dishevelled-associated activator of morphogenesis 1

Overview
Namedishevelled-associated activator of morphogenesis 1 (AFH54448.1)
Smed IDSMED30005945
Length (bp)3477
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dishevelled-associated activator of morphogenesis 1 (SMED30005945) t-SNE clustered cells

Violin plots show distribution of expression levels for dishevelled-associated activator of morphogenesis 1 (SMED30005945) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dishevelled-associated activator of morphogenesis 1 (SMED30005945) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dishevelled-associated activator of morphogenesis 1 (SMED30005945) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005945

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30005945SMESG000040024.1 dd_Smed_v4_3928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005945SMESG000040024.1 dd_Smed_v4_3928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005945SMESG000040024.1 dd_Smed_v4_3928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005945SMESG000040024.1 dd_Smed_v4_3928_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005945SMESG000040024.1 JN100092smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30005945SMESG000040024.1 JN100092smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005945SMESG000040024.1 JN100092smed_ncbi_20200123PMID:22339734
Beane et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Match: FMNL3 (formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698])

HSP 1 Score: 446.817 bits (1148), Expect = 2.273e-138
Identity = 346/1016 (34.06%), Postives = 545/1016 (53.64%), Query Frame = 1
Query:  181 GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPL 3099
            G++ M P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L       +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L   +  L+ V            L+E   P +  +L    P +  LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ +KFE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+ +L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+ GL   P+
Sbjct:   24 GKMPM-PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPSVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITGLHCQPM 1005          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Match: FMNL3 (formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698])

HSP 1 Score: 442.195 bits (1136), Expect = 3.911e-137
Identity = 337/1005 (33.53%), Postives = 529/1005 (52.64%), Query Frame = 1
Query:  181 GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPL 3099
            G++ M P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S       ++ Y  +  ++ L                                        K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L   +  L+ V            L+E   P +  +L    P +  LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ +KFE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+ +L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+ GL   P+
Sbjct:   24 GKMPM-PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPSVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQC---SVMYSTLPGRRAL----------------------------------------KNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITGLHCQPM 954          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Match: FMNL3 (formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698])

HSP 1 Score: 440.654 bits (1132), Expect = 6.307e-136
Identity = 346/1018 (33.99%), Postives = 543/1018 (53.34%), Query Frame = 1
Query:  181 GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            G++ M P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L       +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L   +  L+ V            L+E   P +  +L    P +  LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ +KFE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+ +L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:   24 GKMPM-PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPSVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTA-EAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITVLKSVPFTA 1006          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Match: FMNL2 (formin like 2 [Source:HGNC Symbol;Acc:HGNC:18267])

HSP 1 Score: 236.113 bits (601), Expect = 4.479e-63
Identity = 168/493 (34.08%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKF-INSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA----SIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            MG+  S  + Q  F  ++   +L M P   + E+R+   + ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   +++++E+  T+    D     S S     +  N  +    S+ R       R + +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+  QFINIVVHS ED+N RV+LQ EFT LGLD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +  +  + +D ++   ++ + +  TLR+ + E   +  R+  L  +I+ L+K
Sbjct:    1 MGNAGSMDSQQTDFRAHNVPLKLPM-PEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTF---DFESVES--TVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEK 477          

HSP 2 Score: 226.483 bits (576), Expect = 4.960e-60
Identity = 166/482 (34.44%), Postives = 277/482 (57.47%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTEE-TPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            VF  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE IFK    G +I    D + S +K  ++   K TLL+ ++ + L + L+   +    +D +CK+I+  ++    V+  + ++  LPT ++VK  R YE   K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+  +S F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F  +NE     L   A  A++ F    ++FGE      P VFF +F RF + +K++ E  ++RK++ Q+++  ++  E    +  PK  +   +  Q++L  E R++  + N    +   DG ++DI+  L   P +     +RS
Sbjct:  606 VFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAI----DLSSSKQKIPQKGSNKVTLLEANRAKNLAITLRKAGKT---ADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERK-PLENLSDEDRFMMQFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYE-GKDGAIEDIITDLRNQPYRRADAVRRS 1072          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Match: FMNL1 (formin like 1 [Source:HGNC Symbol;Acc:HGNC:1212])

HSP 1 Score: 227.254 bits (578), Expect = 3.132e-60
Identity = 153/443 (34.54%), Postives = 241/443 (54.40%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKA-LQTGKSIRK---------SFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNS------KDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISE 1464
            P   + E+R++  +  +++ P+ V+ + Q D ++K +L+ +   F+ KNP  +   Y+  +K+ + TG   RK          F ++  +    VL   E SLRTN++ WV +FLN  N GL+VLL+Y++       ++ Y   + + T N  S+++ +       +       +S+ +   +  K   +      ++S   S K+ +H  + C+RAI+N Q G  +   H   ++ IAL L + N +TK LVLE LAA+CL+  G   +LAAF+ FKE+ GE  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS E++N RV+LQ EFT LGLD +  +L     D+L+ Q+ AY  N  DV  LLED+ETK  VL   E+L+ +     E+       + + + E +  I  L+ Q  +  KE  TLRE+ SE
Sbjct:   30 PAAGELEERFNRALNCMNLPPDKVQLLSQYDNEKKWELICDQERFQVKNPPAA---YIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQES-TQVLRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQC---SVTY---DMESTDNGASNSEKNKPLEQSVEDLSKGPPSSVPKSRHLTIKLTPAHSRKALRNSRIVSQKDDVHVCIMCLRAIMNYQSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHDIILAAFDNFKEVCGEQHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEFTHLGLDLYLERLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTER-------LRDAENESMAKIAELEKQLSQARKELETLRERFSE 449          

HSP 2 Score: 218.779 bits (556), Expect = 1.757e-57
Identity = 123/390 (31.54%), Postives = 224/390 (57.44%), Query Frame = 1
Query: 1753 PIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEM----NCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQS 2901
            PIQTK+++P+ NW  LK  Q+ GTVF  +NDE +  +L+   FE  FK    G S+    D +    K +++ P K TL++ ++ + L + L+   +  L ++ +C++I   ++    ++  + ++  LPT  +     R+E   + P+  L++EDR +L   ++ RL +++  + ++ NFP+  + L+ ++  +  AS++++SS KL+QILEI+LA+GN MNSS+RG  YGFRLQSLD L + KS D+  TL+ + V ++  K+  L+ F  ++ F+++A  + ++++  DV SL  G++  + E     +C       LK+F   N      L   +  A+E F    E+FGE     +P +FF +F RF + +KK+ ++V + + ++
Sbjct:  635 PIQTKFRMPLLNWVALKPSQITGTVFTELNDEKVLQELDMSDFEEQFKTKSQGPSL----DLSALKSKAAQKAPSKATLIEANRAKNLAITLR---KGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFEREQR-PMEELSEEDRFMLCFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEIVLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMV-----LKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEA 1011          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Match: frl-1 (FRL (Formin Related gene in Leukocytes) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BL72])

HSP 1 Score: 177.948 bits (450), Expect = 5.489e-45
Identity = 118/389 (30.33%), Postives = 197/389 (50.64%), Query Frame = 1
Query: 1735 TQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKL--------NPVGD-SIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSD-KLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQX-XXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC-NTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
             ++I+   QTK KLP  NW+ +K  Q K TVF  +NDE++ +KL+F K E +FKL         P  + S+   V    ++         K TLLD  + + + +  + +  +          +N   +S E  D +   LPT+++ K Y   + ++ +  +  L+++D  +  LC++ERL+ KL V+  +  F E+   L  + T VT AS   R +Q    +LE+ILA+GN MNS +RG  YGF+L S   L       D+S TL+   V  +E    +L  FS++++FV++A+ +  +++ TD+  L  G K    E     T+ P  L  F    +   ADL ++   A  +F    E++GE + + +P VFF     F +N++K
Sbjct:  607 AKTIKKIYQTKNKLPQLNWTAMKPMQAKNTVFEKLNDELIIEKLDFSKLEEMFKLAQPTLGLAEPKSEQSVIGQVSPGSTTSAAGTSSARKNTLLDTKRLQNVAITRRKVAMDAKSIMAAVHQLNLSALSAEKVDILSRILPTDEERKLYAGKKTTESENSMENLSEDDNFVAALCEIERLEHKLAVMRVMSEFDESAGLLEPQFTHVTAASKCAREAQLFHGVLEVILAFGNYMNSGKRGGAYGFKLSSLDSLAILKAPADRSLTLLHMIVAEIEKNLPHLKTFSEQLKFVDKATSVQWDSVQTDMKELAAGFKMAEKEQELKGTDCPEALSTFTASRKQKMADLEQAFQLAASSFKDCCEFYGENEKSTSPTVFFQKLAHFVQNYQK 995          

HSP 2 Score: 155.221 bits (391), Expect = 5.835e-38
Identity = 133/481 (27.65%), Postives = 240/481 (49.90%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESK---NPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVL----------------FLNINYKNIETKKTLNLQS--DTKTHXXXXXXXXXXXX------NCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEY--------RTLREQISEPRNSTDREKELVLEINSLKKVL 1530
            P   Q +K +D  ++ +D+  + +R +   D D+K +L+++ +      P       ++     +  K   K+     D+    VL   E+SLRTN+VDWV++FLN  N GL  L+DYM +TL+                 FLN +  N       N  S  ++ +H SS ++  +         +  A++ ++  +         +  E+V + +H  + C+RAI+NN++G +  F  + AI  I   +LH N +TKTLVL+ L++IC +  G + V  AF+ F++   E RRF TL+  F  H      +++++F+ S  QF    V+  +D+N RV+LQ E T+LGLD +   + E   D L++++ +Y  N +DV  LL+DS  K  +L + E++  +    +E+ Q        +K  L + +  L  ++E  +KEY        +T+ E+  + R    R ++ + E+ +++K +
Sbjct:   12 PPQEQLDKMFDDVLKHMDLPVDKLRILRGYDNDKKWKLIVDQQVAKQVTPPAKYLEKLSYFLDKKLLKKALKNKEIGVDETSTSVLRHIEISLRTNSVDWVFEFLNTPNLGLRKLVDYM-RTLLADCAPSVPSTSSGLPAGFLN-STANSSVGANNNHSSLNESPSHNSSYEMSTTTTANTSNSFDATANLLKKGPLTISKGKVAKTTGEAV-DDIHICMMCLRAIMNNKQGFQQVFADTDAIYCIVRSILHQNLRTKTLVLQMLSSICWVQGGQELVSDAFDRFEKDFREPRRFWTLMQ-FVSHPP----EFHVEFLSSAVQFFYYFVNV-DDLNFRVHLQYEMTLLGLDKYIDMMAECESDELQERMISYQNNGIDVQQLLDDSNQKTELLDENERILSQLSQAKERIQEVEAKWITDKAALDRRLFDLVKERESMEKEYVEEKGSWTKTMNEKDRQAREERKRLEQKIGELEAIQKQM 483          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Match: frl-1 (FRL (Formin Related gene in Leukocytes) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BL72])

HSP 1 Score: 177.948 bits (450), Expect = 5.489e-45
Identity = 118/389 (30.33%), Postives = 197/389 (50.64%), Query Frame = 1
Query: 1735 TQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKL--------NPVGD-SIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSD-KLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQX-XXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC-NTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
             ++I+   QTK KLP  NW+ +K  Q K TVF  +NDE++ +KL+F K E +FKL         P  + S+   V    ++         K TLLD  + + + +  + +  +          +N   +S E  D +   LPT+++ K Y   + ++ +  +  L+++D  +  LC++ERL+ KL V+  +  F E+   L  + T VT AS   R +Q    +LE+ILA+GN MNS +RG  YGF+L S   L       D+S TL+   V  +E    +L  FS++++FV++A+ +  +++ TD+  L  G K    E     T+ P  L  F    +   ADL ++   A  +F    E++GE + + +P VFF     F +N++K
Sbjct:  607 AKTIKKIYQTKNKLPQLNWTAMKPMQAKNTVFEKLNDELIIEKLDFSKLEEMFKLAQPTLGLAEPKSEQSVIGQVSPGSTTSAAGTSSARKNTLLDTKRLQNVAITRRKVAMDAKSIMAAVHQLNLSALSAEKVDILSRILPTDEERKLYAGKKTTESENSMENLSEDDNFVAALCEIERLEHKLAVMRVMSEFDESAGLLEPQFTHVTAASKCAREAQLFHGVLEVILAFGNYMNSGKRGGAYGFKLSSLDSLAILKAPADRSLTLLHMIVAEIEKNLPHLKTFSEQLKFVDKATSVQWDSVQTDMKELAAGFKMAEKEQELKGTDCPEALSTFTASRKQKMADLEQAFQLAASSFKDCCEFYGENEKSTSPTVFFQKLAHFVQNYQK 995          

