CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30005962
Length (bp)1913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30005962) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30005962) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CCHC-type domain-containing protein (SMED30005962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30005962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005962SMESG000031867.1 SMESG000031866.1 SmedASXL_006078SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005962SMESG000031867.1 SMESG000031866.1 SmedASXL_006078SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30005962SMESG000031867.1 dd_Smed_v4_6978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005962SMESG000031867.1 dd_Smed_v4_6978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005962SMESG000031867.1 dd_Smed_v4_6978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 243.817 bits (621), Expect = 4.062e-72
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 242.662 bits (618), Expect = 1.793e-71
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 243.432 bits (620), Expect = 4.639e-71
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 244.202 bits (622), Expect = 5.210e-71
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:  165 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 455          
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Match: SF1 (splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:12950])

HSP 1 Score: 243.047 bits (619), Expect = 6.066e-71
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: sfa-1 (SF1 protein; Splicing FActor [Source:UniProtKB/TrEMBL;Acc:G5EF97])

HSP 1 Score: 209.534 bits (532), Expect = 1.483e-58
Identity = 118/295 (40.00%), Postives = 171/295 (57.97%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKI------------LSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELG 1443
            +P  L  D    Y +Q++I   T KL   ++    E   R+PSP+PVY  +GKR+NT+E R R+ +E+ +   I  L  + P+  P AD +    R+ +KV+IPQ+ +PD+NF GL+IGPRG T K LE ETG KI++RGKGS K GKL     P+PGE+EPLHAY+T      + +A EKIK++I +    P+  N+LRK Q+++LA+LNGT+R  D  N  +               +A ++ TN I C+ CG  GH+ +DCK   N   M         ++ EY+  + ELG
Sbjct:  208 LPADLTEDQRNAYLLQLEIEDATRKLRLADFGV-AEGRERSPSPEPVYDANGKRLNTREVRKRQELEQLRHEKIQALLKINPNFKPPADYRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLKSLEAETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTGTDMNVIKKACEKIKQVIAEATALPD-NNELRKLQLRELALLNGTFRPEDLANGARCSNCGSDEHKSWECPDAPNV-TNQIKCTNCGAFGHISKDCK---NPKGMY---ASEAGMDDEYSALMAELG 493          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 103.99 bits (258), Expect = 3.885e-24
Identity = 56/125 (44.80%), Postives = 80/125 (64.00%), Query Frame = 1
Query:  889 EKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYR 1239
            EKVF+P  ++PD NF G I+GPRGMT K LE+ETG KI++RG+GS +  K   LN G        E LH  I     E+     + RAVE+++K++   +  PE ++DL++ Q+ +LAI+NGTYR
Sbjct:   90 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 104.375 bits (259), Expect = 9.247e-24
Identity = 56/125 (44.80%), Postives = 80/125 (64.00%), Query Frame = 1
Query:  889 EKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYR 1239
            EKVF+P  ++PD NF G I+GPRGMT K LE+ETG KI++RG+GS +  K   LN G        E LH  I     E+     + RAVE+++K++   +  PE ++DL++ Q+ +LAI+NGTYR
Sbjct:   90 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 211          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 103.99 bits (258), Expect = 2.680e-23
Identity = 56/125 (44.80%), Postives = 80/125 (64.00%), Query Frame = 1
Query:  889 EKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYR 1239
            EKVF+P  ++PD NF G I+GPRGMT K LE+ETG KI++RG+GS +  K   LN G        E LH  I     E+     + RAVE+++K++   +  PE ++DL++ Q+ +LAI+NGTYR
Sbjct:  162 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 283          
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Match: asd-2 (RNA-binding protein asd-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EFF1])

HSP 1 Score: 103.219 bits (256), Expect = 3.603e-23
Identity = 56/125 (44.80%), Postives = 80/125 (64.00%), Query Frame = 1
Query:  889 EKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYR 1239
            EKVF+P  ++PD NF G I+GPRGMT K LE+ETG KI++RG+GS +  K   LN G        E LH  I     E+     + RAVE+++K++   +  PE ++DL++ Q+ +LAI+NGTYR
Sbjct:  132 EKVFVPAKEHPDYNFVGRILGPRGMTAKQLEQETGCKIMVRGRGSMRDKKKEELNRGKPNWEHLSEELHVLIQCEDTENRAKVKLMRAVEEVRKLL---VPAPEGEDDLKRKQLMELAIINGTYR 253          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: SF1 (gene:FBgn0025571 transcript:FBtr0083456)

HSP 1 Score: 252.292 bits (643), Expect = 1.651e-73
Identity = 132/293 (45.05%), Postives = 186/293 (63.48%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSA-PLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD-------GLNKLKILSEAQSIATNTIICSLCGGTGHLPRDC--KVNSNEIPMMEFPVQHVQLEGEYNNFINELG 1443
            +P  L P   E Y +Q QI  ++ KL   +         R+PSP+P+Y  DGKR+NT+E+R R+R+EE++  LI+++  + P+  P AD K    R+ +KV IPQ+ +PDINF GL+IGPRG T K +EK+TG KI++RGKGS K GK+      PLPGEDEPLHA+IT+ + E+V +AV+KIK +I+ GIE PE  NDLR+ Q+++LA LNGT RE D         +        + I TNTI+C+ CGGTGHL +DC  K   + +P M       +++ EY + + ELG
Sbjct:  295 LPSTLDPAQQEAYLVQFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGEDEPLHAFITAPNPEAVRKAVDKIKDVIRQGIEVPEGHNDLRRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIVCTSCGGTGHLTKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELG 587          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0100514)

HSP 1 Score: 94.3597 bits (233), Expect = 2.168e-20
Identity = 53/129 (41.09%), Postives = 81/129 (62.79%), Query Frame = 1
Query:  883 IEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
            + EKV++P  ++PD NF G I+GPRGMT K LE+ETG KI++RGKGS +  K    N G        + LH  IT    E+     + +AV +++K++   +   E +++L+K Q+ +LAI+NGTYR+T
Sbjct:  137 MNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLL---VPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084178)

HSP 1 Score: 93.9745 bits (232), Expect = 2.330e-20
Identity = 53/129 (41.09%), Postives = 81/129 (62.79%), Query Frame = 1
Query:  883 IEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
            + EKV++P  ++PD NF G I+GPRGMT K LE+ETG KI++RGKGS +  K    N G        + LH  IT    E+     + +AV +++K++   +   E +++L+K Q+ +LAI+NGTYR+T
Sbjct:  137 MNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLL---VPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0084177)

HSP 1 Score: 93.9745 bits (232), Expect = 3.082e-20
Identity = 53/129 (41.09%), Postives = 81/129 (62.79%), Query Frame = 1
Query:  883 IEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
            + EKV++P  ++PD NF G I+GPRGMT K LE+ETG KI++RGKGS +  K    N G        + LH  IT    E+     + +AV +++K++   +   E +++L+K Q+ +LAI+NGTYR+T
Sbjct:  137 MNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLL---VPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Match: how (gene:FBgn0264491 transcript:FBtr0301401)

