYWSALTLVTLGEQPSPCTTFQNAFEIGDTLLGLVIFAVIVGDVGNMVVAINLRKSEFENVLDGCKRFMVYRKVPNLLRKKAVEYFAYVWAHGGAQVDEEEIAEFLPPRLFGEIAVEIHMDTLKKVKLFESCDPRLLYELILKLQLRVYSPMDYICKKGDVGTEMYIVKEGFVEVVSEDGQTIFVTLPAGFVFGELSILNIPGNKNKNLRTASVRSKGYSDLYVLDKEDLWEALHEYPQAKDSLIQKGIQILEKDKMIDPNMVDDEDESFNGPIEDYMEHLEHEILKITKMIDQAEDKIHKSNQKMKTRLFGMEMDLVHEIKE 641          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: cng-2 (Cyclic Nucleotide Gated channel [Source:UniProtKB/TrEMBL;Acc:Q9N4C1])

HSP 1 Score: 288.115 bits (736), Expect = 4.248e-86
Identity = 187/600 (31.17%), Postives = 310/600 (51.67%), Query Frame = 2
Query:  383 QNKTFFTKIN---------LWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRY--MWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSD-----GF----VYPPRSNSTDMTIAIPVTEP----------------------WDQ---------FPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMEN-----------IINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1996
            Q +T FT+I          L+Y +V    +S  +Y W   +++ IL+N+  + +   F      + Y   W   +   D   ++D  +GSR  F+  G  V+  +KM KNY      KLD   + P + +  I    ++     R  RL K Y+L+EFI  T  RT+FP+  +I  L     I+ HWN C +F  S   GL  D     GF    V+ PR +  D         P                      WD+         F   Y    +WS+LT+T   + P P  + +  +   + L GVL+FA+I+G VGS+++ ++    DF+  MDG+K YM++RGV   ++ R++N F YL  + Q  DEEE+LS LP   +A IA ++H +T+  VS+F  C+Q LL ++++ +K QV+SP DY+CRK +  KEM+IVK+G L V+ +D      +L EG  FGELSI+ + G+  G+RR+ ++RSVGYSD++ L++DD+  +L EYP+ +++L++  + +L    L++      +   D+G+++            +N++E+ I   D+ ++ +I  F     + K +++ +E
Sbjct:  200 QRQTGFTQIKDILTDKCRKLYYFYVT--ENSTFFYYWTAIISIGILYNMFAMVI---FIFDDVHFGYFNQWLYVNLFFDFCFLLDCLVGSRMTFVSEGNEVSQTDKMFKNYRQSRRCKLDLLCLAPADFYLFIDTKASL----VRAIRLVKAYRLYEFIMLTQRRTDFPHFMKILFLTSSCAILFHWNACVYFLFSLYQGLTEDDPNAFGFSYYKVFDPRFSICDALYDQDCYYPEDTEVLDIRDERPHYMEDMYKFWDKKFNILQIGNFSREYSMTIYWSSLTITKCGQQPWPSKSSQNSLEIFDTLIGVLVFATIIGGVGSVVTQMSQNVNDFREMMDGIKFYMKYRGVQSAIQDRVLNCFLYLNSHNQLYDEEEILSLLPPFFQARIAANLHQDTLSKVSLFYKCDQRLLQEVVMLVKQQVYSPNDYLCRKNEKAKEMFIVKKGLLAVIDDDTGVELDSLKEGHTFGELSIVQVKGNILGDRRSVSLRSVGYSDVYVLHQDDVTRLLQEYPEERVRLMENARRMLHSRGLLETNELGEMCETDDGLDDEAMLEFLSVDEQLNRLENIIDSIDTDLANMITSFSYNSVAYKKRVTALE 790          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: che-6 (pep chromosome:WBcel235:IV:2104056:2111408:-1 gene:WBGene00000487.1 transcript:C23H5.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:che-6)

HSP 1 Score: 254.603 bits (649), Expect = 5.000e-75
Identity = 170/572 (29.72%), Postives = 301/572 (52.62%), Query Frame = 2
Query:  443 SSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYI-SKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSD-----GFVYP-------PRSNS-----------TDMTIAI---------PVTEPWD---------QFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLI------------DLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1996
            +S  YY W   ++  +++N+  + +   F   +  Y + W   + + D+V I+D+F+ SR  +L  G  V + +K+ KNY   KL    D   +LPL+       S ++     R  R+ K+ +L +F+ RT  +T FP  F+I  L +  +++ HWN C +F  S   G+  +     GF Y        P   +            D T+ +          + E W           F   Y  + +WS LT+TT  + P P  + +  +   + L GVL+FA+I+G+VGS+++ ++    +F+  MDG+K YM++R V+  +++R ++ F YL  + Q  DEE +LS LP +L+A IA ++H ET++N+ +F  CE   + +++L +K QVFSP DY+CRK +  KE++IVK+GKL V+ +D  +    L EG+ FGELSI+ + G+  G RR  +++SVG+SD++ L +DD+  +L E+P     ++   + +L    L+            D E +++++L +  +   +N++   I G +  ++ +I  F  + S  K K++ +E
Sbjct:   64 NSKYYYIWSFFVSFGVMYNMFAMVI-FIFADIKTQYFWNWIFLNVMFDMVFIVDIFVQSRLTYLHEGEEVKNTKKLRKNYFFQKLKVANDIFCLLPLDFLLFFDDSMSL----VRTIRIVKVIRLMDFVQRTQQQTTFPRAFKIILLAVSCIVLFHWNACLYFLFSLYEGITEESQTEFGFSYYKVFEPVFPTCQAYYDENCWFGEDIDHTLDLDDVRDSYKKEMAEYWKDKHYRWTTGNFSREYSMSIYWSALTITTCGQQPWPSTSSQNSLEVFDTLIGVLVFATIIGSVGSVVTQMSQTVNEFRQMMDGIKFYMKYREVNSAIQERALSCFMYLMAHNQLDDEEGILSLLPPRLQANIAANLHMETLQNIQIFALCESRFMHEVVLLVKQQVFSPNDYLCRKNEKAKELFIVKKGKLRVIDDDTGEEMGELTEGATFGELSIVYVKGNLLGTRRCCSLQSVGFSDIYVLYRDDVSRLLQEFPQEYKTIVMNARNLLHSRGLLETTELGEMCDPSDHEEADDLVLEEMSVVEQLNRLNGIIDGLNGNMNVMILSFSNSCSYYKQKITGLE 630          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Match: tax-2 (TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2])

HSP 1 Score: 249.21 bits (635), Expect = 6.367e-72
Identity = 163/480 (33.96%), Postives = 253/480 (52.71%), Query Frame = 2
Query:  455 YYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIID-LFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGS-----------DGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAED-GIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENV 1855
            Y  W+  +T+  LFN   +P+R+++     D    WFI DY  D+V +ID L I  R  F   G+ V   +   ++Y+   +FKLD   ILP +L         I    +R NR+ KI   +   D  D     P   RI+  + +++ IIH N C ++ +S     G            + +VY  + N+                   Y+  F+++    T+    P P    E+I MT   + GV +FA ++G +  ++SN N  + +FQ KMD      +  G+  E   R+ +WF Y W  +++LDE++++  LP KL+ ++A+ VHY T+  V +FQDC+++LL  L+LKL+  +F PGD IC KGD+GKEMYI+ +G L VV  D   K+F  L +G+VFGE+S+L I G+   NRRTA++R+ GY  LF L K+DL DV+  YP A+  L ++   +L  D   D E +E +
Sbjct:  221 YMTWLSLVTLCFLFNAFCIPLRSSYPYQTADNWMYWFIVDYSCDLVYVIDMLLIKPRLRFTRGGIQVKIYKDTQRHYLMTRTFKLDILSILPTDLMYFFFGKMPI----WRINRVLKINSFWLLFDMLDNSFANPYAIRIARTLSYMIYIIHCNSCVYYKLSALQAFGQIAYLENGKWYLNKWVYNNQGNA-------------------YIRCFYFTAAVATSTGNNPAPTNVIEYIYMTCSWMMGVFVFALLLGQIRDIVSNANRNREEFQRKMDLALGECKKLGLKMETTNRVRDWFIYTWQQQKTLDEKKLIEKLPLKLQTDLALSVHYTTLSKVQLFQDCDRALLRDLVLKLRPVIFLPGDMICLKGDVGKEMYIINQGILQVVGGDHNEKIFAELAQGAVFGEISLLAIGGN---NRRTASIRAKGYCTLFVLAKEDLNDVIRYYPQAQTILRRKAAAMLKNDKKSD-EKTEKI 673          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302924)

HSP 1 Score: 462.611 bits (1189), Expect = 2.051e-154
Identity = 240/530 (45.28%), Postives = 347/530 (65.47%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVY---PPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1996
            VD +   +Y W+  +++ +L+N+I +  RA F+   K     W+  DYL D + ++D  +    GFL+ GL+V D  ++ ++Y     + LD   +LP +L  +  P +    ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F IS  IG  SD +VY     R+N+                   Y+Y+F+WSTLTLTTI E P P  + E++ +  + L GVLIFA+IVGN+GSMISN+N  + +FQ +MDGVK+YM FR V  ELE R+I WF Y W    +LDEE VL+ LPDKL+AEIAI VH +T++ V +F D E  LL  L+LKLKLQVFSPGDYICRKGD+GKEMYIVKRGKL+VV +DGI V  TL  GSVFGE+S+L I G+++GNRRTANVRS+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:  100 VDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVYNLNGTRNNT---------------LQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CngA (gene:FBgn0261612 transcript:FBtr0302925)

HSP 1 Score: 462.225 bits (1188), Expect = 6.324e-152
Identity = 240/527 (45.54%), Postives = 346/527 (65.65%), Query Frame = 2
Query:  434 VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWY------RFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIE 1996
            VD +   +Y W+  +++ +L+N+I +  RA F+   K     W+  DYL D + ++D  +    GFL+ GL+V D  ++ ++Y     + LD   +LP +L  +  P +    ++       R NRL +I +L+E+ DRT+T T +PN FRI  +++ +L++IHWN C +F IS  IG  SD +VY    N T            +     Y+Y+F+WSTLTLTTI E P P  + E++ +  + L GVLIFA+IVGN+GSMISN+N  + +FQ +MDGVK+YM FR V  ELE R+I WF Y W    +LDEE VL+ LPDKL+AEIAI VH +T++ V +F D E  LL  L+LKLKLQVFSPGDYICRKGD+GKEMYIVKRGKL+VV +DGI V  TL  GSVFGE+S+L I G+++GNRRTANVRS+GYSDLFCL K DLW+ L++YP+A+  L QRG ++L KD L+D +   +     + +E  I K+E S++  + ++++L+ ++  + + +K +L+K+E
Sbjct:  275 VDPTLQSHYRWLAIVSLAVLYNIIFVVGRAVFWEINKSAPAFWYTLDYLCDFIYLLDTLVHMHEGFLDQGLLVRDAFRLRRHYFHTKGWYLDVLSMLPTDLAYIWWPPETCSSLYLPCPVIVRLNRLLRINRLWEWFDRTETATGYPNAFRICKVVLAILVLIHWNACMYFAISYEIGFSSDSWVY--NLNGTRN----------NTLQRQYIYSFYWSTLTLTTIGETPTPENDVEYLFVVADFLAGVLIFATIVGNIGSMISNMNVARVEFQNRMDGVKQYMAFRRVGHELEARVIRWFAYTWSQSGALDEERVLAALPDKLKAEIAIQVHMDTLKQVRIFHDTEPGLLEALVLKLKLQVFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLELSVENLNMRLARLLAEYTASQAKIKQRLAKLE 789          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299573)

