Aminoacylase-1

Overview
NameAminoacylase-1
Smed IDSMED30005961
Length (bp)1249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aminoacylase-1 (SMED30005961) t-SNE clustered cells

Violin plots show distribution of expression levels for Aminoacylase-1 (SMED30005961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aminoacylase-1 (SMED30005961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aminoacylase-1 (SMED30005961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005961SMESG000028073.1 dd_Smed_v4_12209_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005961SMESG000028073.1 dd_Smed_v6_12209_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30005961SMESG000028073.1 dd_Smed_v4_12209_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 365.155 bits (936), Expect = 2.138e-123
Identity = 167/392 (42.60%), Postives = 243/392 (61.99%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY  AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 365.155 bits (936), Expect = 2.138e-123
Identity = 167/392 (42.60%), Postives = 243/392 (61.99%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY  AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ABHD14A-ACY1 (ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:HGNC:38856])

HSP 1 Score: 363.999 bits (933), Expect = 1.146e-120
Identity = 166/386 (43.01%), Postives = 240/386 (62.18%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            +V  F +YL+  TV P PDY  AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+
Sbjct:  202 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLL 585          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ABHD14A-ACY1 (ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:HGNC:38856])

HSP 1 Score: 342.813 bits (878), Expect = 2.807e-113
Identity = 157/370 (42.43%), Postives = 230/370 (62.16%), Query Frame = 2
Query:  110 AVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:  135 AVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 502          
BLAST of Aminoacylase-1 vs. Ensembl Human
Match: ACY1 (aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177])

HSP 1 Score: 328.176 bits (840), Expect = 1.754e-109
Identity = 157/392 (40.05%), Postives = 228/392 (58.16%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY                                   G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDY-----------------------------------GTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 366          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C10C5.3 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17898])

HSP 1 Score: 324.324 bits (830), Expect = 4.454e-108
Identity = 164/386 (42.49%), Postives = 236/386 (61.14%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            AV  F EYL+  T  PNPDY+   +FL   + +LG+     E  P    VIM   G   +L S +  SH DVVP F + W + P+SA  D++ +I+ARG+QDMKC G Q +EA+R +         +R I++++ PDEE+ G  GMK F ++ +F ++N+G  +DEG+ S  + Y VFY +RV  W+KV   G+ GHGSQF++NTA  KL+  L     FR++++A +  N +LT+GDVTT+N+  V GGVQ NVIP  F    DIR++P ++ NE +  +++W ++ G+G+ YEF +HS    +TP    + +W+ FE   K    K   +V    TDSR VRE G+ AI FSP+ NTP L H HNE LN   F+RGI+ Y+ LI
Sbjct:    7 AVTRFREYLRVNTEQPNPDYAACRDFLFKYADELGIARRSFETVPGAIFVIMTIPGSQPELPSIMLYSHTDVVPTFREHWTHDPYSAFKDEDGNIFARGAQDMKCVGVQQMEALRNLFAQGIRQW-KRTIHLVWGPDEEIFGINGMKGFAKTDEFKKLNLGFSLDEGMPSDDDVYKVFYAERVAWWVKVTFPGNPGHGSQFMENTAMEKLERYLASARKFRDEQKALLESNPDLTIGDVTTLNVNIVNGGVQFNVIPEKFEAFVDIRLTPSIDFNEMRNKLDQWVKDAGEGVTYEFSKHSDLKLVTPHTRDDPFWVAFEDSLKQEKCKFTTEVLIGSTDSRIVREAGVRAINFSPLINTPLLAHAHNEFLNEKVFLRGIEIYQTLI 391          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 319.701 bits (818), Expect = 3.561e-106
Identity = 161/392 (41.07%), Postives = 239/392 (60.97%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
             V  F EYL+  T  P PDY    +FL   + +LG+E   +E  P    VIM   G   DL S +  SH DVVP F + W + P+SA  D++ +I+ARG+QDMKC G QY+EA+R            R I+I++ PDEE+G   GMK F  +++F ++NI   +DEGI +  + Y +FY +R+  W+KV + G  GHGS+FI+ TA  KL  ++    +FR ++++ + E+   T+GDVTT N+T + GGVQ NV+P  F    DIR++P  +++   A +++WA+E G+G+ YEF+Q S    ++P    + +W   +   +    K   ++F   TDSR+VR +GI AIGFSPI NTP LLHDHNE LN  TF+RG++ YE LI + +++
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFREYWTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 396          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 319.701 bits (818), Expect = 3.561e-106
Identity = 161/392 (41.07%), Postives = 239/392 (60.97%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
             V  F EYL+  T  P PDY    +FL   + +LG+E   +E  P    VIM   G   DL S +  SH DVVP F + W + P+SA  D++ +I+ARG+QDMKC G QY+EA+R            R I+I++ PDEE+G   GMK F  +++F ++NI   +DEGI +  + Y +FY +R+  W+KV + G  GHGS+FI+ TA  KL  ++    +FR ++++ + E+   T+GDVTT N+T + GGVQ NV+P  F    DIR++P  +++   A +++WA+E G+G+ YEF+Q S    ++P    + +W   +   +    K   ++F   TDSR+VR +GI AIGFSPI NTP LLHDHNE LN  TF+RG++ YE LI + +++
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFREYWTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 396          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C10C5.5 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17900])

HSP 1 Score: 318.931 bits (816), Expect = 5.261e-106
Identity = 161/386 (41.71%), Postives = 238/386 (61.66%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            AV  F EYL+  T  PNP+Y+   +FL   + +LG+    +E  P   +VIM   G   +L S +  SH DVVP F + W + P+SA  D++ +I+ARG+QDMKC G Q +EA+R +         +R I++++ PDEE+ G  GMK F ++ +F ++N+G  +DEG+ S  + Y VFY +RV  W+KV   G+ GHGSQF++NTA  KL+  L     FR +++  +  N NLTLGDVTT+N+  V GGVQ NVIP  F    D+R++P  + N+ + M+++WA+  G+G+ YEF Q+S    ++     N +W  FE      N K    +  A TDSR+VR +G+++I FSP+ NTPFL HDHNE LN   F+RG++ Y+ +I
Sbjct:    7 AVTRFREYLRVNTEQPNPNYAACRDFLFKYADELGIARRSIETAPGVFLVIMTIPGSQPELPSIMLYSHTDVVPTFREHWTHDPYSAFKDEDGNIFARGAQDMKCVGVQQMEALRNLFAQGIRQW-KRTIHLVWGPDEEIFGINGMKGFAKTDEFKKLNLGFSLDEGMPSDDDVYKVFYAERVAWWVKVTFPGNPGHGSQFMENTAMEKLERFLASARKFRNEQKVVLESNPNLTLGDVTTLNVNIVNGGVQFNVIPEKFEAYVDMRLTPHEDFNKIREMLDQWAKNAGEGVTYEFSQYSDQKPISAHTRDNSFWAAFEDSLNQENCKFEKGIMVASTDSRFVRYEGVNSINFSPMINTPFLPHDHNEYLNEKVFLRGLEIYQTII 391          
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Match: C06A6.4 (Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4])

HSP 1 Score: 311.997 bits (798), Expect = 4.320e-103
Identity = 161/406 (39.66%), Postives = 240/406 (59.11%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSA--------------YLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
             V  F EYL+  T  P PDY    +FL   + +LG+E   +E  P    VIM   G   DL S +  SH DVVP F + W + P+SA  D++ +I+ARG+QDMKC G QY+EA+R            R I+I++ PDEE+G   GMK F  +++F ++NI   +DEGI +  + Y +FY +R+  W+KV + G  GHGS+FI+ TA  KL  ++    +FR ++++ + E+   T+GDVTT N+T + GGVQ NV+P  F    DIR++P  +++   A +++WA+E G+G+ YEF+Q +  A               ++P    + +W   +   +    K   ++F   TDSR+VR +GI AIGFSPI NTP LLHDHNE LN  TF+RG++ YE LI + +++
Sbjct:    6 GVTRFREYLRVNTEQPKPDYEACRDFLFKYADELGIERRSVETAPGTYFVIMTIPGSKPDLPSIMLYSHTDVVPTFREYWTHDPYSAFKDEDGNIFARGAQDMKCVGVQYMEALRNWFAKGVKQWT-RTIHIVWGPDEEIGHINGMKGFAVTEEFKKLNIDFALDEGIATEDDVYKIFYAERIPWWVKVTLPGHPGHGSKFIEKTAIEKLHKLIASVDEFRNEQKSLLAEHPEWTVGDVTTSNITIINGGVQVNVVPEKFEAYIDIRVTPLQDLDAVLARVDQWAKEAGEGVTYEFMQSTNPADKSTIDFETFSNFKLISPNTREDPFWAAIDDALQKEGCKYKKEIFIGATDSRFVRAQGIRAIGFSPIINTPSLLHDHNEFLNEKTFLRGVEIYETLINKLANV 410          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0084349)