HSP 2 Score: 155.221 bits (391), Expect = 5.835e-38
Identity = 133/481 (27.65%), Postives = 240/481 (49.90%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESK---NPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVL----------------FLNINYKNIETKKTLNLQS--DTKTHXXXXXXXXXXXX------NCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEY--------RTLREQISEPRNSTDREKELVLEINSLKKVL 1530
            P   Q +K +D  ++ +D+  + +R +   D D+K +L+++ +      P       ++     +  K   K+     D+    VL   E+SLRTN+VDWV++FLN  N GL  L+DYM +TL+                 FLN +  N       N  S  ++ +H SS ++  +         +  A++ ++  +         +  E+V + +H  + C+RAI+NN++G +  F  + AI  I   +LH N +TKTLVL+ L++IC +  G + V  AF+ F++   E RRF TL+  F  H      +++++F+ S  QF    V+  +D+N RV+LQ E T+LGLD +   + E   D L++++ +Y  N +DV  LL+DS  K  +L + E++  +    +E+ Q        +K  L + +  L  ++E  +KEY        +T+ E+  + R    R ++ + E+ +++K +
Sbjct:   12 PPQEQLDKMFDDVLKHMDLPVDKLRILRGYDNDKKWKLIVDQQVAKQVTPPAKYLEKLSYFLDKKLLKKALKNKEIGVDETSTSVLRHIEISLRTNSVDWVFEFLNTPNLGLRKLVDYM-RTLLADCAPSVPSTSSGLPAGFLN-STANSSVGANNNHSSLNESPSHNSSYEMSTTTTANTSNSFDATANLLKKGPLTISKGKVAKTTGEAV-DDIHICMMCLRAIMNNKQGFQQVFADTDAIYCIVRSILHQNLRTKTLVLQMLSSICWVQGGQELVSDAFDRFEKDFREPRRFWTLMQ-FVSHPP----EFHVEFLSSAVQFFYYFVNV-DDLNFRVHLQYEMTLLGLDKYIDMMAECESDELQERMISYQNNGIDVQQLLDDSNQKTELLDENERILSQLSQAKERIQEVEAKWITDKAALDRRLFDLVKERESMEKEYVEEKGSWTKTMNEKDRQAREERKRLEQKIGELEAIQKQM 483          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 94.7449 bits (234), Expect = 1.780e-19
Identity = 103/450 (22.89%), Postives = 197/450 (43.78%), Query Frame = 1
Query: 1750 PPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKK--TLLDGSKHRCLGVLL-------KFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRR-GIMYGFRLQXXXXXX-XXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC--NTNQ-------PPR-------LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNN--PTPDVFFGIFHRFTENFKK-------SLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKL 2991
            PP   K      NW  L   + +GTV+  ++DE +Y +L+  +    F       S  +  +  D+   T  R+P++   T++D  +++   ++L       K + Q  +  D  CK      +  ++ +++L  +PT +++            P   L   DR +  +  + R +Q+L  +  I +F +  ++LV  +  V +A+ + + +++ +QIL IILA GN +N  +R G  YGF + S++ L     +L     L+ F V+ +E K+ +L+ F  +   V +A++        ++ +L   +  VR E+N   +T +       PP         K F E       +L K     K  F   A++F    +   P P+ FF + ++F   F +        +E+  K + Q+I  + +  + T + K   K    E+L   L
Sbjct:  360 PPGNMK----TLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCF-----AASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCK------LPKDMIEQMLKFMPTKEELTQINESVQKHGSP-TVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISAL 793          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 94.7449 bits (234), Expect = 1.780e-19
Identity = 103/450 (22.89%), Postives = 197/450 (43.78%), Query Frame = 1
Query: 1750 PPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKK--TLLDGSKHRCLGVLL-------KFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRR-GIMYGFRLQXXXXXX-XXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC--NTNQ-------PPR-------LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNN--PTPDVFFGIFHRFTENFKK-------SLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKL 2991
            PP   K      NW  L   + +GTV+  ++DE +Y +L+  +    F       S  +  +  D+   T  R+P++   T++D  +++   ++L       K + Q  +  D  CK      +  ++ +++L  +PT +++            P   L   DR +  +  + R +Q+L  +  I +F +  ++LV  +  V +A+ + + +++ +QIL IILA GN +N  +R G  YGF + S++ L     +L     L+ F V+ +E K+ +L+ F  +   V +A++        ++ +L   +  VR E+N   +T +       PP         K F E       +L K     K  F   A++F    +   P P+ FF + ++F   F +        +E+  K + Q+I  + +  + T + K   K    E+L   L
Sbjct:  360 PPGNMK----TLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCF-----AASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCK------LPKDMIEQMLKFMPTKEELTQINESVQKHGSP-TVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISAL 793          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Match: daam-1 (DAAM (Disheveled-Associated Activator of Morphogenesis) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3ASL6])

HSP 1 Score: 95.1301 bits (235), Expect = 1.960e-19
Identity = 103/450 (22.89%), Postives = 197/450 (43.78%), Query Frame = 1
Query: 1750 PPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKK--TLLDGSKHRCLGVLL-------KFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRR-GIMYGFRLQXXXXXX-XXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC--NTNQ-------PPR-------LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNN--PTPDVFFGIFHRFTENFKK-------SLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKL 2991
            PP   K      NW  L   + +GTV+  ++DE +Y +L+  +    F       S  +  +  D+   T  R+P++   T++D  +++   ++L       K + Q  +  D  CK      +  ++ +++L  +PT +++            P   L   DR +  +  + R +Q+L  +  I +F +  ++LV  +  V +A+ + + +++ +QIL IILA GN +N  +R G  YGF + S++ L     +L     L+ F V+ +E K+ +L+ F  +   V +A++        ++ +L   +  VR E+N   +T +       PP         K F E       +L K     K  F   A++F    +   P P+ FF + ++F   F +        +E+  K + Q+I  + +  + T + K   K    E+L   L
Sbjct:  529 PPGNMK----TLNWQRLTLDKTRGTVWDGIDDEKIYKQLDLTELSGCF-----AASSSHKDEDTDTLYGTINRRPQQANITVIDPRRYQNCTIMLSKLKLSHKEIKQAMMSMDEKCK------LPKDMIEQMLKFMPTKEELTQINESVQKHGSP-TVLALADRYMYEISSIPRFEQRLRCLNIIRSFHDRVEALVPFIQVVLKATSSCQQNKRFRQILTIILAIGNYLNFGKRNGNAYGFEMASINKLADVKNALRNDRNLLHFLVNFIEKKYPDLTKFKKDFATVTEAARFSQSETAAEIRNLEEALLIVRKELNLLESTTKVELPEHIPPENDRFALVAKAFIEKATAEYHNLDKMFREMKNKFSDCAKYFCYSPSGGVPVPEEFFSVINKFLNTFNEYHQQLWAEVEEEEKIKRQTIARSFLAKKSTTRRKENHKERDFEQLISAL 962          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Match: Frl (gene:FBgn0267795 transcript:FBtr0114573)

HSP 1 Score: 201.445 bits (511), Expect = 3.357e-52
Identity = 129/386 (33.42%), Postives = 224/386 (58.03%), Query Frame = 1
Query: 1741 SIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSN--DSSEKTSKR--KPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRY--EYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRD--EMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
            +I+  + TKYKLP  NW  LK  Q++GT+F  ++DE ++ +++F +FE  FK+  +G ++ NG +    D S ++SKR  +P+  +LL+ ++ R + +  + L    +  D +  +I+ L++   S+E  + +   +PT+ +VK+Y+ Y  E  D+     LT+ED+ +L L +VER+  KL ++ Y+ NF ++   +  +V  +  AS +++ S+K K +LEI+LA+GN +NS++RG  YGF+LQSLD L DTKS DK  +L+ + V  + +KF  L +F  E+   ++A+ + +E +  DV  L  GM  VR   E+     Q   L+ F  ++E+    +     +A+E F +  E+FG+   N     FF +  RFT  FK+
Sbjct:  677 TIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIG-IGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLG---MPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQ---QLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQ 1055          

HSP 2 Score: 189.504 bits (480), Expect = 1.541e-48
Identity = 98/214 (45.79%), Postives = 135/214 (63.08%), Query Frame = 1
Query:  679 SIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEF 1320
            S+KRRS  + K          +  + +H  + C+RAI+NN+ G  M   H  AI+ IAL L+H + +TK LVLE LAAICL+  G + +L +F+ FK++  E RRF TL+ YF + E F     NIDFMV+C QF+NIVVHS ED+N RV+LQ EFT LGLD +  ++     + LK Q++AY  N  DVA L+EDSETK + L   ++LE + 
Sbjct:  288 SLKRRSRHIAKLNMG------AATDDIHVSIMCLRAIMNNKYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKGGHEIILGSFDNFKDVCQEKRRFQTLMEYFMNFEAF-----NIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKYLERIRLTESEELKVQISAYLDNVFDVAALMEDSETKTSALERVQELEDQL 490          

HSP 3 Score: 61.2326 bits (147), Expect = 5.492e-9
Identity = 34/119 (28.57%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKK--PDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS 543
            PT  + ++R+   + S+D+ P+  + +   D ++K  ++ + E    K    HY++ ++     K+ R    +K   +     VL   E+SLRTN+++WV +FL+  N GL+ L+DY+S
Sbjct:   79 PTTDELDRRFAKVLASMDLPPDKAKLLRNYDDEKKWDMICDQEMVQAKDPPSHYLSKLRTYLDPKASRSHRKRKMVGESTSTQVLRDLEISLRTNHIEWVKEFLDDTNQGLDALVDYLS 197          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Match: Frl (gene:FBgn0267795 transcript:FBtr0334053)

HSP 1 Score: 200.675 bits (509), Expect = 4.018e-52
Identity = 129/386 (33.42%), Postives = 224/386 (58.03%), Query Frame = 1
Query: 1741 SIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSN--DSSEKTSKR--KPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRY--EYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRD--EMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
            +I+  + TKYKLP  NW  LK  Q++GT+F  ++DE ++ +++F +FE  FK+  +G ++ NG +    D S ++SKR  +P+  +LL+ ++ R + +  + L    +  D +  +I+ L++   S+E  + +   +PT+ +VK+Y+ Y  E  D+     LT+ED+ +L L +VER+  KL ++ Y+ NF ++   +  +V  +  AS +++ S+K K +LEI+LA+GN +NS++RG  YGF+LQSLD L DTKS DK  +L+ + V  + +KF  L +F  E+   ++A+ + +E +  DV  L  GM  VR   E+     Q   L+ F  ++E+    +     +A+E F +  E+FG+   N     FF +  RFT  FK+
Sbjct:  677 TIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIG-IGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLG---MPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQ---QLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQ 1055          

HSP 2 Score: 189.119 bits (479), Expect = 1.765e-48
Identity = 98/214 (45.79%), Postives = 135/214 (63.08%), Query Frame = 1
Query:  679 SIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEF 1320
            S+KRRS  + K          +  + +H  + C+RAI+NN+ G  M   H  AI+ IAL L+H + +TK LVLE LAAICL+  G + +L +F+ FK++  E RRF TL+ YF + E F     NIDFMV+C QF+NIVVHS ED+N RV+LQ EFT LGLD +  ++     + LK Q++AY  N  DVA L+EDSETK + L   ++LE + 
Sbjct:  288 SLKRRSRHIAKLNMG------AATDDIHVSIMCLRAIMNNKYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKGGHEIILGSFDNFKDVCQEKRRFQTLMEYFMNFEAF-----NIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKYLERIRLTESEELKVQISAYLDNVFDVAALMEDSETKTSALERVQELEDQL 490          