HSP 1 Score: 371.318 bits (952), Expect = 8.270e-116
Identity = 199/455 (43.74%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+    +GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  295 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 729          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0330241)

HSP 1 Score: 371.703 bits (953), Expect = 7.855e-114
Identity = 200/457 (43.76%), Postives = 300/457 (65.65%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNI--PGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+   G + GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  570 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNMGTAGKELGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1008          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Match: CG42260 (gene:FBgn0259145 transcript:FBtr0299572)

HSP 1 Score: 370.548 bits (950), Expect = 1.672e-113
Identity = 199/455 (43.74%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  425 HVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1789
            H V D +  L Y W   +++  L+N  ++  R AF    +    +WF  DYL D + +ID+    RTG+LE G++ TD  K+  +Y++   F +D   +LPL+   L   S   + +   F RL KIY+ + F+DRT+  TN+PN+FR ++LI +LL+I HWNGC +  I  + G GS  +VY   S S D+                Y+ +++W TL LTTI ++P+P    E++ + ++LL G+++FA+++G+V +++++V+A + +FQ K+DGVK YM  R V   L+ ++I WFDYLW+ ++  DEE  +S LPDKL+AEIAI+VH +T++ V +FQ+ E   L +L+L+L+  +FSPGDYICRKG++GKEMYIV RG+L VVA++G  V  +L  GS FGE+SILN+    +GNRRTA+VRSVGYSDLF L+K D+WDVL EYP A+++L
Sbjct:  570 HFVFDPAGRLCYYWSMVVSMAFLYNFWVIIYRFAFQEINRRTIAIWFCLDYLSDFLYLIDILFHFRTGYLEDGVLQTDALKLRTHYMNSTIFYIDCLCLLPLDFLYL---SIGFNSILRSF-RLVKIYRFWAFMDRTERHTNYPNLFRSTALIHYLLVIFHWNGCLYHIIHKNNGFGSRNWVYHD-SESADVV-------------KQYLQSYYWCTLALTTIGDLPKPRSKGEYVFVILQLLFGLMLFATVLGHVANIVTSVSAARKEFQAKLDGVKTYMRMRRVPNHLQVKVIKWFDYLWLTQKCSDEERAVSCLPDKLKAEIAINVHLDTLKRVEIFQNTEAGFLCELVLRLRPVLFSPGDYICRKGEVGKEMYIVNRGRLQVVADNGKTVMASLKAGSYFGEISILNM--GTAGNRRTASVRSVGYSDLFVLSKKDMWDVLKEYPAARVRL 1004          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 525.398 bits (1352), Expect = 4.428e-179
Identity = 268/525 (51.05%), Postives = 375/525 (71.43%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            VVD + N+YYNW+  +T  +++N I +  RA F   Q DY  +WF  DYL D V ++D+   +RTG+LE GL+V D++K+   Y   L F+LD   ++P ++F L      ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++  S +IG GSD FVYP  S+             + +    Y Y+ +WSTLTLTTI E P PV N E+  +  + L GVLIFA+IVGNVGSMI+N NA + DFQ ++D +K+YM FR V+K+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GS++GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  113 VVDPAGNMYYNWLFVITCPVMYNWIFIIARACFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYLYF---GMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPDPSDPE-----------FGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 523.472 bits (1347), Expect = 3.213e-178
Identity = 267/525 (50.86%), Postives = 374/525 (71.24%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            VVD + N+YYNW+  +T  +++N I +  R+ F   Q DY  +WF  DYL D V ++D+   +RTG+LE GL+V D++K+   Y   L F+LD   ++P ++F L      ++Y   R N+L +I +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++  S +IG GSD FVYP            P    + +    Y Y+ +WSTLTLTTI E P PV N E+  +  + L GVLIFA+IVGNVGSMI+N NA + DFQ ++D +K+YM FR V+K+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GS++GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNL+DLE ++    +   ME  + KI   ++   ++ ++L+ + E A   +K +++K+EK++
Sbjct:  119 VVDPAGNMYYNWLFVITCPVMYNWIFIIARSCFEELQGDYLILWFFLDYLSDAVYLLDMVFRTRTGYLEQGLLVKDQKKLRDRYTDSLQFRLDLASMVPTDIFYLYF---GMNYPEIRMNKLLRINRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACMYYSFSKAIGFGSDAFVYPD-----------PSDPEFGRLVRKYAYSMYWSTLTLTTIGETPPPVENSEYFFVVTDFLVGVLIFATIVGNVGSMITNANAARADFQARIDAIKQYMSFRKVTKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSRAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDNLLDLELAKQG-PDPKDMEEKVQKIGGVLEDLQTRFARLLAEQEAAQGKLKKRVTKLEKKM 628          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 504.982 bits (1299), Expect = 2.925e-171
Identity = 267/528 (50.57%), Postives = 379/528 (71.78%), Query Frame = 2
Query:  425 HV-VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            HV ++D +++LYY+W+  + + + +N++LL  RA F   Q DY  +W + DY  D++  +D F+ SRTGFLE GL+V + +K+ ++Y     FK D   ++P ++  L     N +    RFNRL K+ +LFE+ DRT+TRTNFPNIFRIS+L++++LIIIHWNGC FF IS ++G GSD +VYP  S+             + +    Y+Y  +WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL D L+EYP+AK  L ++G+ ILMKDNLID EA+ N   +   +E  +N + +++    +K ++L+ D+  + S +K +L+ +E ++
Sbjct:   97 HVWIMDPATDLYYHWLTIVAIPVFYNLMLLVTRACFNELQDDYTILWMVLDYTSDVIYYLDTFVRSRTGFLEQGLLVRESKKLWEHYKKSPQFKFDIFSMIPTDILMLKVGYNNPEL---RFNRLFKMARLFEYFDRTETRTNFPNIFRISNLVLYILIIIHWNGCIFFAISKTLGFGSDSWVYPNISDP-----------EFGRLGRKYIYCLYWSTLTLTTIGETPPPVRDIEYFFVVSDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVVKWFDYLWTEQKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLVELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAKKALEEKGRAILMKDNLID-EAAANAGADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQSRIKQRLTNMEARV 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 504.982 bits (1299), Expect = 3.259e-171
Identity = 267/528 (50.57%), Postives = 379/528 (71.78%), Query Frame = 2
Query:  425 HV-VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            HV ++D +++LYY+W+  + + + +N++LL  RA F   Q DY  +W + DY  D++  +D F+ SRTGFLE GL+V + +K+ ++Y     FK D   ++P ++  L     N +    RFNRL K+ +LFE+ DRT+TRTNFPNIFRIS+L++++LIIIHWNGC FF IS ++G GSD +VYP  S+             + +    Y+Y  +WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LL++L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL D L+EYP+AK  L ++G+ ILMKDNLID EA+ N   +   +E  +N + +++    +K ++L+ D+  + S +K +L+ +E ++
Sbjct:   97 HVWIMDPATDLYYHWLTIVAIPVFYNLMLLVTRACFNELQDDYTILWMVLDYTSDVIYYLDTFVRSRTGFLEQGLLVRESKKLWEHYKKSPQFKFDIFSMIPTDILMLKVGYNNPEL---RFNRLFKMARLFEYFDRTETRTNFPNIFRISNLVLYILIIIHWNGCIFFAISKTLGFGSDSWVYPNISDP-----------EFGRLGRKYIYCLYWSTLTLTTIGETPPPVRDIEYFFVVSDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVVKWFDYLWTEQKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLVELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAKKALEEKGRAILMKDNLID-EAAANAGADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQSRIKQRLTNMEARV 609          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3a [Source:ZFIN;Acc:ZDB-GENE-090611-2])

HSP 1 Score: 504.212 bits (1297), Expect = 7.952e-170
Identity = 264/525 (50.29%), Postives = 372/525 (70.86%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +S+ YY W+  +   + +N+++L  RA F   Q  Y  +W + DY  D++  +D F+ SRTGFLE GL+V D +K++ NY +   FK D   ++P +LF L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++L+IIHWN C FF IS +IG G+D +VYP         I+ P    + +    Y+Y  +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK IL KDNL+D EA      +   +E  I+++E ++     K ++L+ ++ +    +K +++ +E ++
Sbjct:  173 IMDPASDKYYRWLSIIAAPVFYNLMMLVTRACFNELQNTYTILWIVLDYTSDVIYYMDTFVRSRTGFLEQGLLVKDSKKLINNYRTIPQFKYDMISMIPTDLFMLKVGFNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIFFAISKTIGFGTDTWVYP--------NISHP---EYGRLARKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVMDFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLVEALTEYPDAKKALEEKGKAILRKDNLLD-EAVAAAGADPKDLEEKIHRLEGNLDIMTGKFAKLMAEYTSYQGKIKQRITNMENKV 682          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 526.939 bits (1356), Expect = 3.235e-180
Identity = 273/525 (52.00%), Postives = 380/525 (72.38%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   50 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 559          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 527.324 bits (1357), Expect = 5.665e-180
Identity = 273/525 (52.00%), Postives = 380/525 (72.38%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:   80 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 589          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 528.48 bits (1360), Expect = 1.238e-179
Identity = 273/525 (52.00%), Postives = 380/525 (72.38%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  133 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 642          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: nfyb (nuclear transcription factor Y subunit beta [Source:Xenbase;Acc:XB-GENE-1006106])

HSP 1 Score: 528.094 bits (1359), Expect = 1.280e-178
Identity = 273/525 (52.00%), Postives = 380/525 (72.38%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D SSNLYY W+  ++V +L+N   L  RA F   Q++   +W + DY  D++ I D  +  RTGFLE GL+V D +K+ +NY     FKLD   +LP +L  L      ++Y   RFNRL +  ++FEF DRT+TRTN+PNIFRI +L++++LIIIHWN C +F IS +IG G+D +VYP         I+ P    + +    Y+Y+ +WSTLTLTTI E P PV + EF+ +  + L GVLIFA+IVGNVGSMISN+NA K +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+ QVFSPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD LID EA++    +   +E  + K+E+++    ++ ++L+ D+ +    +K +++K+E Q+
Sbjct:  200 VIDPSSNLYYRWLSIISVPVLYNWCFLVCRACFDELQRNSIILWLVLDYTADVIYITDTLVRFRTGFLEQGLLVKDAKKLKENYSKTRQFKLDLLSLLPTDLTYL---KIGLNYPELRFNRLLRFGRMFEFFDRTETRTNYPNIFRIGNLVLYILIIIHWNACIYFAISKAIGFGTDTWVYP--------NISHP---EYGRLARKYIYSLYWSTLTLTTIGETPPPVKDIEFLFVVFDFLIGVLIFATIVGNVGSMISNMNASKAEFQSKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTNKKTMDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPQVFSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKTVLEEKGRQILMKDGLIDEEAAK-AGADPKDVEEKVEKMETAMDSLQTRFARLLADYNSTQLKLKQRVTKLESQV 709          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Match: amacr (alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:XB-GENE-1009589])