HSP 1 Score: 380.948 bits (977), Expect = 4.570e-130
Identity = 183/390 (46.92%), Postives = 257/390 (65.90%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVL-EFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENN-LTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            NN+ ++ F EYL+  TVHPN DY+   EFL  Q+  L L + V+     +NP+V++KW G   +L S + NSH DVVPVF ++W + PFSA +D    I+ARGSQDMKC G+QYL A+R +K +   + P+R IY+ +VPDEEVGG  GM++ V+S  F ++N+G   DEGI+S    Y ++Y +R L  ++  ISG+ GHGS  + NTAG KL  ++ K M+FR+ +  ++ +++ L +GDVTTVNLT + GGVQ NV+P      FDIRI+  ++I  F+  + +W  E G GIE EF   +P    T IDS+N +W+ F+     L +K   +VFP  TDSRY+R  GI A+GFSPINNTP LLHDH+E L  DT++ GI+ Y+KLI
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVFEEKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLI 395          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0084348)

HSP 1 Score: 380.948 bits (977), Expect = 4.570e-130
Identity = 183/390 (46.92%), Postives = 257/390 (65.90%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVL-EFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENN-LTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            NN+ ++ F EYL+  TVHPN DY+   EFL  Q+  L L + V+     +NP+V++KW G   +L S + NSH DVVPVF ++W + PFSA +D    I+ARGSQDMKC G+QYL A+R +K +   + P+R IY+ +VPDEEVGG  GM++ V+S  F ++N+G   DEGI+S    Y ++Y +R L  ++  ISG+ GHGS  + NTAG KL  ++ K M+FR+ +  ++ +++ L +GDVTTVNLT + GGVQ NV+P      FDIRI+  ++I  F+  + +W  E G GIE EF   +P    T IDS+N +W+ F+     L +K   +VFP  TDSRY+R  GI A+GFSPINNTP LLHDH+E L  DT++ GI+ Y+KLI
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVFEEKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLI 395          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG6726 (gene:FBgn0039049 transcript:FBtr0344300)

HSP 1 Score: 380.948 bits (977), Expect = 4.570e-130
Identity = 183/390 (46.92%), Postives = 257/390 (65.90%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVL-EFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENN-LTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            NN+ ++ F EYL+  TVHPN DY+   EFL  Q+  L L + V+     +NP+V++KW G   +L S + NSH DVVPVF ++W + PFSA +D    I+ARGSQDMKC G+QYL A+R +K +   + P+R IY+ +VPDEEVGG  GM++ V+S  F ++N+G   DEGI+S    Y ++Y +R L  ++  ISG+ GHGS  + NTAG KL  ++ K M+FR+ +  ++ +++ L +GDVTTVNLT + GGVQ NV+P      FDIRI+  ++I  F+  + +W  E G GIE EF   +P    T IDS+N +W+ F+     L +K   +VFP  TDSRY+R  GI A+GFSPINNTP LLHDH+E L  DT++ GI+ Y+KLI
Sbjct:    8 NNEEIKIFREYLRIPTVHPNVDYTVCTEFLKRQAASLDLPVEVIYPVNEQNPVVVLKWQGSQPELPSIILNSHTDVVPVFEEKWTHGPFSADLDAEGRIFARGSQDMKCVGTQYLGAVRALKASG--YQPKRTIYLTYVPDEEVGGHLGMRELVKSDYFKKLNVGFSFDEGISSADETYALYYAERTLWHLRFKISGTAGHGSLLLPNTAGEKLNYVVGKMMEFRKSQVQKLADDSSLEIGDVTTVNLTQLRGGVQSNVVPPLLEAVFDIRIAVTVDIPAFEKQIRDWCEEAGGGIELEFEMKNPFVEPTKIDSSNAYWLAFKKALDDLGLKTRVRVFPGATDSRYIRYAGIPALGFSPINNTPILLHDHDEFLKADTYLHGIEVYKKLI 395          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG17110 (gene:FBgn0039050 transcript:FBtr0084350)

HSP 1 Score: 371.318 bits (952), Expect = 2.727e-126
Identity = 182/390 (46.67%), Postives = 251/390 (64.36%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVL-EFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            N++ +  F EYL+  +VHP+ DY+  VEFL  Q+ +L L + V+    P  P+VIMKW G++ +LKS + NSH+DVVPVFP++W + PF AHID    IYARG+QDMK  G QY+ A+R +K +   + P+R +Y+ FVPDEE GG  GM +FV+   F  MN+G  +DEGI S  + YPVFY +R L  ++   SG++GHGS   K+TAG K   +++K M FRE +   + E+ +L  GDVTT+NLT + GGVQ NV+P      FDIRI+   N +  +  + EW  E G G+E +F    PS  +T ID +N +W+ F+     L +    +VFP  TDS YVR+ GI A+GFSPINNTP LLH+H+E L  DT++ GI  Y KLI
Sbjct:   10 NDEEIIIFQEYLRIPSVHPDVDYTACVEFLKRQANKLNLRVDVVYPVVPSKPVVIMKWLGKHPELKSIILNSHMDVVPVFPEKWTHEPFGAHIDAQGRIYARGAQDMKSVGCQYMAAVRALKASG--YQPKRTVYLTFVPDEETGGHMGMAEFVKGDYFKAMNVGFSLDEGIASEDDTYPVFYAERTLWQLRFKFSGTSGHGSLLHKSTAGEKFHFVMDKLMKFRETQVKLLAEDSSLQSGDVTTLNLTQLNGGVQSNVVPPVLEATFDIRIAINQNADAMENQIREWCNEVGGGVELDFTLKCPSV-VTKIDDSNPYWLGFKKGLDELGLITHTRVFPGATDSFYVRQVGIPALGFSPINNTPVLLHNHDEYLRADTYLHGIQVYRKLI 396          
BLAST of Aminoacylase-1 vs. Ensembl Fly
Match: CG17110 (gene:FBgn0039050 transcript:FBtr0337026)