HSP 3 Score: 61.2326 bits (147), Expect = 6.197e-9
Identity = 34/119 (28.57%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKK--PDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS 543
            PT  + ++R+   + S+D+ P+  + +   D ++K  ++ + E    K    HY++ ++     K+ R    +K   +     VL   E+SLRTN+++WV +FL+  N GL+ L+DY+S
Sbjct:   79 PTTDELDRRFAKVLASMDLPPDKAKLLRNYDDEKKWDMICDQEMVQAKDPPSHYLSKLRTYLDPKASRSHRKRKMVGESTSTQVLRDLEISLRTNHIEWVKEFLDDTNQGLDALVDYLS 197          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Match: Frl (gene:FBgn0267795 transcript:FBtr0075775)

HSP 1 Score: 201.06 bits (510), Expect = 4.336e-52
Identity = 129/386 (33.42%), Postives = 224/386 (58.03%), Query Frame = 1
Query: 1741 SIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSN--DSSEKTSKR--KPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRY--EYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRD--EMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
            +I+  + TKYKLP  NW  LK  Q++GT+F  ++DE ++ +++F +FE  FK+  +G ++ NG +    D S ++SKR  +P+  +LL+ ++ R + +  + L    +  D +  +I+ L++   S+E  + +   +PT+ +VK+Y+ Y  E  D+     LT+ED+ +L L +VER+  KL ++ Y+ NF ++   +  +V  +  AS +++ S+K K +LEI+LA+GN +NS++RG  YGF+LQSLD L DTKS DK  +L+ + V  + +KF  L +F  E+   ++A+ + +E +  DV  L  GM  VR   E+     Q   L+ F  ++E+    +     +A+E F +  E+FG+   N     FF +  RFT  FK+
Sbjct:  686 TIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIG-IGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLG---MPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQ---QLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQ 1064          

HSP 2 Score: 189.504 bits (480), Expect = 1.770e-48
Identity = 98/214 (45.79%), Postives = 135/214 (63.08%), Query Frame = 1
Query:  679 SIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEF 1320
            S+KRRS  + K          +  + +H  + C+RAI+NN+ G  M   H  AI+ IAL L+H + +TK LVLE LAAICL+  G + +L +F+ FK++  E RRF TL+ YF + E F     NIDFMV+C QF+NIVVHS ED+N RV+LQ EFT LGLD +  ++     + LK Q++AY  N  DVA L+EDSETK + L   ++LE + 
Sbjct:  297 SLKRRSRHIAKLNMG------AATDDIHVSIMCLRAIMNNKYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKGGHEIILGSFDNFKDVCQEKRRFQTLMEYFMNFEAF-----NIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKYLERIRLTESEELKVQISAYLDNVFDVAALMEDSETKTSALERVQELEDQL 499          

HSP 3 Score: 54.299 bits (129), Expect = 8.490e-7
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIR-----------KSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS 543
            PT  + ++R+   + S+D+ P+  + +   D ++K  ++ + E    K    HY++ ++     K+ R           +      +     VL   E+SLRTN+++WV +FL+  N GL+ L+DY+S
Sbjct:   79 PTTDELDRRFAKVLASMDLPPDKAKLLRNYDDEKKWDMICDQEMVQAKDPPSHYLSKLRTYLDPKASRSHRLYLFYFLCQKRKMVGESTSTQVLRDLEISLRTNHIEWVKEFLDDTNQGLDALVDYLS 206          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Match: Frl (gene:FBgn0267795 transcript:FBtr0075776)

HSP 1 Score: 200.675 bits (509), Expect = 4.647e-52
Identity = 129/386 (33.42%), Postives = 224/386 (58.03%), Query Frame = 1
Query: 1741 SIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSN--DSSEKTSKR--KPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRY--EYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRD--EMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
            +I+  + TKYKLP  NW  LK  Q++GT+F  ++DE ++ +++F +FE  FK+  +G ++ NG +    D S ++SKR  +P+  +LL+ ++ R + +  + L    +  D +  +I+ L++   S+E  + +   +PT+ +VK+Y+ Y  E  D+     LT+ED+ +L L +VER+  KL ++ Y+ NF ++   +  +V  +  AS +++ S+K K +LEI+LA+GN +NS++RG  YGF+LQSLD L DTKS DK  +L+ + V  + +KF  L +F  E+   ++A+ + +E +  DV  L  GM  VR   E+     Q   L+ F  ++E+    +     +A+E F +  E+FG+   N     FF +  RFT  FK+
Sbjct:  677 TIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIG-IGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLG---MPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQ---QLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQ 1055          

HSP 2 Score: 189.504 bits (480), Expect = 1.893e-48
Identity = 98/214 (45.79%), Postives = 135/214 (63.08%), Query Frame = 1
Query:  679 SIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEF 1320
            S+KRRS  + K          +  + +H  + C+RAI+NN+ G  M   H  AI+ IAL L+H + +TK LVLE LAAICL+  G + +L +F+ FK++  E RRF TL+ YF + E F     NIDFMV+C QF+NIVVHS ED+N RV+LQ EFT LGLD +  ++     + LK Q++AY  N  DVA L+EDSETK + L   ++LE + 
Sbjct:  288 SLKRRSRHIAKLNMG------AATDDIHVSIMCLRAIMNNKYGFNMVIQHREAINCIALSLIHKSLRTKALVLELLAAICLVKGGHEIILGSFDNFKDVCQEKRRFQTLMEYFMNFEAF-----NIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKYLERIRLTESEELKVQISAYLDNVFDVAALMEDSETKTSALERVQELEDQL 490          

HSP 3 Score: 61.2326 bits (147), Expect = 5.964e-9
Identity = 34/119 (28.57%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKK--PDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS 543
            PT  + ++R+   + S+D+ P+  + +   D ++K  ++ + E    K    HY++ ++     K+ R    +K   +     VL   E+SLRTN+++WV +FL+  N GL+ L+DY+S
Sbjct:   79 PTTDELDRRFAKVLASMDLPPDKAKLLRNYDDEKKWDMICDQEMVQAKDPPSHYLSKLRTYLDPKASRSHRKRKMVGESTSTQVLRDLEISLRTNHIEWVKEFLDDTNQGLDALVDYLS 197          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Match: DAAM (gene:FBgn0025641 transcript:FBtr0070241)

HSP 1 Score: 134.806 bits (338), Expect = 1.598e-31
Identity = 118/409 (28.85%), Postives = 198/409 (48.41%), Query Frame = 1
Query: 1732 QTQSIRPP---------IQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSE---KTSKRKPEKKTL--LDGSKHRCLGVLL---KFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWT-LMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPR---------LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLED 2877
            QT +  PP          Q    L  FNWS L + +L+GTV+  +++  LY+ +E E  + +F          NGV + D S    + + +  ++K L  +DG + +   +LL   K  D E +   IL    N+ ++ +++ +++L   P+ ++       E+S+   I +L   DR L  + K+   +Q+L+ + Y   F      LV ++T V  AS  V  S++L+++LE++LA GN MN   RG   GFRL SL+ L DTKS     T L+ + V ++E KF++L    D++  V +ASK+ +  +  D+  L  G+  V  E+  + +  P          +++F        A+L     + K  F +A   FGE  +   PD FFGIF  F   F ++  D
Sbjct:  588 QTMAPAPPKVDLPKKNVPQPTNPLKSFNWSKLPDAKLQGTVWSELDESKLYNNMELESIDKLFSAYQ-----KNGVSATDGSYEDLRVTGKAAKQKVLSVIDGRRAQNCTILLSKLKMSDME-ISKAILSMDSNE-QLQLDMVEQLLKFTPSAEERALLD--EHSED--IESLARADRFLYEISKIPHYEQRLKSLHYKKRFMLTINDLVPRITSVMEASREVARSRRLRKLLELVLALGNYMNRGARGNASGFRLASLNRLADTKSSAAKGTTLLHYLVQVIERKFKDLLKLEDDIPHVREASKVSLGEMDKDIQMLRTGLADVAREIEFHRSSGPAQQGDRFLPVMREFHAQASVRFAELEDKFQDMKTRFDRAVRLFGEDGSVLQPDEFFGIFDSFLAAFAEARHD 985          

HSP 2 Score: 88.9669 bits (219), Expect = 2.122e-17
Identity = 54/163 (33.13%), Postives = 84/163 (51.53%), Query Frame = 1
Query:  745 VKNS-LHQGL-KCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSG---EDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQV 1218
            V NS LH  L  C++A++NN  G      H  AID IA  L   N +TK   LE L A+CL+  G +KVL A  +F+    E  RF +++    D  T+   D N++   +   F+N V++ G   E++  R++L+ EF +LG+     KL     + L + +
Sbjct:  139 VANSPLHTSLIGCIKALMNNSMGRAHVLAHPTAIDTIARSLAADNIRTKIAALEILGAVCLVPGGHRKVLQAMLHFQVFATERTRFQSIVNDL-DRSTYAYRD-NVNLKTALMSFVNAVLNYGPGQENLEFRLHLRYEFLMLGIQPVIDKLRTHENETLDRHL 299          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Match: fmnl3 (formin-like 3 [Source:NCBI gene;Acc:407694])

HSP 1 Score: 238.424 bits (607), Expect = 4.204e-68
Identity = 160/474 (33.76%), Postives = 268/474 (56.54%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQ-SIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 3153
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++D+ + ++L+ EKFE +FK    G      VD + S  K S++   K  LLD ++ + L + L+  ++    ++ +CK+I   ++    V+  + ++  LPT  + K  R+YE  ++ P++ L +EDR +L   K+ERL Q++ ++ ++ NF +    L  ++  +  AS +V+SS KLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   +V+ K+  L++F +E+ FV++A+ + +E +  DV  L  GM  VR E  C+ +    LK F + ++     L+K A  A+E F     +FGE      P VFF +F RF   +K+++E+  +R+ Q   +   +  +E  +  PK +       Q++L  E R++  + +    +   DG ++DI+  L   P  A    + S       +F
Sbjct:   18 IKKPIKTKFRLPVFNWTALKPNQINGTVFNEIDDDRVLEELDLEKFEELFKTKAQGPV----VDLSCSKSKVSQKVINKVQLLDANRSKNLAITLRKANKT---TEEICKAIQTFDLKALPVDFVECLMRFLPTEAESKLLRQYE-RERRPLDQLAEEDRFMLLFSKIERLTQRMSIITFVGNFNDNVNMLTPQLNAIIAASASVKSSPKLKKILEIILALGNYMNSSKRGSVYGFKLQSLDLLLDTKSTDRKMTLLHYIALVVKEKYPELANFYNELHFVDKAAAVSLENVLLDVKELGKGMDLVRRE--CSLHDHAVLKGFAQTSDTQLDKLAKDAKTAEEAFNNVVLYFGESPKTTPPSVFFPVFVRFIRAYKEAVEENEQRKKQEEAMREKLLAQEAKQHDPKVQAQKKRHQQQELIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTARTAKRGSRFFCDANLF 480          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Match: fmnl3 (formin-like 3 [Source:NCBI gene;Acc:407694])