HSP 1 Score: 518.85 bits (1335), Expect = 1.370e-177
Identity = 268/525 (51.05%), Postives = 378/525 (72.00%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D S NLYYNW+  +T+ +++N  ++  RA F   Q+DY  +WF  DY+ D + I D+F+ +RTG+LE GL+V D  K+   Y   + FKLD   I+P ++  L      ++Y   R N+L ++ ++FEF  RT+TRTN+PNIFRIS+LI++++IIIHWN C ++ IS +IG G D +VYP  S+             + +    Y+Y+ +WSTLTLTTI E P PV + EF  +  + L GVLIFA+IVGNVGSMISN+NA + +FQ ++D +K+YM FR VSK+LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LLI+L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+DL+ + N   +   +E  + ++E  ++   +K ++L+ ++++A   +K +++KIEK I
Sbjct:   11 VIDPSGNLYYNWLFCITMPVMYNWTMIIARACFDELQQDYLELWFFLDYMSDAIYIADMFVRTRTGYLEQGLLVRDEVKLRDKYKMTMQFKLDVLSIIPTDILYL---QFGLNYPELRLNKLLRVARMFEFFQRTETRTNYPNIFRISNLIMYIVIIIHWNACVYYSISKAIGFGEDTWVYPNTSHPE-----------YGRLARKYVYSLYWSTLTLTTIGETPPPVQDSEFWFVVADFLVGVLIFATIVGNVGSMISNMNAARAEFQGRIDAIKQYMHFRKVSKDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLIELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGRQILMKDGLLDLDIA-NSGADPKDIEEKVIQMEGLVENLQTKFARLLAEYDSAQQKLKQRVTKIEKII 520          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 524.242 bits (1349), Expect = 9.763e-179
Identity = 266/528 (50.38%), Postives = 378/528 (71.59%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   98 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 524.242 bits (1349), Expect = 9.763e-179
Identity = 266/528 (50.38%), Postives = 378/528 (71.59%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   98 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga3 (cyclic nucleotide gated channel alpha 3 [Source:MGI Symbol;Acc:MGI:1341818])

HSP 1 Score: 524.628 bits (1350), Expect = 2.411e-178
Identity = 266/528 (50.38%), Postives = 378/528 (71.59%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:  136 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 648          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 522.702 bits (1345), Expect = 2.320e-177
Identity = 267/525 (50.86%), Postives = 384/525 (73.14%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1999
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDY+ D+V + D+F+ +RTG+LE GL+V DR K+++ Y + L FKLD   ++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP             V +P + +    Y+Y+ +WSTLTLTTI E P PVL+ E+I + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  148 VVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYI---KFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPD------------VNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Match: Cnga1 (cyclic nucleotide gated channel alpha 1 [Source:MGI Symbol;Acc:MGI:88436])

HSP 1 Score: 522.702 bits (1345), Expect = 2.320e-177
Identity = 267/525 (50.86%), Postives = 384/525 (73.14%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEP-WDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEK 1999
            VV+D S N YYNW+  +T+ +++N  ++  RA F   Q DY   W IFDY+ D+V + D+F+ +RTG+LE GL+V DR K+++ Y + L FKLD   ++P +L  +       +Y   R NRL +I ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP             V +P + +    Y+Y+ +WSTLTLTTI E P PVL+ E+I + V+ L GVLIFA+IVGN+GSMISN+NA + +FQ ++D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN++S+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKD L+D+  + N+  +   +E  + ++E S+    ++ ++++ ++E+    +K +L+K+EK
Sbjct:  148 VVIDPSGNTYYNWLFCITLPVMYNWTMIIARACFDELQSDYLEYWLIFDYVSDVVYLADMFVRTRTGYLEQGLLVKDRMKLIEKYKANLQFKLDVLSVIPTDLLYI---KFGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGNDTWVYPD------------VNDPEFGRLARKYVYSLYWSTLTLTTIGETPPPVLDSEYIFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQSRVDAIKQYMNFRNVSKDMEKRVIKWFDYLWTNKKTVDEREVLRYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQILMKDGLLDINIA-NMGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK 656          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90980|CNG3_CHICK (Cyclic nucleotide-gated channel rod photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 273/537 (50.84%), Postives = 388/537 (72.25%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI*EKHFSQF 2041
            ++D + N+YYNW+  +T+ +++N  ++  RA F   Q DY  +WFI DY+ D++ I D+F+ +RTG+LE GL+V + +K+ + Y S L FKLDF  I+P +L         ++Y   R NRL ++ ++FEF  RT+TRTN+PNIFRIS+L+++++IIIHWN C ++ IS +IG G+D +VYP  S+             + +    Y+Y+ +WSTLTLTTI E P PV + E+  + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM FR VSK++EKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH ET++ V +F DCE  LL++L+LKL+ QV+SPGDYICRKGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSK+GNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++GK+ILMKD L+D+E + N+  +   +E  +  +E S+    +K ++L+ +++ A   +K +L++IEK I   + E+ F  F
Sbjct:  109 IIDPAGNMYYNWLFCITMPVMYNWTMIIARACFDELQNDYLAVWFIVDYVSDVIYIADMFVRTRTGYLEQGLLVKEEQKLKEKYKSSLQFKLDFLSIIPTDLLYF---KLGLNYPELRINRLLRVARMFEFFQRTETRTNYPNIFRISNLVMYIVIIIHWNACVYYSISKAIGFGADTWVYPNTSHPE-----------FARLTRKYVYSLYWSTLTLTTIGETPPPVRDSEYFFVVVDFLVGVLIFATIVGNVGSMISNMNAARAEFQAKIDAIKQYMHFRNVSKDMEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLETLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICRKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKAMLEEKGKQILMKDGLLDIEVA-NLGSDPKDLEEKVAYMEGSMDRLQTKFARLLAEYDAAQQKLKKRLTQIEK-ILKPVMEQEFLDF 629          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q29441|CNGA3_BOVIN (Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus OX=9913 GN=CNGA3 PE=2 SV=1)

HSP 1 Score: 531.176 bits (1367), Expect = 1.606e-179
Identity = 273/528 (51.70%), Postives = 380/528 (71.97%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLEL--FSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            VV+D SSN+YY+W+  + V + +N  LL  RA F   Q ++  +W + DY  DI+  +D+ + +RTGFLE GLMV D  ++ K+Y   L FKLD   ++P +L  F L      ++Y   RFNRL K+ +LFEF DRT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP  SN             + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T+R V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVAEDGI  FV L +GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E ++    +   +E  +  +E+S+    ++ ++L+ ++      +K +LS++E Q+
Sbjct:  178 VVMDPSSNMYYHWLTVIAVPVFYNWCLLVCRACFDELQSEHLMLWLVLDYSADILYGMDMLVRARTGFLEQGLMVMDASRLWKHYTQTLHFKLDVLSLVPTDLAYFKL-----GMNYPELRFNRLLKLARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNVSNPE-----------YGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLRKVRIFQDCEAGLLVELVLKLRPAVFSPGDYICKKGDIGREMYIIKEGKLAVVAEDGITQFVVLGDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAK-AGADPKDIEEKVEHLETSLDSLQTRFARLLAEYNATQMKVKQRLSQLESQV 688          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q9JJZ8|CNGA3_MOUSE (Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus OX=10090 GN=Cnga3 PE=1 SV=2)

HSP 1 Score: 524.242 bits (1349), Expect = 6.829e-178
Identity = 266/528 (50.38%), Postives = 378/528 (71.59%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            + +VVD SSN+YY W+  + + + +N  LL  RA F   Q ++  +W + DY  D++ ++D+ + +RTGFLE GLMV D +++ K+Y   L FKLD   ++P +L  L      ++Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L+++ LIIIHWN C +F IS  IG G+D +VYP  S              + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L G+LIFA+IVGNVGSMISN+NA + +FQ K+D VK+YM+FR V+K+LE R+I WFDYLW N++++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYPDAK  L ++G++ILMKDNLID E      ++   +E  +  +ESS+    ++ ++L+ ++  +   +K +L+++E Q+
Sbjct:   98 EPIVVDPSSNIYYRWLTAIALPVFYNWCLLVCRACFDELQSEHLTLWLVLDYSADVLYVLDMLVRARTGFLEQGLMVRDTKRLWKHYTKTLHFKLDILSLIPTDLAYL---KLGVNYPELRFNRLLKFSRLFEFFDRTETRTNYPNVFRIGNLVLYTLIIIHWNACIYFAISKFIGFGTDSWVYPNTSKPE-----------YARLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGILIFATIVGNVGSMISNMNAPRVEFQAKIDSVKQYMQFRKVTKDLETRVIRWFDYLWANRKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPDAKRALEEKGRQILMKDNLID-EDLVAARVDTRDVEEKVEYLESSLDILQTRFARLLAEYSASQMKLKQRLTRLESQM 610          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q90805|CNG1_CHICK (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus OX=9031 PE=2 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 6.854e-178
Identity = 270/525 (51.43%), Postives = 382/525 (72.76%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            V+D SSN+YYNW+  +   + +N  +L  RA F   Q D+  +W   DY  DI+ + D+F+  RTGFLE GL+V D +K+  +Y   + FKLD   +LP +L  L      ++Y   RFNRL +I +LFEF DRT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         ++IP    + +    Y+Y+ +WSTLTLTTI E P PV + E++ + ++ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM FR V+K+LE R+I WFDYLW NK+++DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKLK  VFSPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID EA++    +   +E  I+++E+++    ++ ++L+ ++ ++   +K +L+++E ++
Sbjct:  202 VIDPSSNMYYNWLTIIAAPVFYNWCMLICRACFDELQIDHIKLWLFLDYCSDIIYVFDMFVRFRTGFLEQGLLVKDEKKLRDHYTQTVQFKLDVLSLLPTDLAYL---KLGLNYPELRFNRLLRIARLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKVIGFGTDSWVYP--------NVSIP---EYGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVIDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKVDSIKQYMHFRKVTKDLEARVIKWFDYLWTNKKTVDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLKPTVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEEAAK-AGADPKDLEEKIDRLETALDTLQTRFARLLAEYSSSQQKVKQRLARVETRV 711          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Match: sp|Q16281|CNGA3_HUMAN (Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens OX=9606 GN=CNGA3 PE=1 SV=2)