HSP 1 Score: 371.318 bits (952), Expect = 2.727e-126
Identity = 182/390 (46.67%), Postives = 251/390 (64.36%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVL-EFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            N++ +  F EYL+  +VHP+ DY+  VEFL  Q+ +L L + V+    P  P+VIMKW G++ +LKS + NSH+DVVPVFP++W + PF AHID    IYARG+QDMK  G QY+ A+R +K +   + P+R +Y+ FVPDEE GG  GM +FV+   F  MN+G  +DEGI S  + YPVFY +R L  ++   SG++GHGS   K+TAG K   +++K M FRE +   + E+ +L  GDVTT+NLT + GGVQ NV+P      FDIRI+   N +  +  + EW  E G G+E +F    PS  +T ID +N +W+ F+     L +    +VFP  TDS YVR+ GI A+GFSPINNTP LLH+H+E L  DT++ GI  Y KLI
Sbjct:   10 NDEEIIIFQEYLRIPSVHPDVDYTACVEFLKRQANKLNLRVDVVYPVVPSKPVVIMKWLGKHPELKSIILNSHMDVVPVFPEKWTHEPFGAHIDAQGRIYARGAQDMKSVGCQYMAAVRALKASG--YQPKRTVYLTFVPDEETGGHMGMAEFVKGDYFKAMNVGFSLDEGIASEDDTYPVFYAERTLWQLRFKFSGTSGHGSLLHKSTAGEKFHFVMDKLMKFRETQVKLLAEDSSLQSGDVTTLNLTQLNGGVQSNVVPPVLEATFDIRIAINQNADAMENQIREWCNEVGGGVELDFTLKCPSV-VTKIDDSNPYWLGFKKGLDELGLITHTRVFPGATDSFYVRQVGIPALGFSPINNTPVLLHNHDEYLRADTYLHGIQVYRKLI 396          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 403.675 bits (1036), Expect = 1.509e-138
Identity = 189/391 (48.34%), Postives = 260/391 (66.50%), Query Frame = 2
Query:   29 SLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            S  + +V  F EYL+ +TVHP PDY  A++FL   + +L L +  +E CP   + I+ W G   +LKS V NSH DVVPV+ + WK+ PF+A  D + +IYARG+QDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGMK FV+  +F ++NIG  +DEG+ +  N Y VFYG+R L WI V   GS GHGS+F++NTA  KL+ ++N F++FRE+E  R+      TLGDVTT+N+T V GGV +NV+P+   + FD+RI P +N+ EF+  +  W RE G+ + Y+F Q +    LT  D ++ WW  F S CK++NM +  ++FPA TDS ++RE G+ A GFSP+N TP LLHDHNE LN   F++GI  YE+LI
Sbjct:   19 SAEDPSVTLFREYLRLKTVHPEPDYDAALKFLERMADELALPMQKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGNRF--SRTIHLTFVPDEEVGGEKGMKAFVKHPEFQKLNIGFALDEGLANPTNAYTVFYGERNLWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKENQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEQIKVWCREAGEDVTYDFAQKNTDQNLTSTDESDPWWQAFSSTCKAMNMTLKKEIFPAATDSSFIREVGLPAFGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLI 407          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 400.208 bits (1027), Expect = 3.550e-137
Identity = 187/386 (48.45%), Postives = 258/386 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            +V  F EYL+ +TVHP PDY  A++FL   + +L L +  +E CP   + I+ W G   +LKS V NSH DVVPV+ + WK+ PF+A  D + +IYARG+QDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F ++N+G  +DEG+ +  N Y VFYG+R   WI V   GS GHGS+F++NTA  KL+ ++N F++FRE+E+ R+      TLGDVTT+N+T V GGV +NV+P+   + FD+RI P +N+ EF+  +  W RE G+ + Y+F Q      LT  D  + WW  F S CK++NM +  ++FPA TDSR++RE G+ AIGFSP+N TP LLHDHNE LN   F++GI  YE+LI
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLI 407          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 400.208 bits (1027), Expect = 3.550e-137
Identity = 187/386 (48.45%), Postives = 258/386 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            +V  F EYL+ +TVHP PDY  A++FL   + +L L +  +E CP   + I+ W G   +LKS V NSH DVVPV+ + WK+ PF+A  D + +IYARG+QDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F ++N+G  +DEG+ +  N Y VFYG+R   WI V   GS GHGS+F++NTA  KL+ ++N F++FRE+E+ R+      TLGDVTT+N+T V GGV +NV+P+   + FD+RI P +N+ EF+  +  W RE G+ + Y+F Q      LT  D  + WW  F S CK++NM +  ++FPA TDSR++RE G+ AIGFSP+N TP LLHDHNE LN   F++GI  YE+LI
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLI 407          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 400.208 bits (1027), Expect = 3.550e-137
Identity = 187/386 (48.45%), Postives = 258/386 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            +V  F EYL+ +TVHP PDY  A++FL   + +L L +  +E CP   + I+ W G   +LKS V NSH DVVPV+ + WK+ PF+A  D + +IYARG+QDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F ++N+G  +DEG+ +  N Y VFYG+R   WI V   GS GHGS+F++NTA  KL+ ++N F++FRE+E+ R+      TLGDVTT+N+T V GGV +NV+P+   + FD+RI P +N+ EF+  +  W RE G+ + Y+F Q      LT  D  + WW  F S CK++NM +  ++FPA TDSR++RE G+ AIGFSP+N TP LLHDHNE LN   F++GI  YE+LI
Sbjct:   24 SVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGERNPWWITVRCPGSPGHGSRFVENTAAEKLRRVINSFLEFREKEKQRLNTSECFTLGDVTTINMTMVKGGVAYNVVPAEMDVSFDLRIPPTVNLQEFEEKIKVWCREAGEDVTYDFAQKHMDQNLTSTDENDPWWQAFSSTCKAMNMTLKKEIFPAATDSRFIREVGLPAIGFSPMNLTPILLHDHNEYLNEQVFLQGIQVYERLI 407          
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 186.037 bits (471), Expect = 1.229e-56
Identity = 87/183 (47.54%), Postives = 121/183 (66.12%), Query Frame = 2
Query:   38 NQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGD 586
            + +V  F EYL+ +TVHP PDY  A++FL   + +L L +  +E CP   + I+ W G   +LKS V NSH DVVPV+ + WK+ PF+A  D + +IYARG+QDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F ++N+G  +DEG+ +  N Y VFYG+
Sbjct:   22 DPSVTLFREYLRLKTVHPEPDYDAALKFLERMAEELALPMKKVEVCPGRVVAIISWIGSRPELKSVVLNSHTDVVPVYEEHWKHHPFAAVKDADGNIYARGAQDMKSVTIQYIEAIRRLKAAGKRF--SRTIHLTFVPDEEVGGHKGMETFVKHPEFQKLNMGFALDEGLANPTNAYTVFYGE 202          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: ENSXETT00000004778.1 (aminoacylase-1-like [Source:NCBI gene;Acc:101735201])

HSP 1 Score: 378.252 bits (970), Expect = 1.106e-128
Identity = 180/392 (45.92%), Postives = 249/392 (63.52%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            A   F EYLK +TV P+PDY  A+ FLT  +  +GLE   +E      I+++ W G     +S + NSH+DVVPVF + W YPPFSAH D   +IY RG+QDMKC   QYLEA+RR+K     F   R I++  VPDEE+GG  GM+ FV+  +F  +N GI +DEG+ +   +  VFYG+R  C + VH  G TGHGS+ I++TA  K   +++  +DFRE+E  R++ + NLTLGDVT+VNLT V+GGV HN++PS    +FD RI   ++  EF+  +  W R  G+ +  EF   +    +T  + +N WW  F +  K + +K+ P++FPAGTDSR+VRE G  A+GFSP+NNTP LLHDHNE LN   F+RGI  Y  +I   +S+
Sbjct:   11 ATSLFREYLKIQTVQPDPDYDGAMNFLTRVAEDIGLESKKIELSSGRVILVLTWRGTEPQFRSVILNSHMDVVPVFEESWMYPPFSAHKDKAGNIYGRGAQDMKCVSIQYLEAVRRLKSMGRCF--PRTIHLTLVPDEEMGGKTGMELFVKHPEFQALNPGIALDEGLANPSEESSVFYGER--CCVTVHCRGDTGHGSRLIEDTAAAKFYSVISSVLDFREKERNRLLSDPNLTLGDVTSVNLTRVSGGVAHNIVPSEMKANFDFRIPYTVDFKEFEHQLESWCRAAGENVTLEFYTKTMIQKVTSTNDSNPWWKAFSTPLKEMGLKLKPEIFPAGTDSRFVREAGFPALGFSPMNNTPILLHDHNEYLNEYIFLRGIHIYTHIISSLASV 398          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: acy1.1 (aminoacylase 1, gene 1 [Source:NCBI gene;Acc:496883])

HSP 1 Score: 240.35 bits (612), Expect = 3.713e-75
Identity = 106/226 (46.90%), Postives = 153/226 (67.70%), Query Frame = 2
Query:  542 GITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            G+ +   ++ VFYG++   WI VH  G  GHGS+FI+NTA  KL  ++++F++FRE+E+ R++ +  LTLGDVTTVN+T V+GGV  NV+PS  T  FD+RI P +N+ EF+  +  W R  GD + +E+ Q   +  +T  D +N WW  F + CK + +K+ P++FPA TDSR++R  G  A+GFSP+NNTP LLHDHNE LN   F+RGI  Y K+I   +S+
Sbjct:  150 GLANPSEEFSVFYGEKCPWWITVHCGGDPGHGSRFIENTAAAKLHSVISRFLEFREKEKKRLLTDPKLTLGDVTTVNMTQVSGGVSFNVVPSEMTATFDLRIPPTVNLKEFERQLEGWCRAAGDNVTWEYHQKCMNERVTTPDDSNPWWKAFSAPCKEMRLKLKPEIFPAATDSRFIRAAGYSALGFSPMNNTPILLHDHNEYLNESIFLRGIQIYTKIIASLASV 375          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: dock3 (dedicator of cytokinesis 3 [Source:Xenbase;Acc:XB-GENE-855883])

HSP 1 Score: 173.326 bits (438), Expect = 1.316e-51
Identity = 87/184 (47.28%), Postives = 117/184 (63.59%), Query Frame = 2
Query:   56 FCEYLKCETVHPNPDYSK--AVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCW 601
            F EYLK +TV P+PDY    A+ FLT  +  +GLE   +E   +  I+++ W G    L+S + NSH+DVVPVF + W YPPFSAH D   +IY RG+QDMKC   QYLEA+RR+K     F   R I++  VPDEE+GG  GM+ FV+   F  +N GI +DEG+ +   ++ VFYG+R  CW
Sbjct:   10 FREYLKIQTVQPDPDYGNNGAMNFLTRVAEDIGLESKKIEVLGRV-ILVLTWRGTEPQLRSVILNSHMDVVPVFEESWMYPPFSAHKDKAGNIYGRGAQDMKCVSIQYLEAVRRLKSMGRCF--PRTIHLTLVPDEEMGGKTGMELFVKHPAFQALNPGIALDEGLANPSEEFSVFYGERC-CW 189          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: ENSXETT00000004860.1 (aminoacylase 1 [Source:NCBI gene;Acc:108647469])

HSP 1 Score: 173.326 bits (438), Expect = 1.868e-51
Identity = 84/173 (48.55%), Postives = 111/173 (64.16%), Query Frame = 2
Query:   26 ESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEG 544
            E L++ A   F EYL   TV P+PDY K ++FL   + ++GLE   LE  P   I+I+ W G    L S + NSH DVVPVF + W Y PFSA+ D + +IYARG+QDMKC   QYLEA+RR+K     F   R I++  VPDEE+GG KGM+ FV+  +F+ +N GI +DEG
Sbjct:    7 EELSDPATSLFREYLMIRTVQPDPDYDKGIQFLVRMAEEIGLESKKLELYPGRVILILTWKGTEPQLGSVILNSHTDVVPVFEEFWTYSPFSAYKDKDGNIYARGAQDMKCVTIQYLEAVRRLKSEGRRF--PRTIHLTLVPDEEIGGHKGMELFVQHPEFHALNPGITLDEG 177          
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Match: b3gat1 (beta-1,3-glucuronyltransferase 1 [Source:Xenbase;Acc:XB-GENE-961613])