HSP 1 Score: 237.654 bits (605), Expect = 5.029e-68
Identity = 161/485 (33.20%), Postives = 261/485 (53.81%), Query Frame = 1
Query:  166 INSGEGRLEMR----------PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNS--------LHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            I S +G+ EM+          P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  ++     K  RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL++L++Y+S      + ++++ +E  +  +L    K    S  +    +  C   ++     V ++ ++ +S  +++KNS        +H  + C+RAI+N Q G  +   H+ A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E  RF+ L+ YFR       +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGLDDF  K +    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE    +  +  L+ Q   +DKE   ++E                 ++++L++++ EK+  F
Sbjct:    4 IESVDGQSEMKHHIMPLKVPMPDPTELEERFAIVLNSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLRGYLDPKVTRKKFRRRVQE-STKVLRELEISLRTNHIGWVREFLNDENRGLDILVEYLSFAQCAVM-LDFEGLENGEDFSLD---KAKSWSRSIEDLHQNGCNTLVRSARQSVLRYGSTSNS--KTIKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHAHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKEKHRFEKLMEYFRS------EDGNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLDDFLEKSKHTESDKLSVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHLSHVTEK----LLDVENET---MTKVADLEKQLLHKDKELAVIKETYESAST----------QVHTLRRMIQEKDAAF 455          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 233.032 bits (593), Expect = 8.359e-66
Identity = 161/454 (35.46%), Postives = 269/454 (59.25%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLED--VRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDK 3090
            I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT+++ P K +LLD ++ + L + L+ + +    S+ +C+ I   ++    V+  + ++  +P+  ++K  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   R E + + +    LK F + NEN    L   A  A++ F +  ++FGE      P VFF +F RF + ++++ ED   +KR  Q ++  ++  E   +   K  +   +  Q++L  E RKK  + +    +   DG ++DI+  L K
Sbjct:    4 IKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTKAQGPAI----DITSSKQKTAQKGPHKISLLDANRSKNLAITLRKVGKT---SEEICRGIQLFDLRTLPVDFVECLMRFIPSEAELKVLRQYEKERK-PLENLTDEDRFMIQFSKIERLMQKMTIMAFVGNFTESIQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKITLLHYIANVVKDKYQQVSLFYNELNYVEKAAAVSLENVLLDVKELQRGMDLTRKEYSMHGHN-TLLKDFIQQNENKLKKLQDDAKIAQDAFDEVVKFFGENAKTTPPSVFFPVFVRFVKAYRQAEEDNEQKKRHEQMMMEKLIEQEAMEQEDQKSPSHKNKRQQQELIAELRKKQVKDSRHVYE-GKDGAIEDIITALKK 447          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Match: fmnl3 (formin-like 3 [Source:NCBI gene;Acc:407694])

HSP 1 Score: 240.35 bits (612), Expect = 7.628e-65
Identity = 159/465 (34.19%), Postives = 266/465 (57.20%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQ-SIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++D+ + ++L+ EKFE +FK    G      VD + S  K S++   K  LLD ++ + L + L+  ++    ++ +CK+I   ++    V+  + ++  LPT  + K  R+YE  ++ P++ L +EDR +L   K+ERL Q++ ++ ++ NF +    L  ++  +  AS +V+SS KLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   +V+ K+  L++F +E+ FV++A+ + +E +  DV  L  GM  VR E  C+ +    LK F + ++     L+K A  A+E F     +FGE      P VFF +F RF   +K+++E+  +R+ Q   +   +  +E  +  PK +       Q++L  E R++  + +    +   DG ++DI+  L   P  A    + S
Sbjct:  580 IKKPIKTKFRLPVFNWTALKPNQINGTVFNEIDDDRVLEELDLEKFEELFKTKAQGPV----VDLSCSKSKVSQKVINKVQLLDANRSKNLAITLRKANKT---TEEICKAIQTFDLKALPVDFVECLMRFLPTEAESKLLRQYE-RERRPLDQLAEEDRFMLLFSKIERLTQRMSIITFVGNFNDNVNMLTPQLNAIIAASASVKSSPKLKKILEIILALGNYMNSSKRGSVYGFKLQSLDLLLDTKSTDRKMTLLHYIALVVKEKYPELANFYNELHFVDKAAAVSLENVLLDVKELGKGMDLVRRE--CSLHDHAVLKGFAQTSDTQLDKLAKDAKTAEEAFNNVVLYFGESPKTTPPSVFFPVFVRFIRAYKEAVEENEQRKKQEEAMREKLLAQEAKQHDPKVQAQKKRHQQQELIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTARTAKRGS 1033          

HSP 2 Score: 239.58 bits (610), Expect = 1.455e-64
Identity = 161/485 (33.20%), Postives = 261/485 (53.81%), Query Frame = 1
Query:  166 INSGEGRLEMR----------PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNS--------LHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            I S +G+ EM+          P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  ++     K  RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL++L++Y+S      + ++++ +E  +  +L    K    S  +    +  C   ++     V ++ ++ +S  +++KNS        +H  + C+RAI+N Q G  +   H+ A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E  RF+ L+ YFR       +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGLDDF  K +    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE    +  +  L+ Q   +DKE   ++E                 ++++L++++ EK+  F
Sbjct:    4 IESVDGQSEMKHHIMPLKVPMPDPTELEERFAIVLNSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLRGYLDPKVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENRGLDILVEYLSFAQCAVM-LDFEGLENGEDFSLD---KAKSWSRSIEDLHQNGCNTLVRSARQSVLRYGSTSNS--KTIKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHAHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKEKHRFEKLMEYFRS------EDGNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLDDFLEKSKHTESDKLSVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHLSHVTEK----LLDVENET---MTKVADLEKQLLHKDKELAVIKETYESAST----------QVHTLRRMIQEKDAAF 455          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 239.195 bits (609), Expect = 2.551e-64
Identity = 167/474 (35.23%), Postives = 278/474 (58.65%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLED--VRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEV 3150
            I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT+++ P K +LLD ++ + L + L+ + +    S+ +C+ I   ++    V+  + ++  +P+  ++K  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   R E + + +    LK F + NEN    L   A  A++ F +  ++FGE      P VFF +F RF + ++++ ED   +KR  Q ++  ++  E   +   K  +   +  Q++L  E RKK  + +    +   DG ++DI+  L   P  A    KRS+  + EE+
Sbjct:  613 IKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTKAQGPAI----DITSSKQKTAQKGPHKISLLDANRSKNLAITLRKVGKT---SEEICRGIQLFDLRTLPVDFVECLMRFIPSEAELKVLRQYEKERK-PLENLTDEDRFMIQFSKIERLMQKMTIMAFVGNFTESIQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKITLLHYIANVVKDKYQQVSLFYNELNYVEKAAAVSLENVLLDVKELQRGMDLTRKEYSMHGHN-TLLKDFIQQNENKLKKLQDDAKIAQDAFDEVVKFFGENAKTTPPSVFFPVFVRFVKAYRQAEEDNEQKKRHEQMMMEKLIEQEAMEQEDQKSPSHKNKRQQQELIAELRKKQVKDSRHVYE-GKDGAIEDIITVLKTVPFTART-AKRSSRYFNEEL 1075          

HSP 2 Score: 230.72 bits (587), Expect = 1.224e-61
Identity = 156/463 (33.69%), Postives = 254/463 (54.86%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            P   + E+R+   + S+++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V +   + +N         ++ +++                ++I R       RS+ +   +  K+S     K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF++FKE+  E +RF+ L+ YF++      +D NIDFMV+C QFINIVVHS ED+N RV+LQ +FT LGLD++  KL+    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q        +IV +E +  +  + +DSL+   ++ + +  TLR  + E   +  R+  L  +I+ L+K
Sbjct:   25 PEPAELEERFALVLNSMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIHKLQSYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTYDGDSSENSTENSVDKSKAWSRSIEDLHGGNHLSSGGSGSNISRTNRHSTIRSNTLPSRRTLKNSRLVCKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDHFKEVCLEEQRFEKLMEYFKN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQYDFTKLGLDEYLDKLKHTESDKLHVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENMSHLTEKLQDTENEAMAKIVELEKQLMQRNKELDSLRDVYKDANSQVHTLRRMVKEKDEAIQRQCNLEKKIHELEK 477          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Match: gclm (glutamate-cysteine ligase, modifier subunit [Source:Xenbase;Acc:XB-GENE-1014945])

HSP 1 Score: 409.838 bits (1052), Expect = 7.669e-125
Identity = 296/890 (33.26%), Postives = 477/890 (53.60%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLF----LNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSV----VTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEK-------NIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTP 2817
            ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F    L  N +N   K     +S    H  S+        N      R S++    +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT L LD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q        +IV +E +   L+Q    L    ++ + +  TLR+ + E   +  R+  L  +I+ L+K  + K       +I     V +   P+ S                 P                  V        ++    I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + +  ++FE IFK    G +I    D + + +K + +   K TLL+ ++ + L + L+   +    ++ +CK+I   ++    V+  + ++  +PT  +VK +R+YE  +K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+  ++ F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F +++E     L   A  +++ F    ++FGE      P
Sbjct:   32 AMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVPRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDFECLENNVENSVDKSKPWSRSIEDLHRGSNLPSPVG--NSITRSGRHSTLRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHLHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLALDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMAKIVELEKQ---LMQRNKELDIVCKDANTQVHTLRKMVKEKEEAIQRQSTLERKIHELEKQGSIKIQKKGDGDISITPMVASGSVPSGSEGTPGGAPGASISGPSIPCGTTSVPGVAGALSSTTLVPPSSPLLGSSSAVKIKKPIKTKFRMPVFNWVALKPHQINGTVFNEIDDERILEDINVDEFEEIFKTKAQGPAI----DISSTKQKAAPKVTSKVTLLEANRAKNLAITLRKAGKT---AEEICKAIQLFDLKTLPVDFVECLMRFMPTEGEVKVFRQYE-REKKPLENLSDEDRFMMQFSKIERLMQKMTIMAFIGNFSESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVRDKYLQVALFYNEIHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNVMLKEFIQNSEVRLKKLQDDAKISQDAFDDVVKYFGENPKTTPP 897          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Match: gclm (glutamate-cysteine ligase, modifier subunit [Source:Xenbase;Acc:XB-GENE-1014945])

HSP 1 Score: 390.193 bits (1001), Expect = 1.980e-118
Identity = 281/877 (32.04%), Postives = 453/877 (51.65%), Query Frame = 1
Query:  247 LDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEK-------NIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTP 2817
            +++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +                    FLN                               + N   SI   S ++   +  K S+  S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT L LD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q        +IV +E +   L+Q    L    ++ + +  TLR+ + E   +  R+  L  +I+ L+K  + K       +I     V +   P+ S                 P                  V        ++    I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + +  ++FE IFK    G +I    D + + +K + +   K TLL+ ++ + L + L+   +    ++ +CK+I   ++    V+  + ++  +PT  +VK +R+YE  +K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+  ++ F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F +++E     L   A  +++ F    ++FGE      P
Sbjct:    1 MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVPRKKFRRRVQES-TQVLRELEISLRTNHIGWVRE--------------------FLN-------------------------------EENKVESI---SGILKGKKTWKQSLAVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHLHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLALDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMAKIVELEKQ---LMQRNKELDIVCKDANTQVHTLRKMVKEKEEAIQRQSTLERKIHELEKQGSIKIQKKGDGDISITPMVASGSVPSGSEGTPGGAPGASISGPSIPCGTTSVPGVAGALSSTTLVPPSSPLLGSSSAVKIKKPIKTKFRMPVFNWVALKPHQINGTVFNEIDDERILEDINVDEFEEIFKTKAQGPAI----DISSTKQKAAPKVTSKVTLLEANRAKNLAITLRKAGKT---AEEICKAIQLFDLKTLPVDFVECLMRFMPTEGEVKVFRQYE-REKKPLENLSDEDRFMMQFSKIERLMQKMTIMAFIGNFSESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVRDKYLQVALFYNEIHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNVMLKEFIQNSEVRLKKLQDDAKISQDAFDDVVKYFGENPKTTPP 801          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Match: cat.1 (catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-5918489])