HSP 1 Score: 526.168 bits (1354), Expect = 8.874e-178
Identity = 270/526 (51.33%), Postives = 378/526 (71.86%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            +VVD SSNLYY W+  + + + +N  LL  RA F   Q +Y  +W + DY  D++ ++D+ + +RTGFLE GLMV+D  ++ ++Y +   FKLD   ++P +L  L       +Y   RFNRL K  +LFEF DRT+TRTN+PN+FRI +L++++LIIIHWN C +F IS  IG G+D +VYP         I+IP      +    Y+Y+ +WSTLTLTTI E P PV + E++ + V+ L GVLIFA+IVGNVGSMISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW NK+++DE+EVL +LPDKL+AEIAI+VH +T++ V +FQDCE  LL++L+LKL+  VFSPGDYIC+KGDIGKEMYI+  GKL VVA+DG+  FV L++GS FGE+SILNI GSKSGNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNLID E +     +   +E  + ++ SS+    ++ ++L+ ++      MK +LS++E Q+
Sbjct:  159 IVVDPSSNLYYRWLTAIALPVFYNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLWQHYKTTTQFKLDVLSLVPTDLAYL---KVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNMFRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYP--------NISIP---EHGRLSRKYIYSLYWSTLTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVVLSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEEKGRQILMKDNLIDEELAR-AGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQRLSQLESQV 669          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A3P7XJ78 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS4000 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 298/527 (56.55%), Postives = 400/527 (75.90%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2002
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +    +W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + YI +  F +D   ILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:   98 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A183LJM5 (Cyclic nucleotide-binding domain-containing protein OS=Schistosoma margrebowiei OX=48269 PE=4 SV=1)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 298/527 (56.55%), Postives = 400/527 (75.90%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2002
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +    +W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + YI +  F +D   ILP +LF  I P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I+ ++    +++++LI +F  + + +K +L+++E++
Sbjct:   98 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPIIWMVLDYCIDCVYFMDIFVGLRTGYLEEGLLVRDKEKLKQAYIKRRQFIIDIMAILPTDLFYFI-PVLNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRATGLSSDSFVYPPRSSDDTSDEFKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDVLRKAQEQQESIEQCVQRIDGTVNQLTTRLARLIGEFGASQAKLKRRLARLEQE 622          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: G4VGD7 (Putative cyclic-nucleotide-gated cation channel OS=Schistosoma mansoni OX=6183 GN=Smp_194700 PE=4 SV=1)

HSP 1 Score: 588.571 bits (1516), Expect = 0.000e+0
Identity = 297/527 (56.36%), Postives = 400/527 (75.90%), Query Frame = 2
Query:  422 QHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQ 2002
            + +V+DSS + YY WIG +T+T+L+N I+LP+R+AF    +     W + DY ID V  +D+F+G RTG+LE GL+V D+EK+ + Y+ +  F +D   ILP +L  LI P  N    W RFNRL KIY+ FEF+DRT+TRTN PN+FRIS L  ++L++IHWN C +F  S + GL SD FVYPPRS+          TE WD+  S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ KMDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SILNI G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+ K  L+QRG++IL KDNL+D +           +E  + +I++++    +++++LI +F  + + +K +L+++E++
Sbjct:   90 KDLVIDSSESGYYYWIGIVTITVLYNAIVLPMRSAFTQFHELSPITWMVLDYCIDCVYFMDIFVGFRTGYLEEGLLVRDKEKLKQAYLKRRQFIIDIITILPTDLLYLI-PIFNHYASWLRFNRLMKIYRSFEFVDRTETRTNRPNLFRISMLTTYILVLIHWNACIYFGFSRASGLSSDSFVYPPRSSDDTSDEYKNYTEQWDRLFSQYVYSFYWSTLILTTIGETPKPVRNAEYIFITIDFLVGVLIFATVVGNVGAMITNMNAARTEFQNKMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDSLNALPDKLKAEIAIHVHFDTLQRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILNIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPETKTILMQRGQDILRKDNLLDEDILRKAQEQQESIEQCVQRIDNTMNQLTTRLARLIGEFGASQAKLKRRLTRLEQE 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A504Z0W2 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola gigantica OX=46835 GN=FGIG_00261 PE=4 SV=1)

HSP 1 Score: 588.186 bits (1515), Expect = 0.000e+0
Identity = 296/532 (55.64%), Postives = 397/532 (74.62%), Query Frame = 2
Query:  416 WYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 2011
            W   +VVDSS + YY WIG ++ T+L+N I+LP+R+AF    +    MW  FDYLID +  ID+F+G RTGFLE GL+V D  ++ K Y+ +     D   + P +L  LI PS      W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRSN     +    +  W+   S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ +MDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:   85 WITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSNDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDTLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIAGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Match: A0A4E0RSW7 (Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Fasciola hepatica OX=6192 GN=D915_005543 PE=4 SV=1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 295/532 (55.45%), Postives = 396/532 (74.44%), Query Frame = 2
Query:  416 WYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFF 2011
            W   +VVDSS + YY WIG ++ T+L+N I+LP+R+AF    +    MW  FDYLID +  ID+F+G RTGFLE GL+V D  ++ K Y+ +     D   + P +L  LI PS      W RFNRL K+Y+LFEFIDRT+TRT  P +FRIS+L + +L++IH N C +F  S + GLGS+ FVYPPRS      +    +  W+   S Y+Y+F+WSTL LTTI E P+PV N E+I +T++ L GVLIFA++VGNVG+MI+N+NA +T+FQ +MDGVKRYMEFR V+KELE R+I WFDYLW NKQSL EE+ L+ LPDKL+AEIAIHVH++T++ VS+F+DC+  LL++L+LKL+LQVFSPGDYICRKGDIGKEMYIVKRGKL+VV+EDG  VFVTL EGSVFGE+SIL+I G+K+GNRR+ANVRSVGYSDLFCL+KDDLWD L EYP+AK  L+QRG+EIL KDNLID E           +E  + ++++++    +++++LI +F  + + +K +L+++E+  +F
Sbjct:   85 WITTLVVDSSQSAYYYWIGIVSATVLYNSIVLPMRSAFTQFHELSAIMWMFFDYLIDAIYFIDIFVGCRTGFLEQGLLVRDVNQLRKAYLKRREIYADVLAVFPTDLLYLI-PSVGHYGAWLRFNRLLKVYRLFEFIDRTETRTTRPYLFRISTLTMNILVLIHLNACIYFGFSKATGLGSNSFVYPPRSTDEISEVQYNYSARWNHLFSQYVYSFYWSTLILTTIGETPKPVYNAEYIFITIDFLAGVLIFATVVGNVGAMITNMNAARTEFQSRMDGVKRYMEFRKVNKELELRVIRWFDYLWTNKQSL-EEDTLNALPDKLKAEIAIHVHFDTLKRVSIFKDCDPGLLVELVLKLQLQVFSPGDYICRKGDIGKEMYIVKRGKLSVVSEDGKTVFVTLGEGSVFGEISILDIVGNKTGNRRSANVRSVGYSDLFCLSKDDLWDALTEYPEAKEILMQRGEEILRKDNLIDEEVLRKAQEKKETIEQCVTRVDNTLNQISTRLARLIGEFGASQAKLKRRLTRLEEYQYF 614          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga1b (cyclic nucleotide gated channel subunit alpha 1b [Source:ZFIN;Acc:ZDB-GENE-110408-39])

HSP 1 Score: 516.924 bits (1330), Expect = 4.719e-176
Identity = 264/528 (50.00%), Postives = 376/528 (71.21%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFS 2014
            V+D + N YYNW+  +T  +++N +L+  RA F   Q DY   WFI D++ D+V + D+   +RTG+LE GL+V D +K+ + Y+  L FKLD   ++P +L  ++     ++Y   R N+L ++ +LFEF  RT+TRTNFPN+FRIS+L+++++IIIHWN C ++ +S ++G GSD FVYP  SN             + +    Y Y+ +WSTLTLTTI E P P  + EF  +  + L GVLIFA+IVGNVGSMI+N+NA + DFQ ++D +K+YM FR V+ +LEKR+I WFDYLW NK+++DE EVL  LPDKLRAEIAI+VH +T++ V +F DCE  LL++L+LKL+ QV+SPGDYIC+KGDIG+EMYI+K GKL VVA+DGI  FV L++GS FGE+SILNI GSK+GNRRTAN+RS+GYSDLFCL+KDDL + L EYP+AK  L ++G++ILMKDNL+DLE ++    +   ME  + +I S ++   ++ ++L+   E   S +K +++K+E +I  S
Sbjct:   86 VIDPAGNTYYNWLFVITCPVMYNWVLIIARACFEELQHDYLIYWFILDFVSDLVYVADMVFRTRTGYLEQGLLVKDEKKLRERYMVSLQFKLDLISMIPTDLLYVLV---GLNYPEIRMNKLFRVNRLFEFFQRTETRTNFPNVFRISNLVMYIVIIIHWNACLYYSVSKAMGFGSDRFVYPDPSNPE-----------FGRLIRKYAYSMYWSTLTLTTIGETPPPEKDAEFFFVVTDFLVGVLIFATIVGNVGSMITNMNAARADFQARIDAIKQYMSFRKVTTDLEKRVIKWFDYLWTNKKAVDEREVLKYLPDKLRAEIAINVHLDTLKKVRIFADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGITQFVVLSDGSYFGEISILNIKGSKAGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKSMLEEKGRQILMKDNLLDLEVAKQG-PDPKDMEEKVVRIGSVLEDLQTRFARLLAQHEAVQSRLKRRVTKLETKITVS 598          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 503.442 bits (1295), Expect = 3.074e-171
Identity = 264/525 (50.29%), Postives = 369/525 (70.29%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +++ YY+W+  +   + +N++++  RA F   Q  Y  +W I DY  D++   D F+ SRTGFLE GL+V D  K++ +Y     FK D   ++P +   L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LIIIHWN C FF IS +IG G+D +VYP  S+             + +    Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:   64 IMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYPNISHP-----------EYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 573          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 504.597 bits (1298), Expect = 7.318e-171
Identity = 262/525 (49.90%), Postives = 374/525 (71.24%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +S+LYY+W+  ++V   +N+++L  RA F   Q  Y  +W   DY  D++  ID F+ SRTGFLE GL+V DR+K+ +NY     F+ D   ++P ++  L     N +    RFNRL K+ +LFEF DRT+TRTNFPNIFRI +L++++LIIIHWN C FF IS ++G GSD +VYP  S+     +A             Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++G+ ILMKD LID  A++     D  +E+ ++ +E++++   +K++++  D+  +   +K +++ +E ++
Sbjct:  128 IMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTADAKD--LEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNMEARV 636          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3a (cyclic nucleotide-gated channel cone photoreceptor subunit alpha-like [Source:NCBI gene;Acc:103043103])

HSP 1 Score: 503.827 bits (1296), Expect = 2.403e-170
Identity = 265/525 (50.48%), Postives = 370/525 (70.48%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +++ YY+W+  +   + +N++++  RA F   Q  Y  +W I DY  D++   D F+ SRTGFLE GL+V D  K++ +Y     FK D   ++P +   L     N +    RFNRL K+ +LFEF DRT+TRTN+PNIFRIS+L++++LIIIHWN C FF IS +IG G+D +VYP         I+ P    + +    Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR VSK+LE R+I WFDYLW  K++ DE+EVL  LPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++GK ILMKDNLID EA  N   +   +E  I K+ES++    +K  +L+ ++ +  + +K +L+ +E ++
Sbjct:  138 IMDPATDKYYHWLTIIAAPVFYNLMMIVTRACFNELQNTYTILWIILDYTSDVIYYTDTFVRSRTGFLEQGLLVKDGTKLMGHYRQTSQFKYDMLSMIPTDFLMLKVGYNNPEL---RFNRLFKMARLFEFFDRTETRTNYPNIFRISNLVLYILIIIHWNACIFFAISKTIGFGTDTWVYP--------NISHP---EYGRLARKYIYCLYWSTLTLTTIGETPPPVKDVEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVSKDLEARVIKWFDYLWTEKKTCDEKEVLKNLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLESNLDVMTTKFGRLMAEYTSYQAKIKQRLTNMESKV 647          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Match: cnga3b (cyclic nucleotide gated channel subunit alpha 3b [Source:ZFIN;Acc:ZDB-GENE-090312-121])