HSP 1 Score: 93.9745 bits (232), Expect = 3.082e-20
Identity = 53/129 (41.09%), Postives = 81/129 (62.79%), Query Frame = 1
Query:  883 IEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
            + EKV++P  ++PD NF G I+GPRGMT K LE+ETG KI++RGKGS +  K    N G        + LH  IT    E+     + +AV +++K++   +   E +++L+K Q+ +LAI+NGTYR+T
Sbjct:  137 MNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCKIMVRGKGSMRDKKKEDANRGKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLL---VPQAEGEDELKKRQLMELAIINGTYRDT 262          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 248.44 bits (633), Expect = 9.170e-74
Identity = 135/292 (46.23%), Postives = 184/292 (63.01%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSI----ATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQ----LEGEYNNFINELG 1443
            +P  L  D    Y +Q+QI  LT KL   +    +    R+PSP+P+Y  +GKR+NT+EYR R+++EE + +LI  +  L P+  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL   QS      TNT +C+ CGG GH+  DCK  S+  P    P Q  Q    ++ EY + + ELG
Sbjct:   40 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGEPPQSAQDKARMDKEYLSLMAELG 327          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 248.054 bits (632), Expect = 9.330e-73
Identity = 135/292 (46.23%), Postives = 184/292 (63.01%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSI----ATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQ----LEGEYNNFINELG 1443
            +P  L  D    Y +Q+QI  LT KL   +    +    R+PSP+P+Y  +GKR+NT+EYR R+++EE + +LI  +  L P+  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL   QS      TNT +C+ CGG GH+  DCK  S+  P    P Q  Q    ++ EY + + ELG
Sbjct:  112 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSTEPRSITNTTLCTKCGGAGHISSDCKFTSSFAPRPGEPPQSAQDKARMDKEYLSLMAELG 399          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 99.7525 bits (247), Expect = 1.317e-22
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   59 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 187          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 99.7525 bits (247), Expect = 1.528e-22
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Match: qki2 (QKI, KH domain containing, RNA binding 2 [Source:NCBI gene;Acc:393815])

HSP 1 Score: 99.3673 bits (246), Expect = 2.049e-22
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 239.965 bits (611), Expect = 6.649e-71
Identity = 134/291 (46.05%), Postives = 185/291 (63.57%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEI-PMMEFPVQ-HVQLEGEYNNFINELG 1443
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  +  L PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AV++I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S  + P      Q   +++ EY + + ELG
Sbjct:   44 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFTSVTVRPGEPQSAQDKARMDKEYLSLMAELG 329          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 238.81 bits (608), Expect = 1.445e-69
Identity = 134/291 (46.05%), Postives = 185/291 (63.57%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEI-PMMEFPVQ-HVQLEGEYNNFINELG 1443
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  +  L PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AV++I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S  + P      Q   +++ EY + + ELG
Sbjct:   74 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFTSVTVRPGEPQSAQDKARMDKEYLSLMAELG 359          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: men1 (menin 1 [Source:NCBI gene;Acc:549115])

HSP 1 Score: 238.424 bits (607), Expect = 2.943e-69
Identity = 134/291 (46.05%), Postives = 185/291 (63.57%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEI-PMMEFPVQ-HVQLEGEYNNFINELG 1443
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  +  L PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AV++I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S  + P      Q   +++ EY + + ELG
Sbjct:  101 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVDQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFTSVTVRPGEPQSAQDKARMDKEYLSLMAELG 386          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 96.6709 bits (239), Expect = 2.503e-21
Identity = 55/132 (41.67%), Postives = 83/132 (62.88%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
             +++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT    ++     + RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   81 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 209          
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Match: spsb3 (splA/ryanodine receptor domain and SOCS box containing 3 [Source:Xenbase;Acc:XB-GENE-971062])

HSP 1 Score: 92.0485 bits (227), Expect = 2.309e-19
Identity = 55/147 (37.41%), Postives = 83/147 (56.46%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK------------------LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
             +++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K                   N G       +E LH  IT    ++     + RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:  105 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKAVTNILECSILALNKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 248          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 237.654 bits (605), Expect = 3.130e-73
Identity = 127/259 (49.03%), Postives = 171/259 (66.02%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCK 1353
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK
Sbjct:   14 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCK 267          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 237.654 bits (605), Expect = 3.130e-73
Identity = 127/259 (49.03%), Postives = 171/259 (66.02%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCK 1353
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK
Sbjct:   14 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCK 267          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 241.891 bits (616), Expect = 1.616e-71
Identity = 138/301 (45.85%), Postives = 189/301 (62.79%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 241.891 bits (616), Expect = 1.616e-71
Identity = 138/301 (45.85%), Postives = 189/301 (62.79%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Match: Sf1 (splicing factor 1 [Source:MGI Symbol;Acc:MGI:1095403])

HSP 1 Score: 241.121 bits (614), Expect = 5.043e-71
Identity = 138/301 (45.85%), Postives = 189/301 (62.79%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15637|SF01_HUMAN (Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 PE=1 SV=4)

HSP 1 Score: 243.432 bits (620), Expect = 2.228e-70
Identity = 139/301 (46.18%), Postives = 190/301 (63.12%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE + NLI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q64213|SF01_MOUSE (Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 PE=1 SV=6)