HSP 1 Score: 248.44 bits (633), Expect = 1.024e-67
Identity = 163/458 (35.59%), Postives = 262/458 (57.21%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS-LEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE +   L+ +KFE +FK    G +I    D      KTS+R   K TLL+ ++ + L + L+   +    S+ +CK+I   ++    V+  + ++  LPT  +VK  R+YE   K P+  L+DEDR ++   KVERL Q++ ++ ++ NF E  + L  ++  V  AS++V+SS KLKQ+LE+ILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   I + K+  ++ F +E+ FVE+A+ + +E +  DV  L  GM  +R E + + N    L+ F   NE     L K A  A+E +     +FGE      P VFF +F RF +++K++ LE+  +++ + ++   +  +E  K  PK      +  Q+ L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:  502 IKKPIKTKFRLPVFNWTALKPNQISGTVFNDLDDERILQDLDMDKFEELFKTKAQGPAI----DLTCPKNKTSQRSASKVTLLEANRAKNLAITLR---KAGRSSEEICKAIQTFDLRTLPVDFVECLVRFLPTEAEVKLLRQYERERK-PLEDLSDEDRFMMLFSKVERLSQRMSIMTFLGNFNENLQLLTPQLNAVIAASVSVKSSPKLKQMLEVILALGNYMNSSKRGSVYGFKLQSLDLLQDTKSTDRKLTLLNYIALIAKEKYSEVATFYNELHFVEKAAAVSLENVLLDVKELGKGMDLIRKESHHHDNT--FLRNFVSSNEGKLDKLQKDARTAEEAYAAVVLYFGENPKTTPPSVFFPVFARFIKSYKEAELENEMRKKQEEVLREKMLAQEAKKLDPKSPVQKNKRQQQDLIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTA 948          

HSP 2 Score: 216.083 bits (549), Expect = 5.910e-57
Identity = 155/430 (36.05%), Postives = 231/430 (53.72%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNN--GLEVLLDYMS--KTLVLFLNINYKN-----IETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQ-------NSKDSVN-----ESVKNS--------LHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLE----HEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQ 1425
            S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLNN+  GL+VL++Y+S  +  V+F     +N     +E  K  +   +   H +S     +   N  A   R+S +   F        + K S N     +++KNS        +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E+ RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL+DF  K +    ++L  Q+ AY  N  DV  LLED+ETK   L   E+LE    HE Y N       +  I  EK E  Q +  L+     Q
Sbjct:   16 SMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPGVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNNDNKGLDVLVEYLSFAQCAVMFDFEGLENGEDGLVEKSKPWSRSIEDLQHPNSLPTPFA---NGLARSARQSVLRYVFVFCSVPSLSPKSSYNTLPGKKALKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKETHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLGLEDFLEKAKHTESEKLLVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEQLSHETYENANHQVHTLRRIIKEKEEAFQHLRQLEQANTSQ 432          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Match: cat.1 (catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-5918489])

HSP 1 Score: 248.44 bits (633), Expect = 1.051e-67
Identity = 163/458 (35.59%), Postives = 262/458 (57.21%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS-LEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE +   L+ +KFE +FK    G +I    D      KTS+R   K TLL+ ++ + L + L+   +    S+ +CK+I   ++    V+  + ++  LPT  +VK  R+YE   K P+  L+DEDR ++   KVERL Q++ ++ ++ NF E  + L  ++  V  AS++V+SS KLKQ+LE+ILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   I + K+  ++ F +E+ FVE+A+ + +E +  DV  L  GM  +R E + + N    L+ F   NE     L K A  A+E +     +FGE      P VFF +F RF +++K++ LE+  +++ + ++   +  +E  K  PK      +  Q+ L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:  487 IKKPIKTKFRLPVFNWTALKPNQISGTVFNDLDDERILQDLDMDKFEELFKTKAQGPAI----DLTCPKNKTSQRSASKVTLLEANRAKNLAITLR---KAGRSSEEICKAIQTFDLRTLPVDFVECLVRFLPTEAEVKLLRQYERERK-PLEDLSDEDRFMMLFSKVERLSQRMSIMTFLGNFNENLQLLTPQLNAVIAASVSVKSSPKLKQMLEVILALGNYMNSSKRGSVYGFKLQSLDLLQDTKSTDRKLTLLNYIALIAKEKYSEVATFYNELHFVEKAAAVSLENVLLDVKELGKGMDLIRKESHHHDNT--FLRNFVSSNEGKLDKLQKDARTAEEAYAAVVLYFGENPKTTPPSVFFPVFARFIKSYKEAELENEMRKKQEEVLREKMLAQEAKKLDPKSPVQKNKRQQQDLIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTA 933          

HSP 2 Score: 197.978 bits (502), Expect = 3.404e-51
Identity = 150/484 (30.99%), Postives = 234/484 (48.35%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMR---PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNN--GLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            MG+  S   P       G   L ++   P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK         P+  L             WV +FLNN+  GL+VL++Y+S      +   Y  +  KK L                                        K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E+ RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL+DF  K +    ++L  Q+ AY  N  DV  LLED+ETK   L   E+LE +     EK    ++ +ENE    +  +  L+     ++KE   L+E      +          ++++L++++ EK   F
Sbjct:    1 MGNAESAGGP------PGTALLPLKVPMPEPGELEERFAMVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPGVTRKG--------PLFFLVCR----------WVREFLNNDNKGLDVLVEYLSFAQCAVI---YNTLPGKKAL----------------------------------------KNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKETHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLGLEDFLEKAKHTESEKLLVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEQLSHMTEK----LLDLENEN---IMRVAELEKTLLHREKELTVLKETYENANH----------QVHTLRRIIKEKEEAF 391          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Match: cat.1 (catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-5918489])

HSP 1 Score: 248.44 bits (633), Expect = 1.591e-67
Identity = 163/458 (35.59%), Postives = 262/458 (57.21%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS-LEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE +   L+ +KFE +FK    G +I    D      KTS+R   K TLL+ ++ + L + L+   +    S+ +CK+I   ++    V+  + ++  LPT  +VK  R+YE   K P+  L+DEDR ++   KVERL Q++ ++ ++ NF E  + L  ++  V  AS++V+SS KLKQ+LE+ILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   I + K+  ++ F +E+ FVE+A+ + +E +  DV  L  GM  +R E + + N    L+ F   NE     L K A  A+E +     +FGE      P VFF +F RF +++K++ LE+  +++ + ++   +  +E  K  PK      +  Q+ L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:  542 IKKPIKTKFRLPVFNWTALKPNQISGTVFNDLDDERILQDLDMDKFEELFKTKAQGPAI----DLTCPKNKTSQRSASKVTLLEANRAKNLAITLR---KAGRSSEEICKAIQTFDLRTLPVDFVECLVRFLPTEAEVKLLRQYERERK-PLEDLSDEDRFMMLFSKVERLSQRMSIMTFLGNFNENLQLLTPQLNAVIAASVSVKSSPKLKQMLEVILALGNYMNSSKRGSVYGFKLQSLDLLQDTKSTDRKLTLLNYIALIAKEKYSEVATFYNELHFVEKAAAVSLENVLLDVKELGKGMDLIRKESHHHDNT--FLRNFVSSNEGKLDKLQKDARTAEEAYAAVVLYFGENPKTTPPSVFFPVFARFIKSYKEAELENEMRKKQEEVLREKMLAQEAKKLDPKSPVQKNKRQQQDLIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTA 988          

HSP 2 Score: 225.328 bits (573), Expect = 6.197e-60
Identity = 164/493 (33.27%), Postives = 264/493 (53.55%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMR---PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNN--GLEVLLDYMS--KTLVLFLNINYKN-----IETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA--SIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            MG+  S   P       G   L ++   P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLNN+  GL+VL++Y+S  +  V+F     +N     +E  K  +   +   H +S     +      A  S+ R +++  K +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E+ RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL+DF  K +    ++L  Q+ AY  N  DV  LLED+ETK   L   E+LE +     EK    ++ +ENE    +  +  L+     ++KE   L+E      +          ++++L++++ EK   F
Sbjct:    1 MGNAESAGGP------PGTALLPLKVPMPEPGELEERFAMVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPGVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNNDNKGLDVLVEYLSFAQCAVMFDFEGLENGEDGLVEKSKPWSRSIEDLQHPNSLPTPFANGLARSARQSVLRYNTLPGK-KALKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKETHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLGLEDFLEKAKHTESEKLLVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEQLSHMTEK----LLDLENEN---IMRVAELEKTLLHREKELTVLKETYENANH----------QVHTLRRIIKEKEEAF 459          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Match: Fmnl3 (formin-like 3 [Source:MGI Symbol;Acc:MGI:109569])

HSP 1 Score: 439.113 bits (1128), Expect = 1.234e-135
Identity = 343/1012 (33.89%), Postives = 540/1012 (53.36%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L   +   +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L      L+ +            LTE   P +  +L    P + +LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ ++FE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+  L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:   29 PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPNVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPNALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVHTLRRLIKEKEEAFQRRCHLEPSARGLESMGGEALARVGPTELTEGIPPSDLDLLAPAPPTEETLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQINGTVFSELDDEKILEDLDLDRFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPELANFWQELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITVLKSVPFTA 1007          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Match: Fmnl3 (formin-like 3 [Source:MGI Symbol;Acc:MGI:109569])

HSP 1 Score: 438.728 bits (1127), Expect = 2.088e-135
Identity = 331/952 (34.77%), Postives = 516/952 (54.20%), Query Frame = 1
Query:  181 GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIIL 2910
            G+  M P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L   +   +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L      L+ +            LTE   P +  +L    P + +LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ ++FE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+  L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++
Sbjct:   24 GKTPM-PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPNVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPNALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVHTLRRLIKEKEEAFQRRCHLEPSARGLESMGGEALARVGPTELTEGIPPSDLDLLAPAPPTEETLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQINGTVFSELDDEKILEDLDLDRFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPELANFWQELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVM 942          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Match: Fmnl3 (formin-like 3 [Source:MGI Symbol;Acc:MGI:109569])

HSP 1 Score: 434.491 bits (1116), Expect = 2.632e-134
Identity = 320/935 (34.22%), Postives = 496/935 (53.05%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIIL 2910
            P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S       ++ Y  +  ++ L                                        K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L      L+ +            LTE   P +  +L    P + +LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ ++FE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+  L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++
Sbjct:   29 PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPNVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQC---SVMYSTLPGRRAL----------------------------------------KNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVHTLRRLIKEKEEAFQRRCHLEPSARGLESMGGEALARVGPTELTEGIPPSDLDLLAPAPPTEETLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQINGTVFSELDDEKILEDLDLDRFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPELANFWQELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVM 891          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Match: Fmnl2 (formin-like 2 [Source:MGI Symbol;Acc:MGI:1918659])

HSP 1 Score: 236.498 bits (602), Expect = 1.473e-63
Identity = 168/493 (34.08%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKF-INSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA----SIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            MG+  S  + Q  F  ++   +L M P   + E+R+   + ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   +++++E+  T+    D     S S     +  N  +    S+ R       R + +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+  QFINIVVHS ED+N RV+LQ EFT LGLD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +  +  + +D ++   ++ + +  TLR+ + E   +  R+  L  +I+ L+K
Sbjct:    1 MGNAGSMDSQQTDFKAHNVPLKLPM-PEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTF---DFESVES--TMESTVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEK 477          

HSP 2 Score: 225.328 bits (573), Expect = 5.437e-60
Identity = 151/415 (36.39%), Postives = 250/415 (60.24%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE 2928
            VF  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE IFK    G +I    D + S +K +++   K TLL+ ++ + L + L+   +    +D +CK+I+  ++    V+  + ++  LPT ++VK  R YE   K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+Q ++ F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F   NE     L + A  A++ F    ++FGE      P VFF +F RF + +K++ E  ++RK++ Q+++  ++  E
Sbjct:  571 VFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAI----DLSSSKQKITQKASSKVTLLEANRAKNLAITLRKAGKS---ADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERK-PLENLSDEDRFMMQFSKIERLLQKMTIMAFIGNFTESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYQQVTLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNTLLKEFLLHNEGKLKKLQEDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQE 971          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Match: Fmnl2 (formin-like 2 [Source:MGI Symbol;Acc:MGI:1918659])

HSP 1 Score: 236.498 bits (602), Expect = 2.013e-63
Identity = 168/493 (34.08%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKF-INSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA----SIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            MG+  S  + Q  F  ++   +L M P   + E+R+   + ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   +++++E+  T+    D     S S     +  N  +    S+ R       R + +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+  QFINIVVHS ED+N RV+LQ EFT LGLD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +  +  + +D ++   ++ + +  TLR+ + E   +  R+  L  +I+ L+K
Sbjct:    1 MGNAGSMDSQQTDFKAHNVPLKLPM-PEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTF---DFESVES--TMESTVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEK 477          