HSP 1 Score: 504.982 bits (1299), Expect = 3.304e-170
Identity = 262/525 (49.90%), Postives = 374/525 (71.24%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +S+LYY+W+  ++V   +N+++L  RA F   Q  Y  +W   DY  D++  ID F+ SRTGFLE GL+V DR+K+ +NY     F+ D   ++P ++  L     N +    RFNRL K+ +LFEF DRT+TRTNFPNIFRI +L++++LIIIHWN C FF IS ++G GSD +VYP  S+     +A             Y+Y  +WSTLTLTTI E P PV + E++ +  + L GVLIFA+IVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R++ WFDYLW  +++ DE+EVL  LPDKL+AEIAI+VH ET+R V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYP+AK  L ++G+ ILMKD LID  A++     D  +E+ ++ +E++++   +K++++  D+  +   +K +++ +E ++
Sbjct:  179 IMDPASDLYYHWLTIISVPAFYNLMMLITRACFNELQDSYTTVWITLDYSSDVIYYIDTFVRSRTGFLEQGLLVKDRKKLWENYKKTPQFRYDLVSMIPTDIAMLYVGYNNPEL---RFNRLLKMARLFEFFDRTETRTNFPNIFRIGNLVLYILIIIHWNACIFFAISKTLGFGSDTWVYPDISDPEHGRLA-----------RKYIYCLYWSTLTLTTIGETPPPVRDIEYLFVVADFLIGVLIFATIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVVKWFDYLWTEEKTCDEKEVLKYLPDKLKAEIAINVHLETLRKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPEAKKALEEKGRAILMKDGLIDESAAKTADAKD--LEDKVSMLETNLEVMQAKMTRITADWAASQGRIKQRINNMEARV 687          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: cngb1a (cyclic nucleotide gated channel subunit beta 1a [Source:ZFIN;Acc:ZDB-GENE-050419-164])

HSP 1 Score: 238.81 bits (608), Expect = 2.278e-71
Identity = 159/504 (31.55%), Postives = 270/504 (53.57%), Query Frame = 2
Query:  323 KDEKLP--VVDSQPDDAEL----IHFQNKTFFTKINLWYQHVVVDSSSN-LYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFI-GSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSL-ISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVV-AEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGK 1804
            K+E  P   V++  +  E       F+ + +  KI        +D  ++ +Y  W+  + +   ++   LP+R +F +   +    W+I DY  D + ++D+ +   R  F+  G ++TD+++  K Y     FK D   +LPL++  L   PS       +R  RL K Y  FEF DR +   +   I+R+     +LL  +H N CF++F+S+  GLGS  +VY  +                      Y+  ++W+  TL TI  +P P    E +        GV + + ++G +G +I    A +  ++  MD    YM    +S+ ++ R+  W++Y W ++  LDE E+L  LP K+R EIAI V+Y  +  V++F+ C++ ++  ++L+LK  V+ PGD++C+KG++G+EMYI+K G++ VV   D   VFVTL  GSVFGE+S+L + G   GNRRTANV + G+++LF L+K DL ++L  YP+++  L ++ K
Sbjct:    3 KEETAPQAAVEAATEQHECQMLCCRFKRRPWMDKIKKMKLPETIDPCADRIYLIWLTLVMLAFQWSCWFLPLRLSFPVHTPNTMSFWYIGDYTCDAIYLLDILVMQCRLQFVHRGDIITDQKETSKFYYHSEKFKSDLLSLLPLDILYLKFGPS-----AMFRLPRLIKYYAFFEFNDRLEAIMSKAYIYRVIRTTGYLLFSLHLNACFYYFVSDMEGLGSTRWVYNGKGYR-------------------YIRCYYWAVKTLITIGGLPEPSNLIEIVFQLSNYFLGVFVVSIMIGQMGDVIGAATAGQNYYRTCMDNTLSYMNMYHISRAVQNRVRMWYEYTWASQGMLDESELLEKLPIKMRLEIAIDVNYTIVNKVALFKGCDRQMIYDMLLRLKSVVYLPGDFVCKKGELGREMYIIKAGEVQVVGGPDNKIVFVTLRTGSVFGEISLLAVGG---GNRRTANVMAHGFANLFILDKRDLNEILRIYPESEKLLRKKAK 479          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005594.1 (pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1 gene:ENSPMAG00000005049.1 transcript:ENSPMAT00000005594.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 9.604e-28
Identity = 112/464 (24.14%), Postives = 203/464 (43.75%), Query Frame = 2
Query:  464 WIGTLTVTILFNVILLPVRAAFYIP----QKDYRYMWF------IFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYV----WYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISN-----------SIG-LGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGE-LSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPD 1774
            W   + + +++  I  P  AAF +     + + +   +      I D ++DI+ ++D+FI  RT ++     V      +  +  K  F +D    +P +L    S S + +        +  RL ++ ++   +DR            +  L+    +I HW  C ++ I N            IG L   G       N TD +    +    D++ +   + F  S+LT      V  P  N+E I     +L G L++ASI GNV ++I  + +    +  +M  VK ++ F  +   L +R+  +F + W     +D   VL   P+ L+A+I +H++   + +   F    +  L  L +K K     PGD +   GD+   MY + RG + ++ ED   V   L +  +FGE ++  + PG  S     A+VR++ Y DL  + ++D+ +VL  YP+
Sbjct:  101 WDWLILLLVIYTAIFTPYTAAFLLSDQQVENERQKCGYSCNPLNIVDLMVDIMFMVDIFINFRTTYINKNEEVVSHPGKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSGSGETTTLIGLLKTARLLRLVRVARKLDRYSEY----GAAVLVLLMCTFALIAHWLACIWYAIGNMERPVDSLAKDRIGWLDQLGGQIGKPYNDTDTSSGPSIK---DKYVTALYFTF--SSLTSVGFGNV-SPNTNYEKIFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNMVLKGFPECLQADICLHLNRTLLESCKAFNGASKGCLRALAMKFKTTHAPPGDTLVHSGDVITAMYFLSRGSIEILRED--IVVAILGKNDIFGEPVNQYSRPGKSS-----ADVRALTYCDLHKIVREDMLEVLDMYPE 547          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005922.1 (pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-1 gene:ENSPMAG00000005344.1 transcript:ENSPMAT00000005922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 6.038e-23
Identity = 64/245 (26.12%), Postives = 129/245 (52.65%), Query Frame = 2
Query: 1043 SMYMYAFFWSTLTLTTIA-EVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPD 1774
            S Y+ + +++  +LT++         + E I     +L G L+ A + GNV ++I  + + ++ +  +   +K ++    + K+L++R++ +F   W     +D  E+L   PD+LRA+IA+H++ E I  +++F+   +  L  L L +K    +PG+++ R+GD  +  Y V  G + V+ +D   V   L +G + G     ++       +  A+V+++ Y DL C++   L+DVL  YP+
Sbjct:  257 SAYIASLYFALSSLTSVGFGNVSANTDAEKIFSVCAMLIGALMHAVVFGNVTAIIQRMYSRRSQYHTRTKDLKDFIRVHRLPKQLKQRMLEYFQTTWSVNNGIDTHELLKDFPDELRADIAMHMNKE-ILQLAIFESASRGCLRSLSLSIKPSFCAPGEFLIRQGDALQAFYFVCSGSMEVLKDD--MVLAILGKGDLIGS----DLSSKDQVLKTNADVKALTYCDLQCIHLRGLYDVLDLYPE 494          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: kcnh1b (potassium voltage-gated channel, subfamily H (eag-related), member 1b [Source:ZFIN;Acc:ZDB-GENE-121128-4])

HSP 1 Score: 99.7525 bits (247), Expect = 8.074e-22
Identity = 104/477 (21.80%), Postives = 206/477 (43.19%), Query Frame = 2
Query:  458 YNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFL-EMGLMVTDREKMLKNYISKLSFKLDFTGILPLEL-------------------FSLISPSKNIDYVWYRFN-----------RLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRS--NSTDMTIAIPVT---EPWDQFPS---MYMYAFFWSTLTLTTIA-EVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEY 1768
            ++WI  + +   +  I++P   +F   Q +    W + D ++D++ ++D+ +   T F+   G +++D + +  NY+ K  F +D    LP ++                   F   SPS+ +D  W R             ++ ++ +L     + D    +     +  L+    +  HW  C ++ I +   +     +    S       TI  P       W+  PS   +Y+ + +++  +LT+I      P  + E I     ++ G L++A+I GNV ++   + A    +   ++ V+ +++   V K L +R++++    W   + +D E+VL   P  +RA+I +H++ +       F+      L  L ++ +    +PGD I   G+    +  V  G L V+ +D  +V   L +G VFG++       + S     ANVR++ Y DL  + +D L  VL  Y
Sbjct:  200 WDWI--ILILTFYTAIMVPYNVSFKTKQNNV--AWLVVDSVVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYL-KTWFVIDLLSCLPYDIINAFENVDEVVRAAQIRGPFGSRSPSRLLD-AWPRVAPQGISSLFSSLKVVRLLRLGRVARKLDHYIEY-GAAVLVLLVCVFGLAAHWLACIWYSIGDYEVIDEATNLIRKHSWLYQLGETIGTPYHFNGTQWEGGPSKDAVYISSLYFTMTSLTSIGFGNIAPTTDGEKIFAVAMMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSKGIDTEKVLHICPKDMRADICVHLNRKVFNEHPAFRLASDGCLRALAVEFQTHHCAPGDLIYHAGESVDTLCFVVSGSLEVIQDD--EVVAILGKGDVFGDVFWKERVIAPS----CANVRALTYCDLHVIRRDALVKVLDFY 663          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001558.1 (pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 gene:ENSPMAG00000001411.1 transcript:ENSPMAT00000001558.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 7.786e-14
Identity = 61/257 (23.74%), Postives = 117/257 (45.53%), Query Frame = 2
Query:  905 HWNGCFFFFISNS---IGLGSDGFVYPP--------------RSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNE 1624
            HW  C +F I      + + SD  + P                +NS+      P+   +    S+Y   F  S++T      V     + E I     +L G L+ A + GNV ++I  + + ++ +  +   +K ++    + + L++R++ +F   W     +D  E+L   PD+LRA++ +H++ E ++ + +F+   +  L  L L +K    +PG+Y+ R+GD  +    V  G + V+ +DG  V   L E
Sbjct:   44 HWMACIWFVIGCQEIVVRVSSDTHISPHCWLHQLRKRLEASGSANSSVSHCGPPLRSAY--ITSLY---FTLSSITSVGFGNVSANT-DSEKIFSICAMLIGALMHAVVFGNVTAIIQRMYSRRSLYLTRTKDLKEFIRIHRLPQPLKQRMLEYFQTTWSVNNGIDTNELLKDFPDELRADVTMHLNKEMLQ-LPLFEAASRGCLRSLSLNVKTTFCAPGEYLIRQGDALQAFCFVLSGSMEVL-KDG-TVLAILGE 291          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM8])