HSP 1 Score: 76.2554 bits (186), Expect = 1.692e-14
Identity = 80/343 (23.32%), Postives = 140/343 (40.82%), Query Frame = 2
Query:  194 IMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITS-----TGNDYPVFY---GDRVLCWIKVHISGSTGHGSQ---------FIKNTAGVKLKLILNKFMDFREQE------------------EARMIENNLTLGDV--TTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLN-MKIIPQVFPAGTDSRYVREKGIHAIGFSPI 1108
            + K  G + +L   +  +HIDVVP  P+ W+ PPFS    D   IY RG+ D K C    L+++  +        P R+ YI    DEE+ G KG +K VE  Q   + +  V+DEG+        G   PV      ++    + + ++   GH S               + ++  ++ N F +  EQ+                  + R++E + +   +  TT  LT    G++ NVIP   T   + R+ P   + E   ++    ++  + +E   +       ++P D +  + +   +I    +   + P V    TDSR+          FSP+
Sbjct:   49 LFKVQGSDHNLLPYMLLAHIDVVPAPPESWEVPPFSGEERDGY-IYGRGTLDDKNCVIGILQSLEFLLKRGHK--PRRSFYIGLGHDEEISGHKGAQKIVEKLQSQGVKLAFVLDEGLAVLDGVIQGISQPVALVGTTEKGSVTLDLTVNRLPGHSSMPPSETSIGILAAAVSRLEQNMMPNMFGNGPEQDMFEHLSTKTFNISKPIVFKPRILELSPSTNAIVRTTTALTIFKAGIKSNVIPPTATATVNFRLHPAQTVQEVLDIVQNTIKD--ERVELSVLNSFDPLPVSPNDMSLGYHILQRTIHDVFSGPPVAPGVCVGNTDSRHFVNLTNSIYRFSPV 386          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 371.703 bits (953), Expect = 3.050e-126
Identity = 173/392 (44.13%), Postives = 248/392 (63.27%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARGSQDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G V+DEG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL  +++  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D ++ WW  F   CK++N+ + P++FPA TDSR++R  GI A+GFSP+N TP LLHDHNE L+ D F+RG+D Y  L+   +S+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 401          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 322.783 bits (826), Expect = 1.412e-107
Identity = 157/392 (40.05%), Postives = 229/392 (58.42%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E                                   + W + PF A  D    IYARGSQDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G V+DEG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL  +++  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D ++ WW  F   CK++N+ + P++FPA TDSR++R  GI A+GFSP+N TP LLHDHNE L+ D F+RG+D Y  L+   +S+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIE-----------------------------------EHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 366          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 218.394 bits (555), Expect = 2.026e-67
Identity = 94/227 (41.41%), Postives = 148/227 (65.20%), Query Frame = 2
Query:  539 EGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            EG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL  +++  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D ++ WW  F   CK++N+ + P++FPA TDSR++R  GI A+GFSP+N TP LLHDHNE L+ D F+RG+D Y  L+   +S+
Sbjct:  103 EGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 329          

HSP 2 Score: 82.8037 bits (203), Expect = 4.370e-17
Identity = 40/90 (44.44%), Postives = 52/90 (57.78%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHID 313
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKD 101          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 196.052 bits (497), Expect = 2.556e-60
Identity = 97/210 (46.19%), Postives = 129/210 (61.43%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKL 673
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARGSQDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G V+DEG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKL 219          
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Match: Acy1 (aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913])

HSP 1 Score: 196.438 bits (498), Expect = 7.426e-59
Identity = 97/212 (45.75%), Postives = 129/212 (60.85%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKL 679
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARGSQDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G V+DEG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL  
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFVLDEGLANPTDAFTVFYSERSPWWVQVTSTGKPGHASRFIEDTAAEKLAF 221          

HSP 2 Score: 130.183 bits (326), Expect = 8.693e-34
Identity = 52/116 (44.83%), Postives = 77/116 (66.38%), Query Frame = 2
Query:  869 FKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            F+  +  W +E G+G+ +EF Q      +TP D ++ WW  F   CK++N+ + P++FPA TDSR++R  GI A+GFSP+N TP LLHDHNE L+ D F+RG+D Y  L+   +S+
Sbjct:  221 FEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRFIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 336          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q6AYS7|ACY1A_RAT (Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=Acy1a PE=1 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 5.131e-126
Identity = 175/392 (44.64%), Postives = 246/392 (62.76%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV PNPDY  AV FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G  +DEG+ +  + + VFY +R   WI+V  +G  GH S+FI++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D T+ WW  F   CK +N+ + P++FPA TDSRY+R  GI A+GFSP+N TP LLHDHNE L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGSAVTFLEERARQLGLSCQKIEVAPGYVITVLTWPGTNPLLHSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGAQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWIRVTSTGKPGHASRFIEDTAAEKLHKVVNSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSACFDFRVAPDVDMKAFEKQLQSWCQEAGEGVTFEFAQKFTEPRMTPTDDTDPWWAAFSGACKEMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEAVFLRGVDIYTRLVAALASV 401          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q99JW2|ACY1_MOUSE (Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE=1 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 9.855e-126
Identity = 173/392 (44.13%), Postives = 247/392 (63.01%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV PNPDY  A+ FL  ++ QLGL    +E  P   I ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARGSQDMK    QYLEA+RR+K     F   R I++ FVPDEEVGG KGM+ FV+  +F  +  G  +DEG+ +  + + VFY +R   W++V  +G  GH S+FI++TA  KL  +++  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D ++ WW  F   CK++N+ + P++FPA TDSRY+R  GI A+GFSP+N TP LLHDHNE L+ D F+RG+D Y  L+   +S+
Sbjct:   12 SVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRF--PRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASV 401          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q6PTT0|ACY1B_RAT (Aminoacylase-1B OS=Rattus norvegicus OX=10116 GN=Acy1b PE=1 SV=1)

HSP 1 Score: 369.007 bits (946), Expect = 2.933e-124
Identity = 167/392 (42.60%), Postives = 244/392 (62.24%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY  AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IY RG+QDMKC   QYLEA++R+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEG+ +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NV+P+  +  FD R++P +++  F+  +  W +E G+G+ +EF Q      +TP D T+ WW  F   CK + + + P++FPA TDSRY+R  GI A+GFSP+N TP LLHDHNE L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYTRGAQDMKCVSIQYLEAVKRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRHEFHALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVVPATMSACFDFRVAPDVDMKAFEEQLQSWCQEAGEGVTFEFAQKFTEPRMTPTDDTDPWWAAFSGACKEMTLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEAVFLRGVDIYTRLVAALASV 401          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q03154|ACY1_HUMAN (Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=1 SV=1)

HSP 1 Score: 365.155 bits (936), Expect = 1.027e-122
Identity = 167/392 (42.60%), Postives = 243/392 (61.99%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY  AV F    + QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  ++N  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK +N+ + P++ PA TD+RY+R  G+ A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEETARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCVSIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMNLTLEPEIMPAATDNRYIRAVGVPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Match: sp|Q5RFB0|ACY1_PONAB (Aminoacylase-1 OS=Pongo abelii OX=9601 GN=ACY1 PE=2 SV=2)