HSP 2 Score: 225.713 bits (574), Expect = 6.989e-60
Identity = 151/415 (36.39%), Postives = 250/415 (60.24%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE 2928
            VF  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE IFK    G +I    D + S +K +++   K TLL+ ++ + L + L+   +    +D +CK+I+  ++    V+  + ++  LPT ++VK  R YE   K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+Q ++ F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F   NE     L + A  A++ F    ++FGE      P VFF +F RF + +K++ E  ++RK++ Q+++  ++  E
Sbjct:  605 VFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAI----DLSSSKQKITQKASSKVTLLEANRAKNLAITLRKAGKS---ADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERK-PLENLSDEDRFMMQFSKIERLLQKMTIMAFIGNFTESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYQQVTLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNTLLKEFLLHNEGKLKKLQEDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQE 1005          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Match: sp|Q8IVF7|FMNL3_HUMAN (Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3)

HSP 1 Score: 445.662 bits (1145), Expect = 3.797e-137
Identity = 346/1018 (33.99%), Postives = 544/1018 (53.44%), Query Frame = 1
Query:  181 GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            G++ M P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L       +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L   +  L+ V            L+E   P +  +L    P +  LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ +KFE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+ +L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:   24 GKMPM-PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPSVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPSALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSHQVHTLRRLIKEKEEAFQRRCHLEPNVRGLESVDSEALARVGPAELSEGMPPSDLDLLAPAPPPEEVLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQISGTVFSELDDEKILEDLDLDKFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPDLANFWHELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITVLKSVPFTA 1007          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Match: sp|Q6ZPF4|FMNL3_MOUSE (Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2)

HSP 1 Score: 439.113 bits (1128), Expect = 8.635e-135
Identity = 343/1012 (33.89%), Postives = 540/1012 (53.36%), Query Frame = 1
Query:  199 PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKK-----TLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRS----SVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE--------KTELLQI---IDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKV------------LTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVP-TEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  +++       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+S  +  V+F   +++ +E+        L   S +   L   +   +   N  A   R+S    S +   +  K+S   S K+ +H  + C+RAI+N Q G  +   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +LAAF+ FKE+  E  RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGL++F +K      ++L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE        + +LLQ    ++S+K   E    +  TLR  I E   +  R   L      L+ +            LTE   P +  +L    P + +LPL     PP P  PPP     P   P P   P  V  +G  A       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + + L+ ++FE +FK    G ++    D   S  KT+++   K TLL+ ++ + L + L+   +    ++ +C++I+  ++    V+  + ++  LPT  +VK  R+YE  ++ P+  L  EDR +L   KVERL Q++  + ++ NF +  + L  ++  +  AS +V+SSQKLKQ+LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ F    V+ K+  L++F  E+ FVE+A+ + +E +  DV  L  GM+ +R E  C+ +    L+ F   NE     L + A  A+E +     +FGE      P VFF +F RF  ++K++ ++   R+ Q  ++      +E  K   K  +   +  Q++L  E R++  + +    +   DG ++DI+  L   P  A
Sbjct:   29 PEPCELEERFALVLSSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLQSFLDPNVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENKGLDVLVDYLSFAQCSVMF---DFEGLESGDDGAFDKLRSWSRSIEDLQPPNALSAPFTNSLARSARQSVLRYSTLPGRRALKNSRLVSQKDDVHVCILCLRAIMNYQYGFNLVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILAAFDNFKEVCKELHRFEKLMEYFRN------EDSNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLEEFLQKSRHTESEKLQVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHVSHLTEK----LLDLENENMMRVAELEKQLLQREKELESIKETYENTSNQVHTLRRLIKEKEEAFQRRCHLEPSARGLESMGGEALARVGPTELTEGIPPSDLDLLAPAPPTEETLPLPPPPAPPLPPPPPPLPDKCPPAPPLPGAAPSVVLTVGLSAIR-----IKKPIKTKFRLPVFNWTALKPNQINGTVFSELDDEKILEDLDLDRFEELFKTKAQGPAL----DLICSKNKTAQKAASKVTLLEANRAKNLAITLR---KAGRSAEEICRAIHTFDLQTLPVDFVECLMRFLPTEAEVKLLRQYE-RERQPLEELAAEDRFMLLFSKVERLTQRMAGMAFLGNFQDNLQMLTPQLNAIIAASASVKSSQKLKQMLEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKMTLLHFIALTVKEKYPELANFWQELHFVEKAAAVSLENVLLDVKELGRGMELIRRE--CSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQELIAELRRRQAKEHRPVYE-GKDGTIEDIITVLKSVPFTA 1007          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Match: sp|Q6NXC0|FMNL3_DANRE (Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2)

HSP 1 Score: 240.35 bits (612), Expect = 5.759e-64
Identity = 159/465 (34.19%), Postives = 266/465 (57.20%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQ-SIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++D+ + ++L+ EKFE +FK    G      VD + S  K S++   K  LLD ++ + L + L+  ++    ++ +CK+I   ++    V+  + ++  LPT  + K  R+YE  ++ P++ L +EDR +L   K+ERL Q++ ++ ++ NF +    L  ++  +  AS +V+SS KLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   +V+ K+  L++F +E+ FV++A+ + +E +  DV  L  GM  VR E  C+ +    LK F + ++     L+K A  A+E F     +FGE      P VFF +F RF   +K+++E+  +R+ Q   +   +  +E  +  PK +       Q++L  E R++  + +    +   DG ++DI+  L   P  A    + S
Sbjct:  580 IKKPIKTKFRLPVFNWTALKPNQINGTVFNEIDDDRVLEELDLEKFEELFKTKAQGPV----VDLSCSKSKVSQKVINKVQLLDANRSKNLAITLRKANKT---TEEICKAIQTFDLKALPVDFVECLMRFLPTEAESKLLRQYE-RERRPLDQLAEEDRFMLLFSKIERLTQRMSIITFVGNFNDNVNMLTPQLNAIIAASASVKSSPKLKKILEIILALGNYMNSSKRGSVYGFKLQSLDLLLDTKSTDRKMTLLHYIALVVKEKYPELANFYNELHFVDKAAAVSLENVLLDVKELGKGMDLVRRE--CSLHDHAVLKGFAQTSDTQLDKLAKDAKTAEEAFNNVVLYFGESPKTTPPSVFFPVFVRFIRAYKEAVEENEQRKKQEEAMREKLLAQEAKQHDPKVQAQKKRHQQQELIAELRRRQAKDHRPVYE-GKDGTIEDIITVLKSVPFTARTAKRGS 1033          

HSP 2 Score: 239.58 bits (610), Expect = 1.098e-63
Identity = 161/485 (33.20%), Postives = 261/485 (53.81%), Query Frame = 1
Query:  166 INSGEGRLEMR----------PTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNS--------LHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            I S +G+ EM+          P   + E+R+   + S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  ++     K  RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL++L++Y+S      + ++++ +E  +  +L    K    S  +    +  C   ++     V ++ ++ +S  +++KNS        +H  + C+RAI+N Q G  +   H+ A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E  RF+ L+ YFR       +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGLDDF  K +    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE    +  +  L+ Q   +DKE   ++E                 ++++L++++ EK+  F
Sbjct:    4 IESVDGQSEMKHHIMPLKVPMPDPTELEERFAIVLNSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLRGYLDPKVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENRGLDILVEYLSFAQCAVM-LDFEGLENGEDFSLD---KAKSWSRSIEDLHQNGCNTLVRSARQSVLRYGSTSNS--KTIKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNLVMSHAHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKEKHRFEKLMEYFRS------EDGNIDFMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLDDFLEKSKHTESDKLSVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEEHLSHVTEK----LLDVENET---MTKVADLEKQLLHKDKELAVIKETYESAST----------QVHTLRRMIQEKDAAF 455          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Match: sp|A2APV2|FMNL2_MOUSE (Formin-like protein 2 OS=Mus musculus OX=10090 GN=Fmnl2 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 1.408e-62
Identity = 168/493 (34.08%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKF-INSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA----SIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            MG+  S  + Q  F  ++   +L M P   + E+R+   + ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   +++++E+  T+    D     S S     +  N  +    S+ R       R + +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+  QFINIVVHS ED+N RV+LQ EFT LGLD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +  +  + +D ++   ++ + +  TLR+ + E   +  R+  L  +I+ L+K
Sbjct:    1 MGNAGSMDSQQTDFKAHNVPLKLPM-PEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTF---DFESVES--TMESTVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEK 477          

HSP 2 Score: 225.713 bits (574), Expect = 4.889e-59
Identity = 151/415 (36.39%), Postives = 250/415 (60.24%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE 2928
            VF  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE IFK    G +I    D + S +K +++   K TLL+ ++ + L + L+   +    +D +CK+I+  ++    V+  + ++  LPT ++VK  R YE   K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+Q ++ F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F   NE     L + A  A++ F    ++FGE      P VFF +F RF + +K++ E  ++RK++ Q+++  ++  E
Sbjct:  605 VFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAI----DLSSSKQKITQKASSKVTLLEANRAKNLAITLRKAGKS---ADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERK-PLENLSDEDRFMMQFSKIERLLQKMTIMAFIGNFTESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYQQVTLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNTLLKEFLLHNEGKLKKLQEDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQE 1005          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Match: sp|Q96PY5|FMNL2_HUMAN (Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3)

HSP 1 Score: 235.728 bits (600), Expect = 2.375e-62
Identity = 168/493 (34.08%), Postives = 272/493 (55.17%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKF-INSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCA----SIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            MG+  S  + Q  F  ++   +L M P   + E+R+   + ++++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   +++++E+  T+    D     S S     +  N  +    S+ R       R + +   +  K+S   S K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ +FR+      +D NIDFMV+  QFINIVVHS ED+N RV+LQ EFT LGLD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +  +  + +D ++   ++ + +  TLR+ + E   +  R+  L  +I+ L+K
Sbjct:    1 MGNAGSMDSQQTDFRAHNVPLKLPM-PEPGELEERFAIVLNAMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKGYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTF---DFESVES--TVESSVDKSKPWSRSIEDLHRGSNLPSPVGNSVSRSGRHSALRYNTLPSRRTLKNSRLVSKKDDVHVCIMCLRAIMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFEKLMEHFRN------EDNNIDFMVASMQFINIVVHSVEDMNFRVHLQYEFTKLGLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEK 477          

HSP 2 Score: 227.254 bits (578), Expect = 1.327e-59
Identity = 165/475 (34.74%), Postives = 274/475 (57.68%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTEE-TPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            VF  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE IFK    G +I    D + S +K  ++   K TLL+ ++ + L + L+   +    +D +CK+I+  ++    V+  + ++  LPT ++VK  R YE   K P+  L+DEDR ++   K+ERL QK+ ++ +I NF E+ + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V+ K+  +S F +E+ +VE+A+ + +E +  DV  L  GM   + E   + +    LK+F  +NE     L   A  A++ F    ++FGE      P VFF +F RF + +K++ E  ++RK++ Q+++  ++  E    +  PK  +   +  Q++L  E R++  + N    +   DG ++DI+  L   P  A
Sbjct:  606 VFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEIFKTKAQGPAI----DLSSSKQKIPQKGSNKVTLLEANRAKNLAITLRKAGKT---ADEICKAIHVFDLKTLPVDFVECLMRFLPTENEVKVLRLYERERK-PLENLSDEDRFMMQFSKIERLMQKMTIMAFIGNFAESIQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVKEKYHQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYTMH-DHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYE-GKDGAIEDIITVLKTVPFTA 1065          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Match: I0AYW0 (Dishevelled-associated activator of morphogenesis 1 OS=Schmidtea mediterranea OX=79327 GN=DAAM1 PE=2 SV=1)

HSP 1 Score: 1885.92 bits (4884), Expect = 0.000e+0
Identity = 1003/1010 (99.31%), Postives = 1003/1010 (99.31%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 3153
            MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEK  DTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMR ILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQL VSVEV DRILYQLPTNDD KTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAK KDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF
Sbjct:    1 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKXXDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRTILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLXVSVEVXDRILYQLPTNDDXKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKXKDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 1010          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Match: G4M1J2 (Formin-like OS=Schistosoma mansoni OX=6183 GN=Smp_144430 PE=4 SV=1)