HSP 1 Score: 241.121 bits (614), Expect = 2.379e-69
Identity = 138/301 (45.85%), Postives = 189/301 (62.79%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +         R+PSP+P+Y  +GKR+NT+E+R R+++EE +  LI  + AL PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK      P  +      +++ EY + + ELG  EA   PA +G
Sbjct:   40 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHTLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSETRSI-TNTTVCTKCGGAGHIASDCKFQRPGDP--QSAQDKARMDKEYLSLMAELG--EAPV-PASVG 330          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|O74555|BBP_SCHPO (Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bpb1 PE=1 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.399e-48
Identity = 100/288 (34.72%), Postives = 158/288 (54.86%), Query Frame = 1
Query:  628 EVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIA------------TNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEA 1455
            E+YS+ +++  +T KL   +         R+PSP P Y + G+R+NT+E R ++++E+ +  +I R   + P     +D    A+ +EKV++P  DYP+INF GL+IGPRG T KD+E ++G KI +RGKGS K GK     +     +E LH  +T+ S + ++ A++ I  +IQ     PE QNDL++NQ++QLA LNGT R+ +     ++     ++             T  I+C  CG  GH+ RDC V   + PM +        + EY + + ELG   A
Sbjct:  103 ELYSLNVRLEEITQKLRTGDVVPHHRE--RSPSPPPQYDNHGRRLNTREIRYKKKLEDERHRIIERAMKMVPGFRAPSDYRRPAKTQEKVYVPVKDYPEINFIGLLIGPRGHTLKDMEAKSGAKIAIRGKGSVKEGKGRSDPSVRGNMEEDLHCLVTADSEDKINHAIKLIDNVIQTAASVPEGQNDLKRNQLRQLATLNGTLRDDEN----QVCQNCGNVGHRRFDCPERINHTMNIVCRHCGSIGHIARDCPVRDQQPPMAD-----STADREYQSLMQELGGGSA 379          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4WXV6|BBP_ASPFU (Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bbp PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.011e-46
Identity = 93/249 (37.35%), Postives = 145/249 (58.23%), Query Frame = 1
Query:  628 EVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDG--------LNKLKILSEAQSIATNTIICSLCGGTGHLPRDC 1350
            E Y++ ++I  ++ KL   +         R+PSP P Y + G+R+NT+EYR R+R+E+ +  L+ +     P+  P +D     + +EKV++P +DYP+INF GL+IGPRG T K +E E+G KI +RGKGS K GK    +A    ++E LH  I + + E V++A + +  +I+     PE QN+L++NQ+++LA LNGT R+ +         +   K     Q   T  IIC +CG  GH+ RDC
Sbjct:   98 EAYTLHLRIEEISQKLRINDVVPADGD--RSPSPPPQYDNFGRRVNTREYRYRKRLEDERHKLVEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMEAESGAKIAIRGKGSVKEGKGRSDAAHASNQEEDLHCLIMADTEEKVNKAKKLVHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAGHMARDC 344          
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NIW7|BBP_NEUCR (Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=bbp-1 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.308e-46
Identity = 95/249 (38.15%), Postives = 145/249 (58.23%), Query Frame = 1
Query:  628 EVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDG--------LNKLKILSEAQSIATNTIICSLCGGTGHLPRDC 1350
            E Y++ ++I  +T KL   +         R+PSP P Y + G+R+NT+EYR R+++E+ +  LI +     P+  P +D     + +EKV++P +DYP+INF GL+IGPRG T K +E E+G KI +RGKGS K GK    +A    ++E LH  I + + E V++A + I  II+     PE QN+L++NQ+++LA LNGT R+ +         +   K     +   T  IIC +CG  GH+ RDC
Sbjct:  113 EAYTLHLRIEEITQKLKIDDVVPADGD--RSPSPAPQYDNHGRRVNTREYRYRKKLEDERHKLIEKAMKTIPNYHPPSDYRRPTKTQEKVYVPVNDYPEINFIGLLIGPRGNTLKKMETESGAKIAIRGKGSVKEGKGRSDAAHSSNQEEDLHCLIMADTEEKVNKAKKLIHNIIETAASIPEGQNELKRNQLRELAALNGTLRDDENQACQNCGQIGHRKYDCPEKQNYTANIICRVCGNAGHMARDC 359          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A4V6J6 (SF1 protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 4.307e-141
Identity = 225/250 (90.00%), Postives = 232/250 (92.80%), Query Frame = 1
Query:  358 SRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESLVKQEASVKTEDSDNNXXXXXXXXXXXXXXXXGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMS 1107
            +RK KPIK+E+  Y+E  SSKR SPKKE +D   +SQ   KQES VKQE SVKTEDSD NSEKAARKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIE MCR+ SPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMS
Sbjct:    3 TRKRKPIKEESI-YTEVFSSKRFSPKKEEFDYQPESQSLFKQESYVKQECSVKTEDSDGNSEKAARKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIETMCRSASPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMS 251          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A504YE84 (Splicing factor 1 OS=Fasciola gigantica OX=46835 GN=FGIG_05464 PE=4 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 8.367e-86
Identity = 144/294 (48.98%), Postives = 204/294 (69.39%), Query Frame = 1
Query:  595 KVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNG-GSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMME----FPVQHVQLEGEYNNFINELGIDEAS 1458
            ++P  L P    +Y IQ+QI  ++ +L   +         R+PSP+P+Y  DGKR+NT+EYR R++MEE + +L+ +L  L PD  P AD K    RI +KVFIPQD++PDINF GL+IGPRG T K LEKETG K+++RGKGS K GKL      P+PGEDEPLHA++++ + E+V +AV+KI +II+ GIE PE QNDLR+ Q+++LA+LNGT RE +GL KL+ ++EAQ+IATN I C +CGG GHL +DCK N + +  ++     P +  +++ EY+  + ELG+  AS
Sbjct:   55 QLPPNLTPQQERIYIIQLQIEDISRRLKCGDLGIPKNPEDRSPSPEPIYSSDGKRLNTREYRTRKKMEEERHSLVQQLTELNPDYKPPADYKPPQNRITDKVFIPQDNHPDINFVGLLIGPRGNTLKALEKETGAKVIIRGKGSVKEGKLGRRDGLPMPGEDEPLHAFVSAPTAEAVQKAVKKINEIIRQGIEVPESQNDLRRAQLRELALLNGTLREHEGLMKLRAMAEAQTIATNKIHCGICGGAGHLSQDCKANLSAMAYIDQLNNNPTERAKMDSEYSALMAELGVGAAS 348          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A0R3SKU2 (CCHC-type domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS5555 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 3.352e-85
Identity = 145/289 (50.17%), Postives = 197/289 (68.17%), Query Frame = 1
Query:  595 KVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKL-NGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF---PVQHVQLEGEYNNFINELGI 1446
            ++P  L PD  ++Y +Q+QI  LT +L   +         R+PSP+PVY  DGKR+NT+EYR R+ MEE + N I ++  L P+  P  D +    +I +K+FIPQDD+P INF GL+IGPRG T K LEKETG KI++RGKGS K GKL      P+PGEDEPLHA+I++ + ES  +AVEKI+ II+ GIE PE +NDLRK Q+++LA+LNGT RE +GL +L+ LSEAQ+IATN I CSLCGG GHL  DCK+    + + +    P +  +++ EY   + ELG+
Sbjct:   50 QLPPNLTPDQEKMYILQLQIEDLTRRLKTGDLGIPANPEDRSPSPEPVYSSDGKRLNTREYRTRKTMEENRHNFIQQMLELNPEYKPPIDYRAPNNKITDKIFIPQDDHPHINFVGLLIGPRGNTLKALEKETGAKIIIRGKGSVKDGKLVRRDGMPIPGEDEPLHAFISATTPESCQKAVEKIESIIRQGIEVPEGENDLRKAQLRELALLNGTLREHEGLARLRALSEAQNIATNKIQCSLCGGFGHLASDCKLRDPNVSVEQLGINPTERAKMDSEYTALMAELGV 338          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A0R3TEP9 (KH domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS5536 PE=4 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 1.131e-83
Identity = 142/290 (48.97%), Postives = 195/290 (67.24%), Query Frame = 1
Query:  592 AKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKL-NGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF---PVQHVQLEGEYNNFINELGI 1446
             ++P  L  +  ++Y +Q+QI  LT +L   +         R+PSP+PVY  DGKR+NT+EYR R+ MEE + N I ++  L P+  P  D +    +I +K+FIPQDD+P INF GL+IGPRG T K LEKETG KI++RGKGS K GKL      P+PGEDEPLHA+I++ + ES  +AVEKI+ II+ GIE PE +NDLRK Q+++LA+LNGT RE +GL +L+ LSEAQ+IATN I CSLC G GHL  DCK+    + + +    P +  +++ EY   + ELG+
Sbjct:   49 TQLPPNLTAEQEKMYILQLQIEDLTRRLKTGDLGISANPEDRSPSPEPVYSSDGKRLNTREYRTRKTMEENRHNFIQQMLELNPEYKPPIDYRAPNNKITDKIFIPQDDHPHINFVGLLIGPRGNTLKALEKETGAKIIIRGKGSVKDGKLVRRDGMPIPGEDEPLHAFISATTPESCQKAVEKIESIIRQGIEVPEGENDLRKAQLRELALLNGTLREHEGLARLRALSEAQNIATNKIQCSLCLGLGHLASDCKLRDPNVSVEQLGINPTERAKMDSEYTALMAELGV 338          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A068Y7E6 (Zinc finger protein OS=Echinococcus multilocularis OX=6211 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.418e-83
Identity = 143/303 (47.19%), Postives = 200/303 (66.01%), Query Frame = 1
Query:  595 KVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKL-NGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF---PVQHVQLEGEYNNFINELGIDEASAKPAYLGFMP 1488
            ++P  L P   ++Y +Q+QI  +T +L   +         R+PSP+PVY  DGKR+NT+EYR R+ MEE + N I ++  L PD  P  D +    +I +K+FIPQ+D+P INF GL+IGPRG T K LEKETG KI++RGKGS K GKL      P+PGEDEPLHA++++ + ES  +AVEKI+ II+ GIE PE +NDLRK+Q+++LA+LNGT RE +GL +L+ ++EAQ+IATN I CS+CGG GHL  DCK+    + M      P++  +++ EY   + ELG+    A     G  P
Sbjct:   51 QLPPNLTPAQEKMYILQLQIEDITRRLKTGDLGIPANPEDRSPSPEPVYSSDGKRLNTREYRTRKTMEENRHNFIQQMLELNPDYKPPIDYRAPQNKITDKIFIPQEDHPHINFVGLLIGPRGNTLKALEKETGAKIIIRGKGSVKDGKLIRRDGMPIPGEDEPLHAFVSAATPESCQKAVEKIQSIIRQGIEVPEGENDLRKSQLRELALLNGTLREHEGLARLRAMAEAQNIATNKIQCSMCGGFGHLASDCKLRDPSVTMEHMGINPMERAKMDSEYTALMAELGVGYGGAATLPPGVAP 353          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 245.743 bits (626), Expect = 2.980e-71
Identity = 140/305 (45.90%), Postives = 191/305 (62.62%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQ----LEGEYNNFINELGIDEASAKPAYLG 1479
            +P  L  +    Y +Q+QI  LT KL   +    +    R+PSP+P+Y  +GKR+NT+EYR R+++EE + +LI  +  L P+  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S+       P Q  Q    ++ EY + + ELG  EA   PA  G
Sbjct:  192 IPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKLEEERHSLITEMVGLNPEFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQSSEPRSI-TNTTLCTKCGGAGHIASDCKFTSSYTQRQGEPPQSAQDKARMDKEYLSLMAELG--EAPVPPAGGG 489          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 100.523 bits (249), Expect = 8.722e-23
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 100.523 bits (249), Expect = 9.696e-23
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qki2 (protein quaking-B [Source:NCBI gene;Acc:103029551])