HSP 1 Score: 362.459 bits (929), Expect = 1.185e-121
Identity = 166/392 (42.35%), Postives = 243/392 (61.99%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIEN-NLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F +YL+  TV P PDY  AV F   ++ QLGL    +E  P   + ++ W G N  L S + NSH DVVPVF + W + PF A  D    IYARG+QDMKC   QYLEA+RR+K+    F   R I++ FVPDEEVGG +GM+ FV+  +F+ +  G  +DEGI +  + + VFY +R   W++V  +G  GH S+F+++TA  KL  +++  + FRE+E  R+  N +L  G VT+VNLT + GGV +NVIP+  +  FD R++P ++   F+  +  W +  G+G+  EF Q      +TP D +N WW  F  +CK + + + P++ PA TD+RY+R  GI A+GFSP+N TP LLHDH+E L+   F+RG+D Y +L+   +S+
Sbjct:   12 SVTLFRQYLRIRTVQPKPDYGAAVAFFEERARQLGLGCQKVEVAPGYVVTVLTWPGTNPTLSSILLNSHTDVVPVFKEHWSHDPFEAFKDSEGYIYARGAQDMKCISIQYLEAVRRLKVEGHRF--PRTIHMTFVPDEEVGGHQGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVSSILAFREKEWQRLQSNPHLKEGSVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCKDMKLTLEPEIMPAATDNRYIRAVGIPALGFSPMNRTPVLLHDHDERLHEAVFLRGVDIYTRLLPALASV 401          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: R7TAZ0 (M20_dimer domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_184037 PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 1.488e-148
Identity = 205/399 (51.38%), Postives = 275/399 (68.92%), Query Frame = 2
Query:   23 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMI-ENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            M +  NQA  NF EYL+  T+ PNPDY+ A +FLT  + +LGL   V E  P  PI I+ W G +  L S + NSHIDVVPVFP+ WKY PFSA  D N DIYARGSQDMKC G QY+EAIRRIK +   F   R I++ FVPDEE+GG  GM+KF+    F ++N+G  +DEG+ +   ++ VFYG+R   WI+V   G+ GHGS+F++N AG K++ I++ FMD+RE ++A+M  +  + LGDVTTVN T V GGVQ NVIPS     FD+R++P  N+ EF+AM+N+W +E G+G+  +F+Q + +  LT I S + WW  F  +C  LN+ I P++FPA TDSRY+R +GI AIGFSP+N TP LLHDHNE LN   F+RGI+ YE++I   +S+
Sbjct:    5 MTATENQATANFREYLRVNTMQPNPDYAGAADFLTRMANELGLPYQVHECVPGKPIFIITWEGTDPSLPSLLLNSHIDVVPVFPEFWKYEPFSAEKDSNGDIYARGSQDMKCVGIQYIEAIRRIKASGHSF--PRTIHMSFVPDEEIGGHDGMEKFILHAAFKKLNVGFALDEGLANPTENFTVFYGERSPWWIEVTCPGAPGHGSRFVENDAGTKMRKIIDSFMDYRENQKAKMEGDPKVKLGDVTTVNFTMVEGGVQMNVIPSELKAKFDVRVTPHQNLEEFEAMLNKWCQEAGEGVAIKFLQKNTNQALTSISSEDPWWKAFSGVCDKLNLSIEPEIFPAATDSRYLRAEGIPAIGFSPMNKTPILLHDHNEYLNEGVFLRGIEIYEQIIPTMASV 401          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A194PTR5 (Aminoacylase-1 OS=Papilio xuthus OX=66420 GN=RR46_04931 PE=4 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 1.154e-140
Identity = 194/390 (49.74%), Postives = 274/390 (70.26%), Query Frame = 2
Query:   35 NNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIE--NNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            NN AV NF EYL+  +V PN DY + V+FL  Q+ ++GL+  V E  P+ PIV++ W G+   L + + NSH+DVVPVF + W YPPFS HID++  I+ARGSQDMKC G QYLEAIR+IK        +R ++I FVPDEE+GG  GM+KFV + +F  +NIG  +DEG+ +  +++ +F G+R +  + +H +G  GHGS  I NTAG KL+ I++KFMD RE E+ +++E  N LT+GDVTT+NLT ++GGVQ NV+P   T+ FD+R++  ++  EF+  + +W +E GDG+ +EF Q +P+   T +D +N +W+ F+ +C  L +K+  ++FP GTDSRYVR  GI AIGFSP+NNTP LLHDHNE L  D ++RGI+ YEKLI
Sbjct:    7 NNPAVANFVEYLRIPSVQPNIDYDECVKFLKRQANEIGLDFKVYEVVPQKPIVVLTWKGKEPTLPAILLNSHMDVVPVFENSWTYPPFSGHIDEDGKIFARGSQDMKCVGIQYLEAIRKIKQAGLQL--KRTLHISFVPDEEIGGHDGMEKFVLTNEFKALNIGFALDEGMANPTDEFIIFNGERSIWQMHIHCTGQPGHGSLLIPNTAGEKLRYIIDKFMDMRE-EQKKILESDNKLTIGDVTTINLTQISGGVQSNVVPEKLTVVFDVRLAVTVDHEEFENKVTQWCKEAGDGVMFEFEQKNPNVECTKLDKSNPYWVAFKGVCDELELKLDCRIFPGGTDSRYVRRVGIPAIGFSPMNNTPVLLHDHNEFLRADIYLRGIEIYEKLI 393          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A3P9IKF2 (Aminoacylase 1 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 1.676e-140
Identity = 195/392 (49.74%), Postives = 262/392 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F EYL+ +TVHP PDY  AV FL+  +++L L L  +E CP   + IM W G    LKS + NSH DVVPV+ + WKY  F A  D   DIYARGSQDMKC   QY++A+R++K     + P R ++++FVPDEEVGG KGM+ FV   +F ++NIG  +DEG+ + G  + VFYG+R   WI +H  GS GHGS+F++NTA  KL+ ++N F+DFRE+E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ EF+  + EW  E G  I YEF Q   +  +T  D T+ WW  F + CKSLNM +  ++FPA TDSR++R  GI AIGFSP+N TP LLHDHNE LN + F++GI  YE+LI   +S+
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIEVCPGRVVSIMTWEGTEPQLKSVLLNSHTDVVPVYQEHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPWWITIHCPGSPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQEFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 412          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A3P9LQP8 (Aminoacylase 1 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 6.130e-140
Identity = 194/392 (49.49%), Postives = 262/392 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F EYL+ +TVHP PDY  AV FL+  +++L L L  +E CP   + IM W G    LKS + NSH DVVPV+ + WKY  F A  D   DIYARGSQDMKC   QY++A+R++K     + P R ++++FVPDEEVGG KGM+ FV   +F ++NIG  +DEG+ + G  + VFYG+R   WI +H  G+ GHGS+F++NTA  KL+ ++N F+DFRE+E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ EF+  + EW  E G  I YEF Q   +  +T  D T+ WW  F + CKSLNM +  ++FPA TDSR++R  GI AIGFSP+N TP LLHDHNE LN + F++GI  YE+LI   +S+
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIEVCPGRVVSIMTWEGTEPQLKSVLLNSHTDVVPVYQEHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPWWITIHCPGNPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQEFERQIQEWCAEAGQDITYEFAQKHMNQNVTSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGISVYERLIPALTSV 412          
BLAST of Aminoacylase-1 vs. TrEMBL
Match: A0A3B3IG88 (Aminoacylase 1 OS=Oryzias latipes OX=8090 GN=acy1 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 6.910e-140
Identity = 194/392 (49.49%), Postives = 262/392 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F EYL+ +TVHP PDY  AV FL+  +++L L L  +E CP   + IM W G    LKS + NSH DVVPV+ + WKY  F A  D   DIYARGSQDMKC   QY++A+R++K     + P R ++++FVPDEEVGG KGM+ FV   +F ++NIG  +DEG+ + G  + VFYG+R   WI +H  GS GHGS+F++NTA  KL+ ++N F+DFRE+E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ +F+  + EW  E G  I YEF Q   +  +T  D T+ WW  F + CKSLNM +  ++FPA TDSR++R  GI AIGFSP+N TP LLHDHNE LN + F++GI  YE+LI   +S+
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIEVCPGRVVSIMTWEGTEPQLKSVLLNSHTDVVPVYQEHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPWWITIHCPGSPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 412          
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:103031539])

HSP 1 Score: 397.897 bits (1021), Expect = 1.933e-136
Identity = 189/392 (48.21%), Postives = 257/392 (65.56%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            AV  F EYL+ +TVHP PDY  A++FLT  S +LGL +  +E CP   + I+ W+G N  +KS + NSH DVVPV+ + WKY  F+A  D   +IY RGSQDMK    QY+EAIRR+K     F   R I++ FVPDEEVGG KGM+ F+   +F ++N+G  +DEG+ +    + VFYG+R   WI +   GS GHGS+F++NTA  KL+ I+N F+DFR  E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ EF+  +  W  E G+GI Y+F Q       T  + ++ WW  F S CK++NM +  ++FPA TDSR++R  G+ AIGFSP+N TP LLHDHNE LN   F+RGI  YE+L+L  +S+
Sbjct:   22 AVSLFREYLQLKTVHPEPDYDAALKFLTRISEELGLPMKKIEVCPGRVVTIITWTGTNPAVKSVLLNSHTDVVPVYQEHWKYDAFAAVKDAEGNIYGRGSQDMKSVTIQYIEAIRRLKAAGKRF--PRTIHLSFVPDEEVGGHKGMETFINHPEFQKLNVGFALDEGLANPTEAFTVFYGERNPWWITIRCPGSPGHGSRFVENTAAEKLRRIINSFLDFRASEKQRLDTSECFTLGDVTTVNMTMVNGGVAYNVIPAEMDVSFDMRIPPTVNLQEFEEQIKAWCAEAGEGITYKFAQKFMHQNTTSTEDSDPWWNAFSSTCKAMNMTLQKEIFPAATDSRFIRAAGLPAIGFSPMNCTPILLHDHNEFLNEGVFLRGITVYERLLLTLASV 411          
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Match: pm20d1.2 (peptidase M20 domain containing 1 [Source:NCBI gene;Acc:103024030])