HSP 1 Score: 424.091 bits (1089), Expect = 8.183e-143
Identity = 221/461 (47.94%), Postives = 320/461 (69.41%), Query Frame = 2
Query:  443 SSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRS----NSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEIL 1813
            S +  Y W+  +++ +L+N   + +R AF        Y+W I DY  D++ I D+ +  RTGFLE G++ T   KM ++Y+    F LD   ++PL++  +    +      +R NR+ K ++ + F+DRT++RT FPN+ R++SL+ F+L+IIHWN C +F +S  IG GSD +VYP       NS++ TI+            MY+Y+F+WSTLTLTTI EVP P    E+II+T++ L GVL+FA+IVGNVG++I+N+NA + DFQ KMDG+K YM F  + + L++R+I WFDYLW  K+  DEEE+L +LPDKLRAEIAI+VH +++R V++FQDCE   L +L+L+L+ Q+FSPGDY+CRKG++G+EMYIV RGKL VV+E G K++  L  GS FGE+S+L++  S +GNRRTA+VRSVGY++LFCL K+DL +VL EYP+ K K+ +  KE L
Sbjct:    1 SGDRLYFWLLVVSLAVLYNCWAIILRTAFPQINDKITYIWLILDYSCDLIYIADILVSMRTGFLEEGILQTCSTKMRRHYLHTYEFYLDAGALIPLDIAYIFIEHEPA----FRINRILKFHRFWHFLDRTESRTTFPNVVRLASLVQFILLIIHWNACIYFIVSREIGFGSDVWVYPGVRQEILNSSENTIS-----------RMYIYSFYWSTLTLTTIGEVPPPYSEVEYIIVTLDYLIGVLLFATIVGNVGNIITNLNATRLDFQNKMDGIKAYMRFHKIPQHLQRRVIKWFDYLWTYKKHPDEEEILLSLPDKLRAEIAINVHLDSLRKVAIFQDCEAGFLCELVLRLRSQLFSPGDYVCRKGEVGREMYIVNRGKLEVVSEHGTKIYAVLEAGSYFGEISVLSM--SSAGNRRTASVRSVGYTELFCLAKNDLMEVLDEYPNIKEKIEKIAKEKL 444          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO34633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW2])

HSP 1 Score: 357.451 bits (916), Expect = 6.971e-117
Identity = 182/454 (40.09%), Postives = 294/454 (64.76%), Query Frame = 2
Query:  464 WIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDN 1825
            W+  ++V +++N + +  R  F   Q  +  +WF+ DY+ DI+  +D+ +  RT +L+ GL+V D +K+ +NY++ + FKLD   ILP +       ++       R  R+ ++ KLF+   R +T++++PN+ +  ++++ +L++ HWN CF+F IS SIG GSD +VYP  S++            +D+    Y+Y+F+WST  + T      P  + E + +  +L  G L FA++VG  G+++ ++   + +F    + +K+YM    V+ +L++R+I+W DY+W  K+SLD E +L  LP+KLR +IA+HV+   +R+V VF DCE  LL ++++KL+ QVFSPGDYICRKGD+G+EMYIV  G L VV +DG  V   L+EGS FGE+SILN+ G   GNRRTA VRSVG+SDL CL+KDDL + +++YP+A+M+L +RG+E+L + +
Sbjct:    4 WLYIVSVAVVYNWVFIIARQCFSQLQVRFMTLWFVMDYICDIIYGMDIMVEFRTAYLDQGLLVRDLKKLRQNYLATVKFKLDMISILPFDFLYFGLGTRFTLCRLLRLLRIHRVVKLFQ---RGETKSSYPNLLQTFAVVLVILLVFHWNACFYFAISESIGFGSDKWVYPNLSSNN-----------YDKLSRQYLYSFYWSTRMMITGESENPPETDMELLFVVADLTVGYLTFAALVGQFGAILGHIMRARVEFITHSNSIKQYMNNHKVNNDLQERVISWIDYMWHKKRSLDHERILKKLPEKLRGQIAVHVYLAVLRHVPVFADCEPGLLREIVVKLRSQVFSPGDYICRKGDVGREMYIVNSGCLQVVGDDGTTVLAILSEGSYFGEISILNLSG--IGNRRTAAVRSVGFSDLLCLSKDDLLEAMSDYPEARMRLEERGRELLNRTH 441          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO49540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK0])

HSP 1 Score: 302.368 bits (773), Expect = 8.689e-96
Identity = 179/449 (39.87%), Postives = 265/449 (59.02%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKD--YRYMWFIFDYLIDIVNIIDLFIGSRTGFLE-MGLMVTDREKMLKNYISKLSFKLDFTGILPLEL---FSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAED---GIKVFV-TLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDL 1747
            V+D    L Y W   +T  + +N  ++ +R AF   + +  YR +++  D + DI+ ++D+ +  RT + +  G+M+   + +  NY SK+ F LD   + PLE    F+L+ PS     VW+R  RL K + +  F   +D RTN PN  R+  L ++L + +HW  C ++ IS   GLGS+ +VYP  S                     Y+ + +WS LTLTTI E P P  N E +  +   L G+ +FA++VGNVG +ISN+NA +TDFQ KMD +K YME   V ++L+ R   W  Y W         + L  LP +LRAE+AIHVH  T++ V +F+DC++ LL +L+LKL+ Q+FSPGDYICR G+IG+EMYI+  GK+ VV  D   G K+ V +L EG+ FGE+S+L +   +  NRR+A+VRSVGYS+L  L++ DL
Sbjct:    3 VIDPEGGLCYTWAALVTFAVFYNFCIVLLRIAFKEVRNELFYRMIYWPLDVISDIIYLVDILVQFRTAYRDDHGIMINTPKLLALNYCSKIPFFLDALSVFPLETTLPFTLVQPS-----VWFRCLRLLKWHCVLRFFVISDLRTNKPNRLRVVKLALYLGLALHWVACGYYMISEYEGLGSNSWVYPEASGEDG---------------KKYIKSLYWSILTLTTIGETPEPSTNLEHVFTSAMFLFGIFVFAAVVGNVGDVISNMNAARTDFQTKMDYIKSYMEHHKVPEDLQNRAKRWAYYAWSR-----HSDALGMLPLRLRAELAIHVHLATLKKVKIFKDCDEGLLCELVLKLRPQIFSPGDYICRCGEIGREMYIINHGKVEVVVPDSTTGEKIVVASLTEGNYFGEISLLRLDEGR--NRRSADVRSVGYSELLWLSQKDL 424          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO39918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S2])

HSP 1 Score: 292.738 bits (748), Expect = 3.400e-92
Identity = 159/450 (35.33%), Postives = 260/450 (57.78%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAK 1780
            V+       Y W   +   I +N+ ++ +R AF   Q ++   W +FDY  D + ++D+ I  RTGFLE G++V D +++ ++Y    +F  D   + P ++  ++ P +       R NRL K YK F      ++ T +P   R+  L+  + ++I+WN  F+  IS + G G++ +VYP   +                    Y+ + +WSTLTLT I ++P P  NFE++      L GV +FA+IVGN GS+I N NA + DF+ + +G   YM    V K+L++R++ W+DY W +     +   L+ LPDKL+ EIA+HV+ ET+R V+  Q C+   L  L+L +KL++F+PGD+ICRKG++ +EMY++  GK+ VV E G +V   L+ G  FGE+ IL++  S+  NRRTA++R++GY + F L+K+D+     +YP+A+
Sbjct:    1 VIAPDGRFMYIWFYFVVFAIRYNLWVVILRIAFPAAQDEFTVAWLVFDYFCDFLYVLDIIINFRTGFLEEGILVVDAKRVARHYAVSKNFIADLLSVFPTDILCVLYPER---LPMLRINRLIKAYKSFRIKSLMESHTTYPTFLRVFFLLHLMFLLINWNAGFYIMISRTEGFGTNAWVYPGNGS----------------LYQQYLKSLYWSTLTLTAIGDLPSPATNFEYLYTIACYLCGVFMFATIVGNAGSIIVNRNANRLDFERQREGTNNYMRKNRVPKDLQRRVLMWYDYSWASGGG--DLNSLTLLPDKLKTEIALHVNLETLRKVTFLQKCQPEFLHDLVLMMKLRIFTPGDFICRKGEVAREMYVIIDGKIEVVGEVG-QVLKVLSGGDFFGEIGILSL--SEGQNRRTADIRTIGYVECFVLSKEDVLKATRDYPEAQ 426          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Match: EDO35376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLM9])

HSP 1 Score: 280.411 bits (716), Expect = 2.239e-87
Identity = 175/461 (37.96%), Postives = 263/461 (57.05%), Query Frame = 2
Query:  428 VVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAE-------VPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKL 1789
            +V+D S   Y+ W+ T+++ +++N   L V  AF    +         DY  D +  +D  +  R GFLE G+MV    K+ K Y     F LD   ILP ++  L      I     RFNRL K ++   F DR +  +  P +F ++ LI +L +IIHW  C +F +S   G G+D +++P                   +    Y+Y+ + S++++TT+          PR  L   F+I+T   L GVLIFA+IVGN G MI  +   +  +  K++G+K Y+E   +   L+KR+I+WFDYLW +K+ ++E+E+   L D  +AEIAIHV+ +T+  V +F DC+   L +L+LKL+  + SPGD+ICR+G+ G+EMYIV +G L V+ E    V  TL+ GS FGE+S+LN+ G   GN RTA+VRSVG+SDLF L+K DL +VL  YP AK ++
Sbjct:    1 LVLDPSGTFYFLWLLTVSLGVIYNYWALIVYVAFPSVHEANLKTCIAVDYTFDSIFFLDTLVQFRVGFLEHGVMVVGCWKLTKKYGCSFGFMLDLISILPFDVLYLYLGVLPI----LRFNRLFKAHRFLLFCDRGEIYSGRPKLFNLAKLIHYLFLIIHWVACVYFILSRYEGFGTDEWLHPRLDGQLS------------KLSMQYLYSLYRSSVSMTTVGAGVIGTIATPRTELTLCFVIVTY--LTGVLIFATIVGNAGDMIVEMRRSRERYLRKLNGMKEYIEAYQLPAHLKKRVIHWFDYLWRHKRDMNEQELFHKLNDNFKAEIAIHVNLDTLIRVEMFHDCDPGFLHELVLKLRPVICSPGDFICRQGEKGREMYIVNKGSLEVLDEKE-TVLATLSAGSHFGEISLLNMKG--IGNLRTASVRSVGFSDLFQLSKTDLEEVLEFYPQAKEQM 440          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 513.842 bits (1322), Expect = 1.024e-173
Identity = 266/525 (50.67%), Postives = 374/525 (71.24%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG+LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  177 IMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 686          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: ENSORLT00000025598.2 (cyclic nucleotide-gated channel cone photoreceptor subunit alpha [Source:NCBI gene;Acc:101170498])