HSP 1 Score: 100.138 bits (248), Expect = 1.181e-22
Identity = 58/132 (43.94%), Postives = 85/132 (64.39%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT---SMSRESV--DRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT   S +R  +   RAVE++KK++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEVKKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Match: qkib (QKI, KH domain containing, RNA binding b [Source:ZFIN;Acc:ZDB-GENE-081028-54])

HSP 1 Score: 95.5153 bits (236), Expect = 4.029e-21
Identity = 54/132 (40.91%), Postives = 82/132 (62.12%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
             +++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K    N G       +E LH  IT    ++     + RAVE++ K++   +   E ++ L+K Q+ +LAILNGTYR+ +
Sbjct:   80 VQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKVRANRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVNKLL---VPAAEGEDSLKKMQLMELAILNGTYRDAN 208          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: sf1 (splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2492])

HSP 1 Score: 232.646 bits (592), Expect = 1.585e-67
Identity = 126/286 (44.06%), Postives = 185/286 (64.69%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSA-PLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYR--ETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELG 1443
            +P  L  D    Y +Q+QI  +  KL   +         R+PSP+P+Y ++GKR+NT+EYR R+++E+ +  LI  +Y L PD  P AD K    +I E++ IPQD++PDINF GLIIGPRG T K +EKE   KI++RGKGS K GK+      PLPGEDEPLHA +T+ ++++V +AV++IK I++ GIE PE QN+LR+ Q+++LA LNGT R  E+  L   +   E +S+ TN  IC+ CGG GH+  DC+++S   P  +   +  +++ EY + + ELG
Sbjct:  110 LPPGLNKDQERAYIVQLQIEDMNRKLRTGDLGIPPNPEERSPSPEPIYNNEGKRLNTREYRTRKKIEDDRHVLIQEMYRLNPDYKPPADYKPPAQKISERIMIPQDEHPDINFIGLIIGPRGNTLKKIEKECNAKIMIRGKGSVKEGKIGHKPGQPLPGEDEPLHALVTASTQDNVRKAVDQIKNILKQGIEVPEGQNELRRMQLRELARLNGTLRDDESRVLRPWQAPPETRSV-TNMTICNRCGGAGHIASDCRISSMGPP--QGNQERARMDEEYLSLMAELG 392          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs2 (KH domain containing, RNA binding, signal transduction associated 2 [Source:NCBI gene;Acc:768147])

HSP 1 Score: 62.3882 bits (150), Expect = 8.807e-11
Identity = 38/127 (29.92%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  880 RIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKL-----NGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNG 1230
            ++ E+V IP   +P  NF G ++GPRG + K +++ETGTK+ + GKGS +   L       G        E LH  I   +  S     +  A++++KK +      P+  +++R+ Q+++L+ L G
Sbjct:   36 KLAERVIIPAKQHPKFNFVGKLLGPRGNSLKRMQEETGTKMSILGKGSMRDKALEEEMRKSGENKYAHLSEELHVLIEVFAPPSEAYSRMGHALDEVKKYL-----VPDYNDEIRQEQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: KHDRBS3 (KH RNA binding domain containing, signal transduction associated 3 [Source:HGNC Symbol;Acc:HGNC:18117])