HSP 1 Score: 60.077 bits (144), Expect = 2.193e-9
Identity = 89/387 (23.00%), Postives = 151/387 (39.02%), Query Frame = 2
Query:  209 GRNKDLKSAVFNSHIDVVPV-FPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITST-----GNDYP---VFYGDRVLCWIKVHISGSTGHGS------------------------------------QFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDV--TTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQ-HSPSAYLTPIDSTNKWWMKFESICKSL-----NMKIIPQVFPAGTDSRYVRE--KGIHAIG---FSPINNTPFLLHDHNECLNVDTFIRGIDFYEKL 1195
            G    L   +  +HIDVVP    D W+ PPFSA  + N  IY RG+ D K      L+A+  +      ++P R  YI    DEEV G  G    V+  +   + +  V+DEG+        G D P   +   ++    +K+ +S   GH S                                    + + +   + L+ I++    F     +R++E   T      TT  +T    GV+ NV+PS      ++RI     + E   ++     +  + ++ E +    P     PI S ++    F+ I K++      + + P +    TDSR+  +  K I+      F P +   F  H  NE ++   +   + FY +L
Sbjct:  129 GTEPKLLPYMLLAHIDVVPANEADGWEAPPFSAK-EMNGFIYGRGTIDNKQSVMGILQALEYLL--QRGYVPRRGFYIGLGHDEEVSGYSGAVNIVKVLKSRGVKLHYVLDEGLAVLDGVIDGLDGPAALIGISEKGSATVKLSVSTKPGHSSMPSRESSIGILAAAVTRLEENPMPRLFGYGPERGTFEHLAHKFALPLRFIMSNLWLFTPL-MSRVMERTPTTNAFVRTTTAVTMFNSGVKVNVLPSHAEAFVNLRIHSAQTLQEVLELIESTVSD--ERVKIELVNGFDP----LPISSFDEQSFGFQIIKKTVLDMFPQLTVAPGICVGNTDSRHYTDLTKDIYRFAPSWFKPGDAQRF--HGINERISCKNYEELVLFYFRL 503          
BLAST of Aminoacylase-1 vs. Ensembl Sea Lamprey
Match: acy1 (aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-755])

HSP 1 Score: 318.546 bits (815), Expect = 6.178e-107
Identity = 150/324 (46.30%), Postives = 204/324 (62.96%), Query Frame = 2
Query:   47 VENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSL 1015
            V  F EYL+  TVHP PDY  A+ FL   +I L L L   E  P    V++ W G N  L+S + NSH DVVP F + W+Y PF A  D   +IY RG+QDMK  G QY+EAIRR++     F   R +++LFVPDEEVGG +GM  FV+S +F  +N+G V+DEG+ +  + Y VFYG+R   W+ V  +G  GHGS+FI NTA  KL+ I+N F+ FRE+E+AR+     +TLGDVTTVNLT V GGVQ+NV+P+     FDIR+ P +++  F+  +  W RE GDG+ YEF Q      +T    ++ WW  F ++C+ +
Sbjct:   34 VTLFREYLRIRTVHPKPDYDSAIAFLERVAIDLDLPLKKYELEPSLIAVVITWEGSNPALRSVLLNSHTDVVPAFQEHWQYDPFEAVKDAEGNIYGRGAQDMKSVGIQYVEAIRRLRDEGKRF--PRTLHLLFVPDEEVGGFRGMSLFVKSPEFKALNVGFVLDEGLANPTDAYTVFYGERSCWWVTVKCTGHPGHGSRFITNTAAEKLQKIINAFLGFREKEKARLDCSACMTLGDVTTVNLTMVHGGVQYNVVPAELAASFDIRVPPAVDLQAFEQQLESWCREAGDGVTYEFAQKGMDQSVTSTSESDPWWGAFSAVCRDM 355          
BLAST of Aminoacylase-1 vs. Ensembl Sea Lamprey
Match: pm20d1.1 (peptidase M20 domain containing 1, tandem duplicate 1 [Source:NCBI gene;Acc:553216])

HSP 1 Score: 69.707 bits (169), Expect = 2.464e-13
Identity = 84/372 (22.58%), Postives = 147/372 (39.52%), Query Frame = 2
Query:  236 VFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYP--------VFYGDRVLCWIKVHISGSTGHGSQFIKNTA--------------------GVKLKLILNKFMDFREQEEARMIENNLTL-GDV----------------TTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPID-STNKWWMKFESICKSL-NMKIIPQVFPAGTDSRYVREKGIHAIGFSPINN----TPFLLHDHNECLNVDTFIRGIDFYEKLI 1198
            +  +H+DVVP     W  PPFS  I     IY RG+ D K   S          +    F+P+R  YI    DEE+GG KG +   +  +   + +  ++DEG+       P        V   ++    +++ +   TGH S   K +                     G   +  L +++  +     R++ +NL L G +                TT  +T    GV+ NV+        + RI P  +++E   +  E   +  D +E E +       ++P D S   +W   +SI  +  ++   P +  A TD+R+ ++       F+P+ N     P   H  NE +++  + + I FY  L+
Sbjct:   35 MLTAHLDVVPAPDYGWDVPPFSGEIHQGY-IYGRGTIDDKH--SLMAILEALELLLQRGFVPQRTFYIGIGHDEEIGGDKGARNIAKVLESRGVKLDFLLDEGMVILDGVVPGLQIPVAVVGVSEKGSLMLRLRVRTETGHSSMPAKESCIGILSAAITRLESNPLPQQFGSGPERALFEYLSPQFNFPMRVVTSNLWLFGPIFSWVLGQKPTTNALIRTTTAVTEFHAGVKPNVVAPLAEATVNYRIHPAQSVSEVLRLTEEIIAD--DRVELEVLSSMEPLPISPFDESATGYWTISKSITDTFPDIVSAPGLCIANTDTRHYQKLTNALYRFTPVWNKLEDIP-RYHGVNERISLQNYKQTIHFYFNLM 400          
BLAST of Aminoacylase-1 vs. Ensembl Yeast
Match: CPS1 (Vacuolar carboxypeptidase S; expression is induced under low-nitrogen conditions [Source:SGD;Acc:S000003708])

HSP 1 Score: 68.1662 bits (165), Expect = 6.501e-13
Identity = 51/161 (31.68%), Postives = 74/161 (45.96%), Query Frame = 2
Query:  191 VIMKWSGRNKDLKSAVFNSHIDVVPVFPD---QWKYPPFSAHID-DNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVE--SQQFNEMNIGIVMDEGITSTGNDYPVFY-----GDRVLCWIKVHISGSTGHGS 640
            ++  W G + DLK  +  +H DVVPV  +    WK+PPFS H D + D ++ RGS D K       EAI ++ I+   F P R I +    DEE  G  G         +++ +  I  ++DEG      D  VF       ++     +V I G  GH S
Sbjct:  149 LLYTWEGSDPDLKPLLLMAHQDVVPVNNETLSSWKFPPFSGHYDPETDFVWGRGSNDCKNLLIAEFEAIEQLLIDG--FKPNRTIVMSLGFDEEASGTLGAASLASFLHERYGDDGIYSIIDEGEGIMEVDKDVFVATPINAEKGYVDFEVSILGHGGHSS 307          
BLAST of Aminoacylase-1 vs. Ensembl Nematostella
Match: EDO34483 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP85])

HSP 1 Score: 89.7373 bits (221), Expect = 1.523e-19
Identity = 106/418 (25.36%), Postives = 183/418 (43.78%), Query Frame = 2
Query:   29 SLNNQAVENFCEYLKCETVHPNP-DYSKA-----VEFLTSQ-SIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRI-KINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYP----------VFYGDRVLCWIKVHISGSTGHGSQFIKNTA-GVKLKLILNKFMDFREQEEARMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWAREC-GDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLN-----MKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLL---HDHNECLNVDTFIRGIDFYEKLI 1198
            + ++ A+E F + L+  TV   P DY++       EF+  + S      L   E    N  ++++  G N  L+  +  SH+DVVP  P  W  PPF   + D   I+ RG+ D+K      LEA++ + K+      P+R+ Y+ +  DEEV G  G +      +   + +  ++DEG+    N +P          V     ++  + VH SG  GH S   K ++ G+  K I +   +        MI         TT  +T    GV+ NVI    T   + R+ P+  I E    + E  R+C GD   +  ++ + S   +P+ S +   + +++I +S+      + + P +  A TD+++          F+P    P  L   H  NE + V  + + I++Y  LI
Sbjct:   46 TADSSALERFSQALRYRTVAWGPGDYNRTELLKFKEFILREFSYVFHHPLVTFEVI-NNYSLLIQVHGSNSTLRPYMIASHLDVVPA-PGSWDVPPFDGRVKDGY-IWGRGTLDVKNGVMASLEAVQALLKLGQK---PKRSFYLAYGHDEEVQGADGARNIGMLLKARNIKLEFIVDEGMVIVKNVFPGLTTPYAIIGVAEKGYMMVELSVHTSG--GHASMPPKESSIGILSKAIASVLGETPSTNS--MIR--------TTTAVTMFKAGVKGNVIAPDATATVNHRVHPENTIGE----VVEHDRKCIGDNRVH--LRVTASQDPSPVSSWDSHAIGYQAIAQSVRQVFPGVGVAPGLMIANTDTKHYLHLTDAVYRFTPSLLEPSDLKRIHGVNERIGVKNYEQTINYYYHLI 439          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:101160548])