HSP 1 Score: 509.22 bits (1310), Expect = 1.246e-171
Identity = 263/525 (50.10%), Postives = 370/525 (70.48%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D +++LYY+W+  L V + +N++LL  RA F   Q +Y  MW + DY  D+   ID F+ +RTGFLE GL+V D + + + Y++ L FK D   +LP ++   +    N ++   RFNRL ++ +LFEF DRT+TRTNFPNIFRI++L+++++IIIHWN C +F +S  +G GSD +VYP  +      +AI            Y+Y F+WSTLTLTTI E P PV + E+  +  + L GVLIFA+IVGNVG+MISN+ A + +FQ K+D +K+YM FR V+K+LE R++ WFDYLW  +++ DE++VL +LPDKL+AEIAI+VH ET+  V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L  +G+ ILMKDNLID   S     +   +EN +N+IE+S++   +K  +L    +++   +K +LS +  Q+
Sbjct:  109 IMDPATDLYYHWLSALAVPVFYNLMLLVARACFNELQYNYTTMWIVLDYGSDVFYYIDTFVRARTGFLEQGLLVKDPKVLKEKYMTTLQFKFDVISLLPTDIVFFVIGINNPEW---RFNRLFRLPRLFEFFDRTETRTNFPNIFRIANLVLYIIIIIHWNACLYFAVSKVLGFGSDTWVYPALTGPKFSRLAI-----------QYIYCFYWSTLTLTTIGETPPPVRDIEYFFVVADFLTGVLIFATIVGNVGAMISNMGAARVEFQAKIDSIKQYMHFRKVTKDLEARVVKWFDYLWTEEKTCDEKQVLKSLPDKLKAEIAINVHLETLSKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKYALEDKGRAILMKDNLID--ESLVAACDAKDLENKVNQIEASVEVMTNKFKKLTAQHQSSQRKLKQRLSNLSNQV 617          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga2b (cyclic nucleotide gated channel subunit alpha 2 [Source:NCBI gene;Acc:101171687])

HSP 1 Score: 499.204 bits (1284), Expect = 8.867e-169
Identity = 262/525 (49.90%), Postives = 366/525 (69.71%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            VV  S ++YY W+  +++T+L+N  ++  RA F   Q  +   W + DY+ D V I+D  +  RTGFLE GL+V D  K+  +Y+  L FKLD   ILP +L  +   +  I     RFNRL    ++FEF DRT+TRTN+PNIFRI +L++++L+IIHWN C ++ IS S+G GSD +V+P  S +   T++             Y+Y  +WSTLTLTTI E+P PV + E++ +  + L GVLIFA+IVGNVGSMISN+NA + +FQ ++D +K YM FR VS+ELE R+I WFDYLW NK+++DE+EVL  LP+KLRAEIAI+VH ET++ V +F+DCE  LL++L+LKL+ QVFSPGDYICRKGDIGKEMYI+K GKL VVA+DG+  +  L  GS FGE+SILNI GSK GNRRTAN+RS+GYSDLFCL+KDDL + + EYPDAK  L +RG+EIL K+ L+D E +++  L     E  + ++E S+    ++ ++L+ D+      +K +++ +E+QI
Sbjct:  122 VVSPSDDIYYRWLLVISITVLYNWFVVVARACFDELQVTFFIWWLVLDYISDTVYILDTIVRLRTGFLEQGLLVKDHIKLRDSYVRTLQFKLDVASILPTDLGYI---ATGIHTPQLRFNRLLHFPRMFEFFDRTETRTNYPNIFRICNLVLYILVIIHWNACIYYAISKSLGFGSDTWVFPNASRTGFTTLS-----------ESYVYCLYWSTLTLTTIGEMPPPVRDEEYLFVVFDFLVGVLIFATIVGNVGSMISNMNATRAEFQARIDAIKHYMHFRKVSRELETRVIKWFDYLWTNKKAVDEQEVLKNLPNKLRAEIAINVHLETLKKVRIFKDCEAGLLVELVLKLRQQVFSPGDYICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLTSGSCFGEISILNIKGSKMGNRRTANIRSLGYSDLFCLSKDDLMEAVIEYPDAKTVLEERGREILKKEGLLD-ENADSGGLQKEDTEEKVERLEMSLDTLQTRFARLLNDYTHTQQRLKQRVTLLEQQI 631          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 498.434 bits (1282), Expect = 1.414e-168
Identity = 276/600 (46.00%), Postives = 390/600 (65.00%), Query Frame = 2
Query:  287 WICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHV-VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTG--------------------------FLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            W   R      R+D  L      P   E  +  N++   K+    + V ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG                          +LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:   43 WTSFRMNPPEERRDSFLERFRG-PKLKEASNAGNRSDEDKLRHRRKEVWIMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 626          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Match: cnga3a (cyclic nucleotide gated channel subunit alpha 3 [Source:NCBI gene;Acc:101163892])