HSP 1 Score: 61.2326 bits (147), Expect = 1.191e-10
Identity = 39/127 (30.71%), Postives = 68/127 (53.54%), Query Frame = 1
Query:  880 RIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAK-----PGKLNGGSAPLPGEDEPLHAYIT-----SMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNG 1230
            ++ E+V IP   +P  NF G ++GPRG + K L++ETGTK+ + GKGS +           G A     +E LH  I      S +   +  A++++KK +      P+  +++R+ Q+++L+ L G
Sbjct:   36 KLIERVIIPVRQHPKFNFIGKLLGPRGNSLKRLKEETGTKLSILGKGSMRDRDKEEDLRKSGEAKYAHLNEDLHVLIEVFAPPSQAYRRMGHALDEVKKYL-----VPDYNDEIRQQQLRELSFLKG 157          
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Match: khdrbs1a (KH domain containing, RNA binding, signal transduction associated 1a [Source:ZFIN;Acc:ZDB-GENE-000210-25])

HSP 1 Score: 61.6178 bits (148), Expect = 2.010e-10
Identity = 41/128 (32.03%), Postives = 66/128 (51.56%), Query Frame = 1
Query:  880 RIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGS----AKPGKL-NGGSAPLPGEDEPLHAYITSM-----SRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGT 1233
            ++ EKV IP   +P  NF G ++GP+G T K L+ ETGT++ + GKG     AK  +L N G A     +E LH  I        +   +  A+E++KK        P+  +++ + Q+ ++  LNG 
Sbjct:   60 KLAEKVLIPAKQHPKFNFVGKLLGPQGNTLKRLQVETGTRMAIMGKGCMKDRAKEEELRNSGEAKYVHLNEELHVLIEVYAPLPEAYSRMGHALEEVKKFFN-----PDYNDEICQEQLMEMTYLNGV 182          
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Match: MSL5 (Component of commitment complex; which defines first step in splicing pathway; essential protein that interacts with Mud2p and Prp40p, forming a bridge between the intron ends; also involved in nuclear retention of pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000004106])

HSP 1 Score: 162.54 bits (410), Expect = 5.033e-44
Identity = 94/261 (36.02%), Postives = 144/261 (55.17%), Query Frame = 1
Query:  628 EVYSIQI--QINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGE---DEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD------GLNKLKILSEAQSIATNT--IICSLCGGTGHLPRDCKVNSNEI 1371
            ++YS Q+  +I  +T KL   ++        R+PSP PVY   GKR NT+E R R+++E+ +  L+       P  VP  D     + ++K +IP D YPD+NF GL++GPRG T + L++++  KI +RG+GS K GK N    P PG    ++PLH  I + S + + + ++  + I+   +  PE QNDL++ Q+++LA LNGT RE +      GL   K          N   I+C +CG TGH  RDC  +S  +
Sbjct:   62 QIYSYQVMFRIQEITIKLRTNDFVPPSRKN-RSPSPPPVYDAQGKRTNTREQRYRKKLEDERIKLVEIALKTIPYFVPPDDYKRPTKFQDKYYIPVDQYPDVNFVGLLLGPRGRTLRKLQEDSNCKIAIRGRGSVKEGK-NASDLP-PGAMNFEDPLHCLIIADSEDKIQKGIKVCQNIVIKAVTSPEGQNDLKRGQLRELAELNGTLREDNRPCPICGLKDHKRYDCPNRKIPNIQGIVCKICGQTGHFSRDCNSSSQRM 319          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO45484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSV9])

HSP 1 Score: 144.436 bits (363), Expect = 3.843e-39
Identity = 78/178 (43.82%), Postives = 112/178 (62.92%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGG---SAPLPGEDEPLHAYITSMSRESV 1119
            +P  LKPD  + Y +Q++I  ++  L   +         R+PSP+P+Y  DGKR+NT+++R R+R+E+ +   I  +  + PD  P AD K    +I++KV IPQD+ P++NF GL+IGPRG T K++EKET  KI++RGKGS K GK   G        GEDEPLHA +T  + ESV
Sbjct:   84 LPPNLKPDQQKAYLMQLRIEEISRMLRTGDLGIPDNPEDRSPSPEPIYNTDGKRLNTRDFRVRKRLEDERHKFIQDMMKINPDFKPPADYKPPLIKIQDKVMIPQDENPEVNFIGLLIGPRGNTLKNMEKETNAKIMIRGKGSIKDGKQGRGRDMQLMNSGEDEPLHALVTGPTAESV 261          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO30297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T170])

HSP 1 Score: 88.9669 bits (219), Expect = 1.996e-20
Identity = 50/131 (38.17%), Postives = 79/131 (60.31%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPG---EDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
             ++ EKV+ P  ++P  NF G +IGPRGMT +++E  TG K+L+RGKGS K  KL       P     DE LH  I+    E      +++AVE+++ +++      E +++++K Q+K LA+LNGT RE+
Sbjct:   51 VKLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKLEEEKRGQPNYEHLDEDLHVLISCEDTEERCHTRLEKAVERVQSLLRP---VEEGEDEIKKKQLKDLALLNGTLRES 178          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO44127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWI4])

HSP 1 Score: 70.4774 bits (171), Expect = 3.334e-14
Identity = 46/127 (36.22%), Postives = 68/127 (53.54%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSA----KPGKLNGGSAPLPGE-DEPLHAYIT-----SMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILN 1227
             ++ EKVFIP  D+P  NF G ++GPRG T K L+  TGTK+ + GKGS     K  +L     P      E LH  I        +   +  A+E+IKK +      PE+ +++ + QM+++AILN
Sbjct:   47 VKLSEKVFIPVKDHPKFNFVGKLLGPRGNTFKRLQNSTGTKMSILGKGSMRDKEKEEELRATEDPKYAHLGEELHVLIEVEAPPGQAHARLGIAIEEIKKYL-----IPEMNDEIHQEQMREMAILN 168          
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Match: EDO28641 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5W9])

HSP 1 Score: 63.5438 bits (153), Expect = 4.651e-12
Identity = 28/54 (51.85%), Postives = 39/54 (72.22%), Query Frame = 1
Query:  880 RIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKL 1041
            ++ EKV+ P  ++P  NF G +IGPRGMT +++E  TG K+L+RGKGS K  KL
Sbjct:   91 KLVEKVYAPVKEFPKFNFVGRVIGPRGMTLREIESTTGCKLLVRGKGSMKDKKL 144          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 240.736 bits (613), Expect = 4.535e-70
Identity = 137/296 (46.28%), Postives = 184/296 (62.16%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF---PVQHVQ----LEGEYNNFINELG 1443
            +P  L  D    Y +Q+QI  LT KL   +    +    R+PSP+P+Y  +GKR+NT+EYR R+++EE +  LI  +  L PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S           P Q  Q    ++ EY + + ELG
Sbjct:  111 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQNSEPRSI-TNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELG 401          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: sf1 (splicing factor 1 [Source:NCBI gene;Acc:101157648])