HSP 1 Score: 745.347 bits (1923), Expect = 0.000e+0
Identity = 461/1033 (44.63%), Postives = 657/1033 (63.60%), Query Frame = 1
Query:  211 QFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPV-HVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYK----NIETKKTL---NLQSDTKTHXXXXXXXXXXXXNC-----CASIKRRSSVVTKFQNSK-DSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEE-------QDKEYRTLREQI-SEPRNSTDREK-------ELVLEINSLKKVLTEKNIPFNSSVLTEL-SPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGAT--NTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKL--------NPVG-DSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDE--MNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRA----QSI------------ILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNL 3132
            ++E +W  FIQSLDV P+  + I+QL  DQK QLL N+  KNPK+SAFHYV+LIK L+ G+S      +K D      +L ATE+SLRTNNV WVYDFL+  GLE L++Y+S+ + + +  +++     I+ +++    +L SD    ++      ++         C+S++++      F      ++++S+++SLHQG++C RA+LNNQRGC M F H  A++VIALCLLHP+YQTKTLVLE L  +CLI  G ++VL AF+ FK+  GES RF+ LI YF  HE+ +  DYN+DFMVSC QF NIVVHS +DI LRVYLQ+EF  LGL ++  ++  +SGDRL +Q+ AYN N VDVA+LLEDS+ ++ +  + E+ E +    + +  T     EN+  +L Q I +L+ + ++       QD +  TLR Q+  + +++T+RE+       EL   +N++K    +  I  N  V   + S N +S+  +  + PPPP  PPPP  PPP  +      PP     G GA     +  SIRPPIQT+YKLP+ NW +LKNQQL+GT+FV MNDE + D L+ EKFEN+FKL        N  G +++ NG+D  DS  + SK K EKK+L+D ++HRC+GVLL++L+ EK   + L   IN+LE+  +V DRI +QLPT+D++KTY  YE++++  I+ LTDEDRLLL LCKVERL  +LE+++++++F +    +  K+  V  ASLA+++S K + ILEIILA+GN MNSSRRGI YGFRLQSLD L+DT++LDKSWTL+ F V+ +E++F  L +F DE+  V +A+K+P EA+T DVA+LV GM Q   E  +  +   P RL  F  +N+     + K A  A+  F +  EWFGE Q  P+P+ FF +  RF +NFK ++ D   RR     QS+             +N +     PK +PKD ++ + ELQK+LA EAR   RR  NRTRQI  DG+MD+ILAGL   PLQAE+HP R+ L
Sbjct:    8 KYEDQWANFIQSLDVDPDKAKGIEQLPDDQKRQLLENYAVKNPKFSAFHYVSLIKGLRVGRSTLTKNPRKGDAQQAKEILLATEISLRTNNVAWVYDFLDQEGLEALVNYVSRVIHMVMRTDFRPTVDAIQQQRSALLGSLSSDQAVSITDLCDNINESDKVGSGLWCSSLRKKKHDRISFSPIHVRNISDSIRDSLHQGVRCFRALLNNQRGCSMVFEHPHAVNVIALCLLHPSYQTKTLVLELLTVVCLITGGHERVLNAFDNFKKEVGESTRFEYLIHYFFTHES-ESSDYNMDFMVSCMQFFNIVVHSTDDIMLRVYLQEEFKHLGLVNYLSRIYNQSGDRLLRQIEAYNDNEVDVAVLLEDSQMRDILQQEKEQAESDLIILQTRTATIQAEYENKLLQLQQNIQALEIKNQDLENQCTNQDGQLSTLRAQLLDKDKSTTERERNLQQRLRELEDTLNTVKNSQLKSQIQVNGIVDNSIESVNTTSVISSGANAPPPPPPPPPPPLPPPPPSAGGIPPPPPPPPPGMGAMVPGAEGVSIRPPIQTRYKLPLVNWVLLKNQQLRGTIFVGMNDEAVLDALDTEKFENLFKLSNQSVNNSNKSGVNNLANGLDQKDS--RISK-KVEKKSLMDPNRHRCIGVLLRYLESEKYTPERLWNDINRLELGQDVTDRIYHQLPTSDEMKTYLNYEFTEQRSIDDLTDEDRLLLHLCKVERLGPRLEIILFMNSFEDNLNVVNSKIIAVRSASLALKNSCKFRAILEIILAFGNYMNSSRRGIAYGFRLQSLDALSDTRTLDKSWTLLHFIVETIETQFPALVNFDDELTGVVEAAKVPTEALTNDVAALVSGMSQADKETIIFGSLKTPQRLSDFVFNNKLKVESIEKEAEIARNMFARTIEWFGEAQIKPSPEQFFSLIVRFIKNFKNAIVDNEARRRVEALQSLNSVTGDDNGPLSSINQISINHIPK-RPKD-DVPISELQKRLAQEARLAKRRFKNRTRQITGDGMMDEILAGLISEPLQAEVHPHRNRL 1034          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Match: A0A074ZXZ8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01552 PE=4 SV=1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 456/1042 (43.76%), Postives = 663/1042 (63.63%), Query Frame = 1
Query:  148 TPQYKFINSGE--GRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKS-IRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIET---KKTLNLQS-DTKTHXXXXXXXXXXXXNCCASIK--RRSSVVTKFQNSKD---------SVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFK-VDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKA-------QKEEQDKEYRTLREQIS-EPRNSTDREKELVLEINSLKKVLTE----KNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNP--VGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDE--MNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSL-EDVRKRRAQSI-ILNIV------PTEET------PKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            TP++   +  E   R+     N  F+K W +FIQSLDVGPE  + I+QL  DQK  LL ++ +KNPK SAFHYV+LIK L+ G+S + K+  +        VL ATE+SLRTNNV WVY+FL+ NGL+VL+ Y+SK + + +  N  +  +      + L+S D+   +S S      K N   S+   RR +   +F   +           +++S+++SLHQ +KC RA+LNNQRGC M F H RAI+VI LCLLHP+ QTK+LVLE LAA+CLI+ G ++V+ AF+ FK   GE +RF++L+ YF  HET    D+YN+DFMVSC QF NIVVHS +DI LRVYLQ+EF  LGL  F ++L  R+ DRL +Q+ AYN N VDVA+LLEDS+ +E    + E+ E E +A + +  +     E +  EL   +D+L++       Q E Q  +  TL+ ++  + R++TDREK L   I  L++ ++      + P ++ ++   +P  +S P     PPPPP        PPP         PP    LG   +  +   IRPPIQT++KLP+ NW+VL++QQL+GTVFV MNDE + + ++ ++ E++FKL+   VG    +G+++  S  K +KR  EKK+L+D ++HRC+GVLL+FL+ EK   + L   I +LE+S +VADRI +QLPT D++KTY +YE++D+L ++ LTDEDRLLL LCK+ERL  +LE+++++++F ++  +L  K+  V+  SLA++ S++ + ILE++LA+GN +NSSRRGI YGFRLQSLD+L DTKS+DKSWTL+ + VD ++++F  L  F +    +  A+K+PMEA+T+DV +LV G+ Q   E  +    N P RL +F E N+     + + A  AK  F Q  EWFGE QN P+P+ FFG+  RF ENFKK++ E+ ++ R  ++ +L  V      PT +T      P  K KD N+   +LQ++LA EAR   RR+ NRTRQI  DG+MD+ILAGL   PLQ E+HP+R+
Sbjct:   90 TPKFGLPDCRERFARVMENEENEIFQKNWASFIQSLDVGPEKAKGIEQLPADQKRHLLESYVTKNPKCSAFHYVSLIKGLRVGRSTLSKNSRRSEGQHAKEVLMATEISLRTNNVGWVYEFLDQNGLDVLVTYVSKVIHMLIRSNIGSDSSDMEPPMIPLESFDSTETISRSLPSSRPKANSLRSLWCIRRPADGDEFGRRRSLNRPSRFTLQLSDSIRDSLHQAVKCFRALLNNQRGCSMVFDHPRAINVITLCLLHPSTQTKSLVLELLAAVCLIIGGHERVIKAFDNFKREVGEFQRFESLVHYFFTHETSSPADEYNVDFMVSCIQFFNIVVHSTDDIMLRVYLQEEFRHLGLVLFLQRLHNRASDRLVRQIEAYNDNEVDVAMLLEDSQARELYQQELEQRETEMFALQTRLGSIQTEHEAKTAELQATLDALQSRCAELEGQHEAQIGQLNTLQSRLKDQDRSATDREKILEARIQELEETISRTKSTADRPTSAKLVNGDAPEIASPPPPPPPPPPPPPPLLSSGIPPPPPPVMGGMPPPPP-GLGQVPSGVEAVPIRPPIQTRFKLPLVNWTVLRSQQLRGTVFVGMNDEEVLNHIDTKRLEDLFKLSTQTVGTDSIDGLENGQS--KPAKRL-EKKSLVDTNRHRCIGVLLRFLESEKYTRERLWSDITRLELSQDVADRIYHQLPTQDEMKTYLKYEFTDQLNVDDLTDEDRLLLHLCKIERLGTRLEIILFMNSFEDSVATLTPKIAAVSSVSLALKQSERFRAILELVLAFGNYINSSRRGIAYGFRLQSLDVLVDTKSVDKSWTLLHYIVDTIQTRFPALITFYESFGDIATAAKVPMEALTSDVNALVSGLAQADRETIVAGPMNTPDRLIQFIEKNKPRVEAIHQRAERAKTLFAQTVEWFGEAQNKPSPEQFFGLILRFVENFKKAVAENEKRHRMDALQMLQAVTAGHNGPTLQTAHALGVPPKKSKDYNIP--DLQRQLASEARNVKRRLKNRTRQITGDGMMDEILAGLISEPLQVEVHPRRA 1125          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Match: A0A3Q0KNX0 (Formin-like OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 461/1044 (44.16%), Postives = 656/1044 (62.84%), Query Frame = 1
Query:  211 QFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPV-HVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNI---------------NYKNIETKKTL---NLQSDTKTHXXXXXXXXXXXXNC-----CASIKRRSSVVTKFQNSK-DSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEE-------QDKEYRTLREQI-SEPRNSTDREK-------ELVLEINSLKKVLTEKNIPFNSSVLTEL-SPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGAT--NTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKL--------NPVG-DSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDE--MNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRA----QSI------------ILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNL 3132
            ++E +W  FIQSLDV P+  + I+QL  DQK QLL N+  KNPK+SAFHYV+LIK L+ G+S      +K D      +L ATE+SLRTNNV WVYDFL+  GLE L++Y+S+ + + +++                   I+ +++    +L SD    ++      ++         C+S++++      F      ++++S+++SLHQG++C RA+LNNQRGC M F H  A++VIALCLLHP+YQTKTLVLE L  +CLI  G ++VL AF+ FK+  GES RF+ LI YF  HE+ +  DYN+DFMVSC QF NIVVHS +DI LRVYLQ+EF  LGL ++  ++  +SGDRL +Q+ AYN N VDVA+LLEDS+ ++ +  + E+ E +    + +  T     EN+  +L Q I +L+ + ++       QD +  TLR Q+  + +++T+RE+       EL   +N++K    +  I  N  V   + S N +S+  +  + PPPP  PPPP  PPP  +      PP     G GA     +  SIRPPIQT+YKLP+ NW +LKNQQL+GT+FV MNDE + D L+ EKFEN+FKL        N  G +++ NG+D  DS  + SK K EKK+L+D ++HRC+GVLL++L+ EK   + L   IN+LE+  +V DRI +QLPT+D++KTY  YE++++  I+ LTDEDRLLL LCKVERL  +LE+++++++F +    +  K+  V  ASLA+++S K + ILEIILA+GN MNSSRRGI YGFRLQSLD L+DT++LDKSWTL+ F V+ +E++F  L +F DE+  V +A+K+P EA+T DVA+LV GM Q   E  +  +   P RL  F  +N+     + K A  A+  F +  EWFGE Q  P+P+ FF +  RF +NFK ++ D   RR     QS+             +N +     PK +PKD ++ + ELQK+LA EAR   RR  NRTRQI  DG+MD+ILAGL   PLQAE+HP R+ L
Sbjct:    8 KYEDQWANFIQSLDVDPDKAKGIEQLPDDQKRQLLENYAVKNPKFSAFHYVSLIKGLRVGRSTLTKNPRKGDAQQAKEILLATEISLRTNNVAWVYDFLDQEGLEALVNYVSRVIHMVMSLKRFRKCSVLSTDFRPTVDAIQQQRSALLGSLSSDQAVSITDLCDNINESDKVGSGLWCSSLRKKKHDRISFSPIHVRNISDSIRDSLHQGVRCFRALLNNQRGCSMVFEHPHAVNVIALCLLHPSYQTKTLVLELLTVVCLITGGHERVLNAFDNFKKEVGESTRFEYLIHYFFTHES-ESSDYNMDFMVSCMQFFNIVVHSTDDIMLRVYLQEEFKHLGLVNYLSRIYNQSGDRLLRQIEAYNDNEVDVAVLLEDSQMRDILQQEKEQAESDLIILQTRTATIQAEYENKLLQLQQNIQALEIKNQDLENQCTNQDGQLSTLRAQLLDKDKSTTERERNLQQRLRELEDTLNTVKNSQLKSQIQVNGIVDNSIESVNTTSVISSGANAPPPPPPPPPPPLPPPPPSAGGIPPPPPPPPPGMGAMVPGAEGVSIRPPIQTRYKLPLVNWVLLKNQQLRGTIFVGMNDEAVLDALDTEKFENLFKLSNQSVNNSNKSGVNNLANGLDQKDS--RISK-KVEKKSLMDPNRHRCIGVLLRYLESEKYTPERLWNDINRLELGQDVTDRIYHQLPTSDEMKTYLNYEFTEQRSIDDLTDEDRLLLHLCKVERLGPRLEIILFMNSFEDNLNVVNSKIIAVRSASLALKNSCKFRAILEIILAFGNYMNSSRRGIAYGFRLQSLDALSDTRTLDKSWTLLHFIVETIETQFPALVNFDDELTGVVEAAKVPTEALTNDVAALVSGMSQADKETIIFGSLKTPQRLSDFVFNNKLKVESIEKEAEIARNMFARTIEWFGEAQIKPSPEQFFSLIVRFIKNFKNAIVDNEARRRVEALQSLNSVTGDDNGPLSSINQISINHIPK-RPKD-DVPISELQKRLAQEARLAKRRFKNRTRQITGDGMMDEILAGLISEPLQAEVHPHRNRL 1045          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Match: A0A3R7JKV5 (Formin-like protein OS=Clonorchis sinensis OX=79923 GN=CSKR_717s PE=4 SV=1)