HSP 1 Score: 498.434 bits (1282), Expect = 1.159e-167
Identity = 266/551 (48.28%), Postives = 374/551 (67.88%), Query Frame = 2
Query:  431 VVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTG--------------------------FLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQI 2005
            ++D S++ YY W+  +   + +N++++  RA+F   QK Y  +W + DY  DI+ + D F+ SRTG                          +LE GL+V D +K+   Y +   FK D   ++P +L  L       D   +RFNRL KI +LFEF +RT+TRT+FPN+FRIS+L++++L+IIHWN C FF IS +IG GSD +VYP  S+     +A             Y+Y+ +WSTLTLTTI E P PV + E++ +  + L GVLIFASIVGNVG+MISN+NA + +FQ K+D +K+YM+FR V+K+LE R+I WFDYLW  K++ DE+EVL TLPDKL+AEIAI+VH +T++ V +FQDCE  LLI+L+LKL+ QVFSPGDYIC+KGDIG+EMYI+K GKL VVA+DG+  FV L++G+ FGE+SIL I GSK+GNRRTAN+RSVGYSDLF L+KDDL + L EYPDAK  L ++GK ILMKDNLID EA  N   +   +E  I K++ ++    +  +QL+ ++ +    +K +++K+E+++
Sbjct:  154 IMDPSADQYYRWLTVIAGPVFYNLMMIVTRASFNDLQKSYTKLWIVLDYTSDIIYLADTFVRSRTGIVAVWFGAPLLVGFCSSSPVLFCPSGYLEQGLLVKDSKKLRDKYRTTSQFKYDMIAMIPTDLLFL---QYGFDNPEFRFNRLCKIQRLFEFFERTETRTSFPNMFRISNLVLYILVIIHWNACAFFSISKTIGFGSDTWVYPNISHPEHGRLA-----------RKYIYSLYWSTLTLTTIGETPAPVRDVEYLFVIADFLTGVLIFASIVGNVGAMISNMNASRAEFQAKIDSIKQYMQFRKVTKDLEARVIKWFDYLWTEKKTCDEKEVLKTLPDKLKAEIAINVHLDTLKKVRIFQDCEAGLLIELVLKLQPQVFSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGAYFGEISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMEALTEYPDAKKALEEKGKAILMKDNLID-EAVANAGADPKDLEEKIVKLQGNLDMMQTNFAQLMAEYTSGQMRIKQRVTKMEEKV 689          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 961.059 bits (2483), Expect = 0.000e+0
Identity = 482/578 (83.39%), Postives = 538/578 (93.08%), Query Frame = 2
Query:  284 MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 2017
            MWICNRFRKKSNRKDE LPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++  +  SI
Sbjct:    1 MWICNRFRKKSNRKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 578          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000035733.1 (SMESG000035733.1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 499/578 (86.33%), Postives = 527/578 (91.18%), Query Frame = 2
Query:  284 MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 2017
            M +  R +K   R +E+ PV+     + E I       FT+I  W Q  VVDSSS  YYNWIG LT+T+LFN+++LPVRAAF IPQ+ YR +W++FDY+ID  N+ID+ I SR  FLE GL+V +  ++ KNYISK+ FK+D   ILP+ELFSLI P +NIDYVWYRFNRLTKIYKLFEFI+RTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI
Sbjct:    1 MTLWKRIKKCFVRNNERFPVLG----NIENIPPLKGDLFTRIGSWNQKFVVDSSSVFYYNWIGVLTLTVLFNILVLPVRAAFVIPQRKYRSLWYVFDYIIDSGNVIDIIINSRKCFLEQGLLVKEVNRLRKNYISKIEFKIDLIAILPIELFSLILPHRNIDYVWYRFNRLTKIYKLFEFINRTDTRTNFPNIFRISSLIIFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLILKLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 574          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000013398.1 (SMESG000013398.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 474/570 (83.16%), Postives = 530/570 (92.98%), Query Frame = 2
Query:  308 KKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNXXXXXXXXXXXXXXXHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMKCKLSKIEKQIFFSI 2017
            KKSNRKDE LPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLI+FLLI+IHWNGCFFFF+SNSIGLGSDGFVYPPRSN+T+ T+++ V++PWDQF +MY+Y+FFWSTLTLTT+AEVP PV N EFIIMT+ELLGGVLIFA+I+GNVGSMISN+NA KTDFQMK+DGVKRYMEFRGV KELE+RIINWFDYLW+NKQSLDE+ +LSTLPDKL+AEIA+ VHYET++ V +FQDCE++LL+QLILKL++QVFSPGDYICRKGDIGKEMYIVKRGKLNVVA+DGIKVFVTL EGSVFGELSILNIPGSKSGNRRTANV+SVGYSDLFCLNKDDLWDVL E P+AK +LI+RGKEILMKDNL+DLEA++N L N + ++ I+ +I  ++  F++K S+L++DFE     MK KL  ++  +  SI
Sbjct:    2 KKSNRKDENLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVVVDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLIDIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLELFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLIVFLLIMIHWNGCFFFFVSNSIGLGSDGFVYPPRSNNTEATLSVSVSQPWDQFSTMYIYSFFWSTLTLTTVAEVPGPVFNSEFIIMTLELLGGVLIFATIIGNVGSMISNMNAAKTDFQMKIDGVKRYMEFRGVGKELERRIINWFDYLWINKQSLDEDTILSTLPDKLKAEIAVQVHYETLKGVKIFQDCEETLLVQLILKLRMQVFSPGDYICRKGDIGKEMYIVKRGKLNVVADDGIKVFVTLKEGSVFGELSILNIPGSKSGNRRTANVKSVGYSDLFCLNKDDLWDVLDENPEAKSRLIERGKEILMKDNLLDLEANKNSLNNPHTIDMILKRINENMSLFENKYSELVQDFEVEQEIMKSKLDDLQNVLNGSI 571          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000044898.1 (SMESG000044898.1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 293/326 (89.88%), Postives = 294/326 (90.18%), Query Frame = 2
Query:  998 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSSMK 1975
            MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP              GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQ                 GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS +K
Sbjct:    1 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP--------------GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQIR---------------GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHSIVK 297          
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Match: SMESG000044898.1 (SMESG000044898.1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 292/323 (90.40%), Postives = 292/323 (90.40%), Query Frame = 2
Query:  998 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSXXXXXXXXXXXXVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS 1966
            MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP              GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQ                 GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS
Sbjct:    1 MTIAIPVTEPWDQFPSMYMYAFFWSTLTLTTIAEVPRP--------------GGVLIFASIVGNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWVNKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQIR---------------GDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSVFGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKMKLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKISQLIEDFETAHS 294          
The following BLAST results are available for this feature:
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNGA39.347e-17951.33cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA31.848e-17851.33cyclic nucleotide gated channel subunit alpha 3 [S... [more]
CNGA15.983e-17550.48cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA15.983e-17550.48cyclic nucleotide gated channel subunit alpha 1 [S... [more]
CNGA15.983e-17550.48cyclic nucleotide gated channel subunit alpha 1 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tax-49.226e-15850.79Cyclic nucleotide-gated cation channel [Source:Un... [more]
cng-11.368e-10536.92Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
cng-24.248e-8631.17Cyclic Nucleotide Gated channel [Source:UniProtKB... [more]
che-65.000e-7529.72pep chromosome:WBcel235:IV:2104056:2111408:-1 gene... [more]
tax-26.367e-7233.96TAX2 [Source:UniProtKB/TrEMBL;Acc:G5EEE2][more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CngA2.051e-15445.28gene:FBgn0261612 transcript:FBtr0302924[more]
CngA6.324e-15245.54gene:FBgn0261612 transcript:FBtr0302925[more]
CG422608.270e-11643.74gene:FBgn0259145 transcript:FBtr0299573[more]
CG422607.855e-11443.76gene:FBgn0259145 transcript:FBtr0330241[more]
CG422601.672e-11343.74gene:FBgn0259145 transcript:FBtr0299572[more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b4.428e-17951.05cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga1b3.213e-17850.86cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3b2.925e-17150.57cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3b3.259e-17150.57cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3a7.952e-17050.29cyclic nucleotide gated channel subunit alpha 3a [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfyb3.235e-18052.00nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb5.665e-18052.00nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb1.238e-17952.00nuclear transcription factor Y subunit beta [Sourc... [more]
nfyb1.280e-17852.00nuclear transcription factor Y subunit beta [Sourc... [more]
amacr1.370e-17751.05alpha-methylacyl-CoA racemase [Source:Xenbase;Acc:... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnga39.763e-17950.38cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga39.763e-17950.38cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga32.411e-17850.38cyclic nucleotide gated channel alpha 3 [Source:MG... [more]
Cnga12.320e-17750.86cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
Cnga12.320e-17750.86cyclic nucleotide gated channel alpha 1 [Source:MG... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q90980|CNG3_CHICK0.000e+050.84Cyclic nucleotide-gated channel rod photoreceptor ... [more]
sp|Q29441|CNGA3_BOVIN1.606e-17951.70Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q9JJZ8|CNGA3_MOUSE6.829e-17850.38Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
sp|Q90805|CNG1_CHICK6.854e-17851.43Cyclic nucleotide-gated channel cone photoreceptor... [more]
sp|Q16281|CNGA3_HUMAN8.874e-17851.33Cyclic nucleotide-gated cation channel alpha-3 OS=... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7XJ780.000e+056.55Cyclic nucleotide-binding domain-containing protei... [more]
A0A183LJM50.000e+056.55Cyclic nucleotide-binding domain-containing protei... [more]
G4VGD70.000e+056.36Putative cyclic-nucleotide-gated cation channel OS... [more]
A0A504Z0W20.000e+055.64Cyclic nucleotide-gated channel cone photoreceptor... [more]
A0A4E0RSW70.000e+055.45Cyclic nucleotide-gated channel cone photoreceptor... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga1b4.719e-17650.00cyclic nucleotide gated channel subunit alpha 1b [... [more]
cnga3a3.074e-17150.29cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3b7.318e-17149.90cyclic nucleotide gated channel subunit alpha 3b [... [more]
cnga3a2.403e-17050.48cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga3b3.304e-17049.90cyclic nucleotide gated channel subunit alpha 3b [... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cngb1a2.278e-7131.55cyclic nucleotide gated channel subunit beta 1a [S... [more]
ENSPMAT00000005594.19.604e-2824.14pep scaffold:Pmarinus_7.0:GL476331:707593:738342:1... [more]
ENSPMAT00000005922.16.038e-2326.12pep scaffold:Pmarinus_7.0:GL476456:333240:381928:-... [more]
kcnh1b8.074e-2221.80potassium voltage-gated channel, subfamily H (eag-... [more]
ENSPMAT00000001558.17.786e-1423.74pep scaffold:Pmarinus_7.0:GL480650:659:21543:-1 ge... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353938.183e-14347.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346336.971e-11740.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495408.689e-9639.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399183.400e-9235.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353762.239e-8737.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnga3a1.024e-17350.67cyclic nucleotide gated channel subunit alpha 3 [S... [more]
ENSORLT00000025598.21.246e-17150.10cyclic nucleotide-gated channel cone photoreceptor... [more]
cnga2b8.867e-16949.90cyclic nucleotide gated channel subunit alpha 2 [S... [more]
cnga3a1.414e-16846.00cyclic nucleotide gated channel subunit alpha 3 [S... [more]
cnga3a1.159e-16748.28cyclic nucleotide gated channel subunit alpha 3 [S... [more]
back to top
BLAST of Cyclic nucleotide gated channel alpha 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013398.10.000e+083.39SMESG000013398.1[more]
SMESG000035733.10.000e+086.33SMESG000035733.1[more]
SMESG000013398.10.000e+083.16SMESG000013398.1[more]
SMESG000044898.10.000e+089.88SMESG000044898.1[more]
SMESG000044898.10.000e+090.40SMESG000044898.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005978 ID=SMED30005978|Name=Cyclic nucleotide gated channel alpha 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2073bp
GTTGGGTTCGGGGAATGGGGCGTCGACTGACAACTTTATTAATTACGGAG
AGAATAGAAAATGCAAACGCGAGCAGTTCTTGGCAGTTCTCATTTGATTG
TAGTTAAATAGATGAAATTCTCTAAAATAAGAATTACCTGTCATTATTTG
CGAATGATTCCATGGGAAAATTCCTTGTAATAGATTTTCATTTTTCATCG
ATTATATTCTTCAAATCTGATTCGTCAGGATTTTCATTGGATCAATTTCA
TACTCGATAGGAATTTTATTGATTTGGAATTTTATGTGGATTTGCAATCG
ATTCAGAAAAAAATCCAACAGAAAGGATGAAAAGCTCCCAGTCGTTGATT
CTCAGCCTGACGATGCCGAACTCATTCATTTTCAAAACAAAACTTTCTTT
ACGAAAATTAATTTATGGTACCAACATGTTGTCGTTGATTCGTCTTCAAA
TCTGTATTACAATTGGATTGGCACTTTAACTGTTACAATACTTTTTAATG
TCATCCTACTTCCTGTCAGGGCGGCCTTTTATATTCCCCAAAAAGATTAT
AGATATATGTGGTTCATCTTCGATTATCTAATAGATATAGTCAATATCAT
TGACTTGTTTATCGGATCAAGAACAGGTTTCTTAGAAATGGGTTTGATGG
TGACAGACAGAGAAAAAATGCTTAAAAATTATATTTCTAAATTGTCATTC
AAATTAGATTTCACGGGAATTTTACCTTTAGAATTATTCAGTTTAATTTC
CCCTTCCAAAAATATTGATTATGTTTGGTATCGATTTAATCGGCTCACAA
AAATCTATAAATTGTTTGAATTCATCGACCGCACGGATACTAGAACCAAC
TTCCCAAATATTTTCAGAATTTCTTCACTGATCATTTTCCTTCTAATTAT
AATTCATTGGAATGGTTGTTTTTTCTTTTTTATAAGTAATTCAATAGGAT
TGGGATCAGATGGCTTTGTGTATCCTCCGAGGTCCAACAGCACTGATATG
ACCATAGCAATTCCTGTTACTGAACCCTGGGACCAATTTCCTAGCATGTA
CATGTATGCTTTCTTTTGGTCAACATTGACTTTAACAACAATAGCAGAAG
TCCCAAGGCCCGTATTGAATTTTGAATTTATCATAATGACCGTGGAATTG
TTAGGGGGAGTGTTGATATTTGCCTCTATTGTTGGAAATGTGGGATCCAT
GATTTCCAACGTGAACGCTGTGAAAACCGACTTTCAAATGAAAATGGACG
GAGTTAAACGATACATGGAATTCCGAGGAGTTAGTAAAGAATTGGAAAAA
CGAATCATAAACTGGTTCGATTATTTATGGGTCAACAAGCAGTCTCTGGA
TGAAGAAGAAGTTCTATCAACTCTGCCCGATAAACTTAGGGCAGAAATTG
CTATCCATGTCCATTATGAAACCATAAGAAACGTATCAGTTTTTCAAGAC
TGTGAGCAAAGTCTGCTAATCCAGTTAATTTTAAAACTTAAATTACAAGT
GTTTAGTCCGGGAGATTATATATGCCGAAAAGGTGATATTGGAAAGGAAA
TGTATATTGTAAAACGTGGGAAATTGAACGTGGTGGCTGAGGATGGAATA
AAGGTTTTTGTAACTTTAAATGAAGGAAGTGTGTTTGGAGAGTTATCAAT
TCTCAATATTCCTGGAAGTAAAAGCGGAAATCGTCGGACCGCTAATGTAA
GATCGGTTGGATATTCAGATTTGTTTTGTTTAAACAAAGATGATCTTTGG
GATGTCTTGGCTGAATATCCCGATGCAAAAATGAAATTGATTCAACGTGG
TAAAGAAATTCTGATGAAAGATAACCTTATTGATTTAGAGGCAAGTGAAA
ATGTATTATTAAACGATAACGGCATGGAAAATATCATAAATAAAATTGAA
TCTTCAATAAAAGGATTTGATTCAAAGATTTCACAACTTATAGAAGATTT
CGAAACAGCCCATTCAAGTATGAAATGTAAACTTTCAAAAATTGAAAAGC
AGATTTTCTTTTCTATTTGAGAAAAACATTTTTCCCAATTTACTGTGATT
TTTTAATTGTTTAAATGAGTAGA
back to top

protein sequence of SMED30005978-orf-1

>SMED30005978-orf-1 ID=SMED30005978-orf-1|Name=SMED30005978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MWICNRFRKKSNRKDEKLPVVDSQPDDAELIHFQNKTFFTKINLWYQHVV
VDSSSNLYYNWIGTLTVTILFNVILLPVRAAFYIPQKDYRYMWFIFDYLI
DIVNIIDLFIGSRTGFLEMGLMVTDREKMLKNYISKLSFKLDFTGILPLE
LFSLISPSKNIDYVWYRFNRLTKIYKLFEFIDRTDTRTNFPNIFRISSLI
IFLLIIIHWNGCFFFFISNSIGLGSDGFVYPPRSNSTDMTIAIPVTEPWD
QFPSMYMYAFFWSTLTLTTIAEVPRPVLNFEFIIMTVELLGGVLIFASIV
GNVGSMISNVNAVKTDFQMKMDGVKRYMEFRGVSKELEKRIINWFDYLWV
NKQSLDEEEVLSTLPDKLRAEIAIHVHYETIRNVSVFQDCEQSLLIQLIL
KLKLQVFSPGDYICRKGDIGKEMYIVKRGKLNVVAEDGIKVFVTLNEGSV
FGELSILNIPGSKSGNRRTANVRSVGYSDLFCLNKDDLWDVLAEYPDAKM
KLIQRGKEILMKDNLIDLEASENVLLNDNGMENIINKIESSIKGFDSKIS
QLIEDFETAHSSMKCKLSKIEKQIFFSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005249voltage-gated potassium channel activity
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR005821Ion_trans_dom
IPR014710RmlC-like_jellyroll
IPR032406CLZ_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45638:SF6CYCLIC NUCLEOTIDE-GATED CATION CHANNEL ALPHA-3coord: 45..194
NoneNo IPR availablePANTHERPTHR45638FAMILY NOT NAMEDcoord: 45..194
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 54..190
NoneNo IPR availableTMHMMTMhelixcoord: 57..79
NoneNo IPR availableTMHMMTMhelixcoord: 94..116