HSP 1 Score: 240.736 bits (613), Expect = 5.353e-70
Identity = 137/296 (46.28%), Postives = 184/296 (62.16%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHAD-KMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAP-LPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKIL-----SEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF---PVQHVQ----LEGEYNNFINELG 1443
            +P  L  D    Y +Q+QI  LT KL   +    +    R+PSP+P+Y  +GKR+NT+EYR R+++EE +  LI  +  L PD  P AD K    R+ +KV IPQD+YP+INF GL+IGPRG T K++EKE   KI++RGKGS K GK+       LPGEDEPLHA +T+ + E+V +AVE+I+ I++ GIE PE QNDLRK Q+++LA LNGT RE D     +IL     SE +SI TNT +C+ CGG GH+  DCK  S           P Q  Q    ++ EY + + ELG
Sbjct:  111 IPPGLTRDQERAYIVQLQIEDLTRKLRTGDLGIPVNPEDRSPSPEPIYNSEGKRLNTREYRTRKKIEEERHALITEMIGLNPDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECCAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDN----RILRPWQNSEPRSI-TNTTLCTKCGGAGHISSDCKYTSTFAAHRATGGEPPQSAQDKARMDKEYLSLMAELG 401          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045137.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 99.3673 bits (246), Expect = 2.103e-22
Identity = 54/132 (40.91%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT-----SMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K   +N G       +E LH  IT     + ++  + RA+ ++KK++   +   E +++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044982.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 99.3673 bits (246), Expect = 2.285e-22
Identity = 54/132 (40.91%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT-----SMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K   +N G       +E LH  IT     + ++  + RA+ ++KK++   +   E +++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033069.1 (protein quaking-B-like [Source:NCBI gene;Acc:101161529])

HSP 1 Score: 99.3673 bits (246), Expect = 2.477e-22
Identity = 54/132 (40.91%), Postives = 86/132 (65.15%), Query Frame = 1
Query:  877 ARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGK---LNGGSAPLPGEDEPLHAYIT-----SMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETD 1248
            A+++EK+++P  +YPD NF G I+GPRG+T K LE ETG KI++RGKGS +  K   +N G       +E LH  IT     + ++  + RA+ ++KK++   +   E +++L+K Q+ +LAILNGTYR+ +
Sbjct:   82 AQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEMNRGKPNWEHLNEDLHVLITVEDTHNRAKIKLQRAINEVKKLL---VPAAEGEDNLKKMQLMELAILNGTYRDAN 210          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031867.1 (SMESG000031867.1)