HSP 1 Score: 415.231 bits (1066), Expect = 2.601e-143
Identity = 194/392 (49.49%), Postives = 262/392 (66.84%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F EYL+ +TVHP PDY  AV FL+  +++L L L  +E CP   + IM W G    LKS + NSH DVVPV+ + WKY  F A  D   DIYARGSQDMKC   QY++A+R++K     + P R ++++FVPDEEVGG KGM+ FV   +F ++NIG  +DEG+ + G  + VFYG+R   WI +H  GS GHGS+F++NTA  KL+ ++N F+DFRE+E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ +F+  + EW  E G  I YEF Q   +  +T  D T+ WW  F + CKSLNM +  ++FPA TDSR++R  GI AIGFSP+N TP LLHDHNE LN + F++GI  YE+LI   +S+
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIEVCPGRVVSIMTWEGTEPQLKSVLLNSHTDVVPVYQEHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERNPWWITIHCPGSPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 412          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: acy1 (aminoacylase 1 [Source:NCBI gene;Acc:101160548])

HSP 1 Score: 347.436 bits (890), Expect = 4.487e-117
Identity = 173/392 (44.13%), Postives = 238/392 (60.71%), Query Frame = 2
Query:   44 AVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARM-IENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSM 1216
            +V  F EYL+ +TVHP PDY  AV FL+  +++L L L  +E                                   + WKY  F A  D   DIYARGSQDMKC   QY++A+R++K     + P R ++++FVPDEEVGG KGM+ FV   +F ++NIG  +DEG+ + G  + VFYG+R   W +       GHGS+F++NTA  KL+ ++N F+DFRE+E+ R+      TLGDVTTVN+T V GGV +NVIP+   + FD+RI P +N+ +F+  + EW  E G  I YEF Q   +  +T  D T+ WW  F + CKSLNM +  ++FPA TDSR++R  GI AIGFSP+N TP LLHDHNE LN + F++GI  YE+LI   +S+
Sbjct:   23 SVTLFREYLRLKTVHPEPDYDAAVRFLSRIAVELELPLKKIE-----------------------------------EHWKYDAFKAFKDAKGDIYARGSQDMKCVTIQYIQAVRKLKAQG--WKPARTVHLMFVPDEEVGGHKGMETFVTQPEFQKLNIGFALDEGLANPGEAFTVFYGERN-PWCECRTQTIPGHGSRFVENTAAEKLRQVINSFLDFREKEKQRLNTSECFTLGDVTTVNMTMVKGGVAYNVIPAEMDVSFDLRIPPTVNLQDFERQIQEWCAEAGQDITYEFAQKHMNQNITSTDDTDPWWSAFSAACKSLNMTLEKEIFPAATDSRFIRAVGIPAIGFSPMNRTPILLHDHNEYLNEEVFLKGIGVYERLIPALTSV 376          
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Match: pm20d1.2 (peptidase M20 domain containing 1 [Source:NCBI gene;Acc:101164152])

HSP 1 Score: 73.1738 bits (178), Expect = 1.237e-13
Identity = 94/387 (24.29%), Postives = 151/387 (39.02%), Query Frame = 2
Query:  209 GRNKDLKSAVFNSHIDVVPV-FPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCW--------IKVHISGSTGHGS------------------------------------QFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDV--TTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGD-GIEYEFIQ-HSPSAYLTPIDSTNKWWMKFESICKSL-----NMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPF---LLHDHNECLNVDTFIRGIDFYEKLI 1198
            G + DL   +  +HIDVVP    D W+ PPFSA  + N  IY RG+ D K      L+A+  + +    + P R  YI F  DEE+ G  G    V   +   + +  V+DEG+           G   L          +K+ +S + GH S                                    + + +   + LK +++ F  F     +R++E    +     TT  +T   GGV+ NVIPS      ++RI     + E   +M+      GD  ++ E +    P     P+ S ++    F+ I K++      + + P +    TDSR+ ++       FSP    P      H  NE ++   +   I FY  LI
Sbjct:  161 GSHPDLVPYMLLAHIDVVPANESDGWEAPPFSAK-EINGFIYGRGTIDDKNSLMAILQALEYLLLKG--YAPRRGFYIGFGHDEEIRGFNGAMNIVRVLKQRNVQLSFVLDEGLAVMDGIISGLEGPAALIGLSEKGSANVKLSVSTAPGHSSIPPRESSIGILAGAVKRLEDNPMPRLFGLGPERTTFEHLAHKFSLPLKFVMSNFWLF-SSVLSRVLERKPDMNAFVRTTTAVTIFNGGVKMNVIPSYAEAYVNLRIHSAQTLQE---VMDLIEATVGDPRVKVELVDGFDP----LPVSSADERSFGFQIIKKTVLDLFPTVTVAPGICIGNTDSRHFKDLSKDVYRFSPNWFKPGDVQRFHGINERISKKNYEEMIQFYFNLI 536          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028073.1 (SMESG000028073.1)

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 396/401 (98.75%), Postives = 397/401 (99.00%), Query Frame = 2
Query:   23 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSMQVD 1225
            MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTV+EFC KNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDN DIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEE RMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLI EFSSMQVD
Sbjct:    1 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVIEFCQKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNGDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEETRMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLIFEFSSMQVD 401          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028073.1 (SMESG000028073.1)

HSP 1 Score: 716.072 bits (1847), Expect = 0.000e+0
Identity = 342/346 (98.84%), Postives = 343/346 (99.13%), Query Frame = 2
Query:   23 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEFCPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDS 1060
            MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTV+EFC KNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDN DIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEE RMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDS
Sbjct:    1 MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVIEFCQKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNGDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEETRMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDS 346          

HSP 2 Score: 63.5438 bits (153), Expect = 7.513e-11
Identity = 29/30 (96.67%), Postives = 30/30 (100.00%), Query Frame = 3
Query: 1059 AGMSEKKESMQLGFHQSIILHSFCMTTMNA 1148
            +GMSEKKESMQLGFHQSIILHSFCMTTMNA
Sbjct:  348 SGMSEKKESMQLGFHQSIILHSFCMTTMNA 377          
BLAST of Aminoacylase-1 vs. Planmine SMEST
Match: SMESG000028017.1 (SMESG000028017.1)