HSP 1 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 460/462 (99.57%), Postives = 461/462 (99.78%), Query Frame = 1
Query:  169 NKSPXXXXXXXXXXXXXXXXXXXXEHSNDSKRERSPKRKRQDYSPESSYRKKHHKRDRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESLVKQEASVKTEDSDNNXXXXXXXXXXXXXXXXGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPXXXXXXXXXXXXXFVRNFIFRS 1554
            NKSPSRADHSSRKRKDKDRDYKRREHSNDSKRERSPKRKRQDYSPESSYRKKHHKRDRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESL+KQEASVKTEDSDNNSEKA RKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPQQSSGNSSQGASSFVRNFIFRS
Sbjct:   45 NKSPSRADHSSRKRKDKDRDYKRREHSNDSKRERSPKRKRQDYSPESSYRKKHHKRDRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESLIKQEASVKTEDSDNNSEKATRKRKRESKWSSGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPQQSSGNSSQGASSFVRNFIFRS 506          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000060577.1 (SMESG000060577.1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 301/425 (70.82%), Postives = 358/425 (84.24%), Query Frame = 1
Query:  280 RKRQDYSPESSYRKKHHKRDRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQESLVKQEASVKTEDSDNNXXXXXXXXXXXXXXXXGQAKVPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEFPVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPXXXXXXXXXXXXXFVRNFIFRS 1554
            RKR ++S + S R KH KR+RS  + +R E  +K EN E SE +SSKR           +D++ +   + +++ +   +   + +N+ ++ RKRKRESKW +GQAKVP+YL  +DAEVYSIQIQ+NS+TTKL Q+NY EEIEAMCR PSPDPVY H+GKRINTKE+RARER+++RKRNLILRL+ALRP+LVPHADKM+GARIEE++FIPQ+DYPDINFAGLIIGPRGMTQK+LEKETGTKIL+RGKGSAKPG+ NG  APLPGEDEPLHAY+TSMSRESVD+A EKI+KIIQDGIEFPELQNDLRKNQMKQLAI NGTYRET+GLNKLKIL EAQSI TNTIICSLCGGTGHLPRDC VNSN IPMM FP QH +LEGEY+NFINELG+D    KPA+LGF+PQ +SGN++QG SSFV+NFIFR+
Sbjct:   68 RKRHEHSRDHSDRIKHRKRERSNFSPTRNESLMKLENFENSEHRSSKRTD---------YDTRRYSPTQHILRSDHKEENFFNSDNNSESTRKRKRESKWGTGQAKVPMYLNSEDAEVYSIQIQLNSVTTKLTQRNYAEEIEAMCREPSPDPVYNHEGKRINTKEFRARERLDDRKRNLILRLHALRPELVPHADKMIGARIEERIFIPQEDYPDINFAGLIIGPRGMTQKELEKETGTKILIRGKGSAKPGQFNGDGAPLPGEDEPLHAYVTSMSRESVDKAAEKIRKIIQDGIEFPELQNDLRKNQMKQLAIFNGTYRETEGLNKLKILGEAQSIVTNTIICSLCGGTGHLPRDCLVNSNLIPMMHFPPQHAKLEGEYDNFINELGVDGTDTKPAFLGFIPQHNSGNTTQGTSSFVKNFIFRN 483          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000031862.1 (SMESG000031862.1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.019e-147
Identity = 218/321 (67.91%), Postives = 256/321 (79.75%), Query Frame = 1
Query:  598 VPLYLKPDDAEVYSIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRARERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLHAYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSN--EIPMMEFPVQHVQLEGEYNNFINELGID-EASAKPAYLGFMPXX-XXXXXXXXXXXFVRNFIF 1548
            +P  + P DAEVY IQ+QI  +T+KL +QNYT EIEAM R PSPDP+YG DGKRINTKEYRARER+E+RK+ L+L+L+ LRPDLVPH DK+ G R EEKVFIPQDDYPDIN  GLIIGPRG+T KDLEKE   KI++RGKGS   GK+N  + PLPGEDE LHAYITS S+E V++A ++I KIIQ+GI+FPEL+NDLRKNQMKQLAILNGTYRETDGLNKLK+L EAQS  TNTIICSLCGGTGHLPRDCKVN N  E P +  P Q   L+GEY +F+NELG +   +  PAYLGF+P+      S  GA+SFVR F+F
Sbjct:   48 IPPNMNPKDAEVYIIQLQITDITSKLQKQNYTSEIEAMTRLPSPDPIYGPDGKRINTKEYRARERLEDRKKQLMLKLHTLRPDLVPHTDKI-GGRFEEKVFIPQDDYPDINLIGLIIGPRGLTLKDLEKEYNVKIIIRGKGSIHNGKVNVNNVPLPGEDECLHAYITSFSKECVEKATDRINKIIQEGIDFPELENDLRKNQMKQLAILNGTYRETDGLNKLKMLGEAQSCVTNTIICSLCGGTGHLPRDCKVNQNPAEFPPLNIP-QSSPLDGEYKSFMNELGSEGRPTVLPAYLGFLPEFPPPNASVDGANSFVRKFVF 366          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000068399.1 (SMESG000068399.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.162e-20
Identity = 52/134 (38.81%), Postives = 83/134 (61.94%), Query Frame = 1
Query:  883 IEEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKP--------GKLNGGSAPLPGEDEPLHAYITSMSRES-----VDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTYRET 1245
            ++EKV++P D+ P+ NF G I+GPRG+T K LE+E   K+++RGKGS +         GK N         ++ LH  IT    E+     +  A++ I+K I+ GI+ P+ ++D++K Q+ +LAI+NGTYR+T
Sbjct:   92 LQEKVYVPVDENPNYNFIGRILGPRGLTAKQLEQELQCKLMIRGKGSLRNKEKEDELRGKPNWEHL-----NDKLHINITVEDYENRAVIKLKWALDAIEKFIEQGIKMPDGEDDIKKRQLMELAIINGTYRDT 220          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000080790.1 (SMESG000080790.1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.487e-13
Identity = 45/126 (35.71%), Postives = 71/126 (56.35%), Query Frame = 1
Query:  886 EEKVFIPQDDYPDINFAGLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGE---DEPLHAYITSMSRES-VDRAVEKIKK----IIQDGIEFPELQNDLRKNQMKQLAILNGTYR 1239
            +EK+F+P  + P+ NF G I+GPRG T K LE++   KI++RG+GS +       +   P     +E LH  I     E+ VD  +  IK+     IQ+G+  PE  + L++ Q+ +L+ILN + R
Sbjct:   64 QEKIFLPVKENPNYNFVGRILGPRGYTAKQLEQKLDCKIMIRGRGSMRDQNKEEQNRNKPNWEHLNEDLHVLINISDCENRVDEKMNTIKEAISSFIQEGLNTPESLDTLKQMQLMELSILNESDR 189          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF14.062e-7246.18splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF11.793e-7146.18splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF14.639e-7146.18splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF15.210e-7146.18splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
SF16.066e-7146.18splicing factor 1 [Source:HGNC Symbol;Acc:HGNC:129... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfa-11.483e-5840.00SF1 protein; Splicing FActor [Source:UniProtKB/Tr... [more]
asd-23.885e-2444.80RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-29.247e-2444.80RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-22.680e-2344.80RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
asd-23.603e-2344.80RNA-binding protein asd-2 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SF11.651e-7345.05gene:FBgn0025571 transcript:FBtr0083456[more]
how2.168e-2041.09gene:FBgn0264491 transcript:FBtr0100514[more]
how2.330e-2041.09gene:FBgn0264491 transcript:FBtr0084178[more]
how3.082e-2041.09gene:FBgn0264491 transcript:FBtr0084177[more]
how3.082e-2041.09gene:FBgn0264491 transcript:FBtr0301401[more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf19.170e-7446.23splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
sf19.330e-7346.23splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qki21.317e-2243.94QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qki21.528e-2243.94QKI, KH domain containing, RNA binding 2 [Source:N... [more]
qki22.049e-2243.94QKI, KH domain containing, RNA binding 2 [Source:N... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
men16.649e-7146.05menin 1 [Source:NCBI gene;Acc:549115][more]
men11.445e-6946.05menin 1 [Source:NCBI gene;Acc:549115][more]
men12.943e-6946.05menin 1 [Source:NCBI gene;Acc:549115][more]
spsb32.503e-2141.67splA/ryanodine receptor domain and SOCS box contai... [more]
spsb32.309e-1937.41splA/ryanodine receptor domain and SOCS box contai... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sf13.130e-7349.03splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf13.130e-7349.03splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.616e-7145.85splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf11.616e-7145.85splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
Sf15.043e-7145.85splicing factor 1 [Source:MGI Symbol;Acc:MGI:10954... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15637|SF01_HUMAN2.228e-7046.18Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1 P... [more]
sp|Q64213|SF01_MOUSE2.379e-6945.85Splicing factor 1 OS=Mus musculus OX=10090 GN=Sf1 ... [more]
sp|O74555|BBP_SCHPO5.399e-4834.72Branchpoint-bridging protein OS=Schizosaccharomyce... [more]
sp|Q4WXV6|BBP_ASPFU2.011e-4637.35Branchpoint-bridging protein OS=Neosartorya fumiga... [more]
sp|Q8NIW7|BBP_NEUCR2.308e-4638.15Branchpoint-bridging protein OS=Neurospora crassa ... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4V6J64.307e-14190.00SF1 protein (Fragment) OS=Dugesia japonica OX=6161... [more]
A0A504YE848.367e-8648.98Splicing factor 1 OS=Fasciola gigantica OX=46835 G... [more]
A0A0R3SKU23.352e-8550.17CCHC-type domain-containing protein OS=Hymenolepis... [more]
A0A0R3TEP91.131e-8348.97KH domain-containing protein OS=Rodentolepis nana ... [more]
A0A068Y7E61.418e-8347.19Zinc finger protein OS=Echinococcus multilocularis... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf12.980e-7145.90splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
qki28.722e-2343.94protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki29.696e-2343.94protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qki21.181e-2243.94protein quaking-B [Source:NCBI gene;Acc:103029551][more]
qkib4.029e-2140.91QKI, KH domain containing, RNA binding b [Source:Z... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf11.585e-6744.06splicing factor 1 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
khdrbs28.807e-1129.92KH domain containing, RNA binding, signal transduc... [more]
KHDRBS31.191e-1030.71KH RNA binding domain containing, signal transduct... [more]
khdrbs1a2.010e-1032.03KH domain containing, RNA binding, signal transduc... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MSL55.033e-4436.02Component of commitment complex; which defines fir... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO454843.843e-3943.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302971.996e-2038.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441273.334e-1436.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286414.651e-1251.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf14.535e-7046.28splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
sf15.353e-7046.28splicing factor 1 [Source:NCBI gene;Acc:101157648][more]
ENSORLT00000045137.12.103e-2240.91protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000044982.12.285e-2240.91protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
ENSORLT00000033069.12.477e-2240.91protein quaking-B-like [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031867.10.000e+099.57SMESG000031867.1[more]
SMESG000060577.10.000e+070.82SMESG000060577.1[more]
SMESG000031862.11.019e-14767.91SMESG000031862.1[more]
SMESG000068399.12.162e-2038.81SMESG000068399.1[more]
SMESG000080790.14.487e-1335.71SMESG000080790.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005962 ID=SMED30005962|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1913bp
CTCAAATACGAAAAATTGTATTGATAAATTTTAGAAATGACAAGAAAAGA
TAAATCTCCTTCGCGTAGAGATAGAAGGCGTTCATCTACTGATACTGATT
CATATAGAAGAAAACAAAAGGACCATAGACGTAGAGATAGAGATAGATCT
TCTCAAGAATCTTCAAGAAATAAATCTCCGTCAAGAGCTGATCATTCCTC
TCGAAAAAGAAAAGATAAAGATCGTGATTATAAACGACGTGAACATTCAA
ATGATTCTAAAAGAGAACGCTCTCCGAAGCGTAAACGTCAAGATTATTCT
CCTGAATCTTCTTACCGTAAAAAACATCATAAACGCGACAGATCTTATTC
TAATTCAAGTAGAAAAGAAAAGCCAATAAAGCAAGAAAATAATGAATACT
CGGAAACACAAAGTTCCAAAAGAATTTCTCCAAAAAAAGAAACTTATGAT
TCTTATCACGATTCTCAAATATTTGTCAAGCAAGAGAGTCTTGTTAAACA
AGAAGCAAGTGTAAAAACAGAAGATTCTGATAATAATTCTGAAAAGGCAG
CTCGTAAAAGAAAACGTGAAAGTAAATGGAGTTCTGGGCAAGCTAAAGTA
CCATTGTATTTAAAACCAGATGACGCAGAAGTATATTCGATTCAAATCCA
GATTAACAGTCTTACAACCAAATTAGCCCAGCAGAATTATACTGAAGAAA
TTGAAGCTATGTGCCGCGCACCTTCTCCAGATCCAGTTTATGGTCATGAT
GGTAAGCGTATTAATACAAAGGAGTATCGAGCTCGAGAACGCATGGAAGA
ACGAAAACGAAATCTAATCCTTAGACTTTATGCATTAAGACCGGATTTGG
TTCCTCATGCTGATAAAATGATGGGAGCAAGAATAGAAGAAAAAGTATTT
ATACCCCAGGATGATTATCCTGATATTAATTTTGCTGGATTGATAATAGG
CCCCCGTGGTATGACACAGAAAGATCTTGAAAAAGAAACAGGAACTAAAA
TTTTATTACGTGGTAAAGGTAGCGCAAAGCCAGGTAAACTAAATGGTGGA
AGCGCTCCTCTCCCTGGAGAAGATGAACCACTCCATGCTTACATCACATC
GATGTCCAGAGAAAGTGTCGATAGGGCAGTGGAAAAAATTAAAAAAATCA
TTCAAGATGGCATAGAATTCCCGGAATTGCAAAATGATTTGCGAAAAAAT
CAAATGAAACAGTTAGCCATTCTTAACGGAACTTATCGAGAAACCGATGG
ATTAAACAAACTGAAAATCCTGAGCGAGGCCCAATCTATCGCTACAAATA
CAATCATTTGCAGTCTATGTGGCGGCACGGGACATTTGCCCCGAGACTGT
AAAGTGAACAGTAACGAAATACCGATGATGGAATTTCCGGTCCAACACGT
TCAACTCGAAGGGGAATACAACAATTTCATAAATGAATTGGGTATAGATG
AAGCTTCAGCAAAGCCAGCATATTTGGGATTTATGCCGCAACAATCATCC
GGTAATTCAAGTCAAGGCGCGAGTTCATTCGTTAGAAATTTTATATTTAG
AAGTTGAACATACGTTTGTATTATTGATATCTTTGATACGAATATCTGCA
AATTGTAATATTATTTATGATTTTCAGTGAAACAAAAATAAAAAAAGTGT
TTAGCAAATTGTAATTTCTAAAATTCAAGCTCGGGTAGTATTTCATGTTG
AATAATATTTCAGGAATTGGTTGACTGGGGATTGGTGGTATCGAGGTATT
GCACACAGATTGTCTCGTTAATGATTTATTTTTTTAGGATTGTGAATTGA
ATACGAATCTTCGGGATATTTAGTTTTTTATTATATTTTATTTTCATAAT
TATTTTATTGATTGATTTCTAATGCAGCACAAACCAGCCCAGCCAGAACT
GGATTGCTTTATT
back to top

protein sequence of SMED30005962-orf-1

>SMED30005962-orf-1 ID=SMED30005962-orf-1|Name=SMED30005962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=507bp
MTRKDKSPSRRDRRRSSTDTDSYRRKQKDHRRRDRDRSSQESSRNKSPSR
ADHSSRKRKDKDRDYKRREHSNDSKRERSPKRKRQDYSPESSYRKKHHKR
DRSYSNSSRKEKPIKQENNEYSETQSSKRISPKKETYDSYHDSQIFVKQE
SLVKQEASVKTEDSDNNSEKAARKRKRESKWSSGQAKVPLYLKPDDAEVY
SIQIQINSLTTKLAQQNYTEEIEAMCRAPSPDPVYGHDGKRINTKEYRAR
ERMEERKRNLILRLYALRPDLVPHADKMMGARIEEKVFIPQDDYPDINFA
GLIIGPRGMTQKDLEKETGTKILLRGKGSAKPGKLNGGSAPLPGEDEPLH
AYITSMSRESVDRAVEKIKKIIQDGIEFPELQNDLRKNQMKQLAILNGTY
RETDGLNKLKILSEAQSIATNTIICSLCGGTGHLPRDCKVNSNEIPMMEF
PVQHVQLEGEYNNFINELGIDEASAKPAYLGFMPQQSSGNSSQGASSFVR
NFIFRS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR031150BBP/SF1
IPR004087KH_dom
IPR004088KH_dom_type_1
IPR032570SF1-HH
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0008270zinc ion binding
GO:0045131pre-mRNA branch point binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0000243commitment complex
GO:0005634nucleus
GO:0005681spliceosomal complex
GO:0005737cytoplasm
GO:0005829cytosol
GO:0071004U2-type prespliceosome
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0045292mRNA cis splicing, via spliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 281..373
e-value: 8.8E-9
score: 45.2
IPR032570Splicing factor 1, helix-hairpin domainPFAMPF16275SF1-HHcoord: 175..275
e-value: 3.9E-17
score: 62.6
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 210..407
e-value: 2.4E-47
score: 163.6
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 283..401
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 287..369
e-value: 2.4E-5
score: 24.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 155..182
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..94
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..184
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 127..141
NoneNo IPR availablePANTHERPTHR11208RNA-BINDING PROTEIN RELATEDcoord: 116..482
NoneNo IPR availableCDDcd02395SF1_like-KHcoord: 285..401
e-value: 6.04147E-43
score: 146.62
IPR031150BBP/SF1 familyPANTHERPTHR11208:SF45SPLICING FACTOR 1coord: 116..482
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 425..439
score: 8.763