HSP 1 Score: 520.776 bits (1340), Expect = 0.000e+0
Identity = 241/343 (70.26%), Postives = 283/343 (82.51%), Query Frame = 2
Query:  197 MKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDNDDIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGGKGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISGSTGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDVTTVNLTGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEYEFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVREKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSMQVD 1225
            MKW+G +K LKS V NSH+DVVPVFPD+WKYPPFSA+ID+  +IYARG+QDMKC GSQYLEAIR+IK  SP ++PERNI +LFVPDEEVGG KGM+  VE+  F  MNIG+VMDEG+ +  N +  FYGDRV  WIKVHISG+TGHGSQFI N+AGVK+  IL KFM+ R  EE RM ENNLT+GDVTTVNLTG  GGVQHNV+PSPFTLDFDIRI+PK +++ FK M+N WA E G GIEYEFIQ++PSAYLT  D+TNKWW  FES+C+S NM+IIPQ+FPAGTDSR+VR KGI AIGFSPINNTP LLHDHNE LNVD F+ GI+FYE LIL  + ++ D
Sbjct:    1 MKWNGMDKSLKSIVLNSHMDVVPVFPDKWKYPPFSAYIDELGNIYARGAQDMKCVGSQYLEAIRKIKTKSPTYVPERNIIVLFVPDEEVGGKKGMELLVETDIFRLMNIGLVMDEGLANPTNSFSAFYGDRVAWWIKVHISGNTGHGSQFIDNSAGVKMHRILTKFMNLRLAEELRMKENNLTIGDVTTVNLTGTTGGVQHNVVPSPFTLDFDIRITPKTDLSNFKNMLNSWAEEVGGGIEYEFIQYAPSAYLTATDATNKWWETFESVCQSRNMEIIPQIFPAGTDSRFVRSKGISAIGFSPINNTPILLHDHNEFLNVDVFLCGIEFYEDLILALARVEED 343          
The following BLAST results are available for this feature:
BLAST of Aminoacylase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACY12.138e-12342.60aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ACY12.138e-12342.60aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
ABHD14A-ACY11.146e-12043.01ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:H... [more]
ABHD14A-ACY12.807e-11342.43ABHD14A-ACY1 readthrough [Source:HGNC Symbol;Acc:H... [more]
ACY11.754e-10940.05aminoacylase 1 [Source:HGNC Symbol;Acc:HGNC:177][more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C10C5.34.454e-10842.49Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17898][more]
C06A6.43.561e-10641.07Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
C06A6.43.561e-10641.07Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
C10C5.55.261e-10641.71Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q17900][more]
C06A6.44.320e-10339.66Aminoacylase [Source:UniProtKB/TrEMBL;Acc:Q5WRS4][more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG67264.570e-13046.92gene:FBgn0039049 transcript:FBtr0084349[more]
CG67264.570e-13046.92gene:FBgn0039049 transcript:FBtr0084348[more]
CG67264.570e-13046.92gene:FBgn0039049 transcript:FBtr0344300[more]
CG171102.727e-12646.67gene:FBgn0039050 transcript:FBtr0084350[more]
CG171102.727e-12646.67gene:FBgn0039050 transcript:FBtr0337026[more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acy11.509e-13848.34aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy13.550e-13748.45aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy13.550e-13748.45aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy13.550e-13748.45aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
acy11.229e-5647.54aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000004778.11.106e-12845.92aminoacylase-1-like [Source:NCBI gene;Acc:10173520... [more]
acy1.13.713e-7546.90aminoacylase 1, gene 1 [Source:NCBI gene;Acc:49688... [more]
dock31.316e-5147.28dedicator of cytokinesis 3 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000004860.11.868e-5148.55aminoacylase 1 [Source:NCBI gene;Acc:108647469][more]
b3gat11.692e-1423.32beta-1,3-glucuronyltransferase 1 [Source:Xenbase;A... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acy13.050e-12644.13aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy11.412e-10740.05aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy12.026e-6741.41aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy12.556e-6046.19aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
Acy17.426e-5945.75aminoacylase 1 [Source:MGI Symbol;Acc:MGI:87913][more]
back to top
BLAST of Aminoacylase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYS7|ACY1A_RAT5.131e-12644.64Aminoacylase-1A OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|Q99JW2|ACY1_MOUSE9.855e-12644.13Aminoacylase-1 OS=Mus musculus OX=10090 GN=Acy1 PE... [more]
sp|Q6PTT0|ACY1B_RAT2.933e-12442.60Aminoacylase-1B OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|Q03154|ACY1_HUMAN1.027e-12242.60Aminoacylase-1 OS=Homo sapiens OX=9606 GN=ACY1 PE=... [more]
sp|Q5RFB0|ACY1_PONAB1.185e-12142.35Aminoacylase-1 OS=Pongo abelii OX=9601 GN=ACY1 PE=... [more]
back to top
BLAST of Aminoacylase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7TAZ01.488e-14851.38M20_dimer domain-containing protein OS=Capitella t... [more]
A0A194PTR51.154e-14049.74Aminoacylase-1 OS=Papilio xuthus OX=66420 GN=RR46_... [more]
A0A3P9IKF21.676e-14049.74Aminoacylase 1 OS=Oryzias latipes OX=8090 PE=4 SV=... [more]
A0A3P9LQP86.130e-14049.49Aminoacylase 1 OS=Oryzias latipes OX=8090 PE=4 SV=... [more]
A0A3B3IG886.910e-14049.49Aminoacylase 1 OS=Oryzias latipes OX=8090 GN=acy1 ... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acy11.933e-13648.21aminoacylase 1 [Source:NCBI gene;Acc:103031539][more]
pm20d1.22.193e-923.00peptidase M20 domain containing 1 [Source:NCBI gen... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acy16.178e-10746.30aminoacylase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-75... [more]
pm20d1.12.464e-1322.58peptidase M20 domain containing 1, tandem duplicat... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CPS16.501e-1331.68Vacuolar carboxypeptidase S; expression is induced... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO344831.523e-1925.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aminoacylase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
acy12.601e-14349.49aminoacylase 1 [Source:NCBI gene;Acc:101160548][more]
acy14.487e-11744.13aminoacylase 1 [Source:NCBI gene;Acc:101160548][more]
pm20d1.21.237e-1324.29peptidase M20 domain containing 1 [Source:NCBI gen... [more]
back to top
BLAST of Aminoacylase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000028073.10.000e+098.75SMESG000028073.1[more]
SMESG000028073.17.513e-1198.84SMESG000028073.1[more]
SMESG000028017.10.000e+070.26SMESG000028017.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005961 ID=SMED30005961|Name=Aminoacylase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1249bp
GTAAAATTGATTTGAATAACAAATGGAATCATTAAACAACCAAGCCGTTG
AAAATTTTTGTGAGTATTTGAAGTGTGAAACTGTCCATCCAAATCCTGAT
TATTCAAAAGCTGTTGAATTTCTTACATCTCAATCAATTCAATTAGGATT
GGAATTAACTGTCCTTGAATTTTGCCCGAAAAACCCAATAGTAATAATGA
AATGGAGTGGTAGAAATAAGGATTTGAAAAGTGCAGTGTTCAATTCACAT
ATTGATGTCGTACCTGTGTTCCCTGATCAATGGAAATATCCCCCTTTCTC
TGCTCACATCGATGACAATGATGATATCTATGCCAGAGGTTCTCAAGACA
TGAAATGTTGTGGCAGTCAGTACTTAGAAGCGATAAGACGCATTAAAATT
AATTCACCTGATTTTATACCGGAAAGAAATATTTACATTTTATTCGTACC
AGATGAAGAAGTTGGTGGTGGAAAAGGAATGAAAAAGTTTGTTGAAAGTC
AACAATTCAATGAAATGAATATCGGAATAGTTATGGATGAAGGTATAACG
AGTACAGGGAATGATTATCCAGTGTTTTACGGAGATAGGGTTTTGTGTTG
GATAAAAGTTCACATCAGTGGATCTACCGGCCATGGTTCCCAGTTTATTA
AAAATACAGCTGGAGTTAAACTTAAATTGATTTTGAATAAATTTATGGAT
TTCCGCGAACAAGAGGAGGCCCGAATGATAGAAAATAATCTTACTTTAGG
AGACGTCACAACAGTTAATCTTACTGGCGTAGCTGGTGGAGTACAGCACA
ACGTCATTCCATCACCATTCACTTTAGACTTCGATATTCGAATTAGTCCG
AAAATGAATATAAATGAATTTAAAGCAATGATGAATGAATGGGCACGAGA
ATGTGGAGATGGGATTGAATACGAATTTATTCAACATTCACCAAGTGCGT
ACCTTACACCAATTGATAGTACCAACAAATGGTGGATGAAATTTGAATCT
ATATGCAAATCTCTCAATATGAAAATCATTCCACAGGTATTTCCGGCAGG
AACTGATAGCAGGTATGTCCGAGAAAAAGGAATCCATGCAATTGGGTTTT
CACCAATCAATAATACTCCATTCCTTTTGCATGACCACAATGAATGCCTG
AATGTCGATACATTCATTCGTGGAATCGATTTCTATGAAAAATTGATTTT
GGAATTTTCATCCATGCAAGTTGATTAATGATCAATAAAATTTTCTAAA
back to top

protein sequence of SMED30005961-orf-1

>SMED30005961-orf-1 ID=SMED30005961-orf-1|Name=SMED30005961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=402bp
MESLNNQAVENFCEYLKCETVHPNPDYSKAVEFLTSQSIQLGLELTVLEF
CPKNPIVIMKWSGRNKDLKSAVFNSHIDVVPVFPDQWKYPPFSAHIDDND
DIYARGSQDMKCCGSQYLEAIRRIKINSPDFIPERNIYILFVPDEEVGGG
KGMKKFVESQQFNEMNIGIVMDEGITSTGNDYPVFYGDRVLCWIKVHISG
STGHGSQFIKNTAGVKLKLILNKFMDFREQEEARMIENNLTLGDVTTVNL
TGVAGGVQHNVIPSPFTLDFDIRISPKMNINEFKAMMNEWARECGDGIEY
EFIQHSPSAYLTPIDSTNKWWMKFESICKSLNMKIIPQVFPAGTDSRYVR
EKGIHAIGFSPINNTPFLLHDHNECLNVDTFIRGIDFYEKLILEFSSMQV
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036264Bact_exopeptidase_dim_dom
IPR002933Peptidase_M20
IPR010159N-acyl_aa_amidohydrolase
IPR011650Peptidase_M20_dimer
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006520cellular amino acid metabolic process
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004046aminoacylase activity
GO:0008237metallopeptidase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePIRSFPIRSF036696ACY-1coord: 1..400
e-value: 1.2E-161
score: 535.4
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 1..193
e-value: 2.2E-54
score: 186.0
NoneNo IPR availableGENE3DG3DSA:3.30.70.1640coord: 318..398
e-value: 3.8E-35
score: 121.4
NoneNo IPR availableGENE3DG3DSA:3.30.70.360coord: 194..304
e-value: 8.3E-21
score: 76.0
NoneNo IPR availablePANTHERPTHR45892:SF1AMINOACYLASE-1coord: 4..399
NoneNo IPR availablePANTHERPTHR45892FAMILY NOT NAMEDcoord: 4..399
NoneNo IPR availableCDDcd05646M20_AcylaseI_likecoord: 5..396
e-value: 0.0
score: 586.161
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 3..396
IPR011650Peptidase M20, dimerisation domainPFAMPF07687M20_dimercoord: 187..293
e-value: 1.5E-10
score: 41.0
IPR010159N-acyl-L-amino-acid amidohydrolaseTIGRFAMTIGR01880TIGR01880coord: 5..397
e-value: 9.7E-152
score: 503.2
IPR002933Peptidase M20PFAMPF01546Peptidase_M20coord: 73..392
e-value: 1.6E-33
score: 116.4
IPR036264Bacterial exopeptidase dimerisation domainSUPERFAMILYSSF55031Bacterial exopeptidase dimerisation domaincoord: 192..299