HSP 1 Score: 738.799 bits (1906), Expect = 0.000e+0
Identity = 447/1017 (43.95%), Postives = 643/1017 (63.23%), Query Frame = 1
Query:  214 FEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKS-IRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIET---KKTLNLQS-DTKTHXXXXXXXXXXXXNCCASIK--RRSSVVTKFQNSKD---------SVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFK-VDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKA-------QKEEQDKEYRTLREQIS-EPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLX-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNP--VGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDE--MNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRR---AQSIILNIVPTEETPK-------AKP--KDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            F+K W +FIQSLDVGPE  + I+QL  DQK  LL ++ +KNPK SAFHYV+LIK L+ G+S + K+  +        VL ATE+SLRTNNV WVY+FL+ NGL+VL+ Y+SK + + +  N  +  +      + L+S D+   +S S      K N   S+   RR +   +F   +           +++S+++SLHQ +KC RA+LNNQRGC M F H RAI+VI LCLLHP+ QTK+LVLE LAA+CLI+ G ++V+ AF+ FK   GE +RF++L+ YF  HET    D+YN+DFMVSC QF NIVVHS +DI LRVYLQ+EF  LGL  F ++L  R+ DRL +Q+ AYN N VDVA+LLEDS+ +E    + E+ E E +A + +  +     E +  EL   +D+L++       Q E Q  +  TL+ ++  + R++TDREK L   I  L++ ++       SS  T   P  + L        +  PPPPP  P      PP   P   G PP    LG   +  +   IRPPIQT++KLP+ NW+VL++QQL+GTVFV MNDE + + ++ ++ E++FKL+   VG    + +D  ++ +    ++ EKK+L+D ++HRC+GVLL+FL+ EK   + L   I +LE+S +VADRI +QLPT D+VKTY +YE++D+L ++ LTDEDRLLL LCK+ERL  +LE+++++++F +   +L  K+  V+  SLA++ S++ + ILE++LA+GN +NSSRRGI YGFRLQSLD+L DTKS+DKSWTL+ + VD ++++F  L  F +    +  A+K+PMEA+T+DV +LV G+ Q   E  +    N P RL +F E N+     + + A  AK  F Q  EWFGE QN P+P+ FFG+  RF ENFKK++ +  KR    A  ++  +      P        A P  K K  ++ +LQ++LA EAR   RR+ NRTRQI  DG+MD+ILAGL   PLQ E+HP+R+
Sbjct:   16 FQKNWASFIQSLDVGPEKAKGIEQLPADQKRHLLESYVTKNPKCSAFHYVSLIKGLRVGRSTLSKNSRRSEGQHAKEVLMATEISLRTNNVGWVYEFLDQNGLDVLVTYVSKVIHMLIRSNTGSDSSDMEPPIIPLESFDSTETISRSLPSNRPKANSLRSLWCIRRPADGDEFGRRRSLNRPNRFTLQLSDSIRDSLHQAVKCFRALLNNQRGCSMVFDHPRAINVITLCLLHPSSQTKSLVLELLAAVCLIIGGHERVIKAFDNFKREVGEFQRFESLVHYFFTHETSSPADEYNVDFMVSCIQFFNIVVHSTDDIMLRVYLQEEFRHLGLVLFLQRLHNRASDRLVRQIEAYNDNEVDVAMLLEDSQARELYQQELEQRETEMFALQTRLGSIQTEHEAKTAELQATLDALQSRCAELEGQHEAQIGQLNTLQSRLKDQDRSATDREKVLEARIQELEETISRTK----SSNATTDRPTSAKLVNGDAPEITPPPPPPPPPPLLSSGIPPPPPPVMGGLPPPPPGLGQVPSGVEAVPIRPPIQTRFKLPLVNWTVLRSQQLRGTVFVGMNDEEVLNHIDTKRLEDLFKLSTQTVGT---DSIDGLENGQNKPAKRLEKKSLVDTNRHRCIGVLLRFLESEKYTRERLWSDITRLELSQDVADRIYHQLPTQDEVKTYLKYEFTDQLNVDDLTDEDRLLLHLCKIERLGTRLEIILFMNSFEDTVATLTPKIAAVSSVSLALKQSERFRAILELVLAFGNYINSSRRGIAYGFRLQSLDVLIDTKSVDKSWTLLHYMVDTIQTRFPALITFYESFGDIATAAKVPMEALTSDVNALVSGLAQADRETIVAGPMNTPDRLTQFIEKNKPRVEAIHQRAERAKTLFAQTVEWFGEAQNKPSPEQFFGLILRFVENFKKAVAENEKRHRMDALQMLQAVTAGHNGPTLQAAHALAVPPKKSKEYNIPDLQRQLASEARNVKRRLKNRTRQITGDGMMDEILAGLISEPLQVEVHPRRA 1025          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Match: fmnl3 (formin-like 3 [Source:NCBI gene;Acc:407694])

HSP 1 Score: 434.491 bits (1116), Expect = 1.486e-134
Identity = 318/964 (32.99%), Postives = 505/964 (52.39%), Query Frame = 1
Query:  232 TFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSV-----LTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILN-IVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAG 3081
             F  S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  ++        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL++L++Y+S      +   Y      KT+                                        K+S   S K+ +H  + C+RAI+N Q G  M   H+ A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E  RF+ L+ YFR       +D NIDFMV+C QFINIVVHS ED+N RV+LQ EFT LGLDDF  K +    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE +     EK    ++ +ENE    +  +  L+ Q  ++DK+   +RE  +    ST        ++++L++++ EK+  F         L EL   + ++ L         I             PP     PG       +       I+ PI+TK++LPVFNW+ LK  Q+ GTVF  ++DE + ++L+ EKFE +FK    G      VD + +  K S +   K  LLD ++ + L + L+  ++    ++ +CK+I   ++    V+  + ++  LPT  + K  R+YE  ++ P+  L +EDR +L   K+ERL Q++ ++ ++ NF +    L  ++  +  AS +V+SS KLK++LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   IV+ K+  L++F +E+ FV++A+ + +E +  DV  L  GM+ +R E  C+ +    LK F + ++     L K A  A+E F     +FGE      P VFF +F RF + +K ++E+  +R+ Q   L   +  +E  +  PK +     + Q +L  E R++  + +    +   DG ++DI+ G
Sbjct:   45 VFQNSMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLRGFLDPGVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENRGLDILVEYLSFAQCAVI---YGTAANNKTI----------------------------------------KNSRLVSQKDDVHVCIMCLRAIMNYQYGFNMVMSHAHAVNEIALSLNNKNSRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKEKHRFEKLMDYFR------CEDGNIDFMVACMQFINIVVHSVEDMNFRVHLQFEFTKLGLDDFLEKSKHTESDKLSVQIQAYLDNVFDVGGLLEDAETKNVALEKVEELEDQLSHVTEK----LLEVENET---VMKVAELEKQLLQKDKDLTAIRE--TYESTST--------QVHTLRRMIQEKDAAFQRHTNIEKRLLELE-QQGTIRLRKQPDGDIAIEALGGGGAECPPPPPLAPPLPGASPSVILSVGLSAIRIKKPIKTKFRLPVFNWTALKPNQINGTVFNEIDDERVLEELDLEKFEELFKTKAQGAV----VDLSCTKSKVSNKAMNKVQLLDANRSKNLAITLRKANKS---TEEICKAIQTFDLKALPVDFVECLMRFLPTEAESKLLRQYE-RERRPLEQLAEEDRFMLLFSKIERLTQRMNIITFVGNFSDNISMLTPQLNAIIAASASVKSSPKLKRMLEIILALGNYMNSSKRGSVYGFKLQSLDLLLDTKSTDRKMTLLHYIALIVKEKYPELANFFNELHFVDKAAAVSLENVLLDVKELGKGMELIRRE--CSLHDHAILKNFLQSSDQQLDKLQKDAKTAEEAFNAVVMYFGESPKTTPPSVFFPVFVRFIKAYKDAVEENEQRKKQEQALREKLLAQEAKQHDPKVQAQKKRQQQHELIAELRRRQAKDHRPVYE-GKDGAIEDIITG 926          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 395.586 bits (1015), Expect = 6.040e-120
Identity = 320/981 (32.62%), Postives = 518/981 (52.80%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK---VLTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQS------IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE--------ETPKAKPKDKNLSM-EELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAG 3081
            S+++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K+       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S        +    + +++TL                            + S +V K            K+ +H  + C+RA++N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E +RF+ L+ YF++      +D NIDFMV+C QFINIVVHS ED+N R   +  F  +  +       E   D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +     + +D+++   ++ + +  TL+  + E   +  R+  L  +I+ L+K   +  +K    + S+L       +        PPPPP  P P  A   S   PPP  P      G G+      S      I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT ++ P K TLLD ++ + L + L+ + +     + +CK+I   ++    V+  + ++  +PT  +VK  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   + E + + +    LK F + NE+    L   A  A++ F +A ++FGE      P VFF +F RF + ++++ E  + RKR+ Q ++  ++  E        ++P  K K +   +  EL+KK   ++R               DG ++DI+ G
Sbjct:   16 SMNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKSYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLS---FAQYAVTCNTLPSRRTL----------------------------KNSRLVCK------------KDDVHVCIMCLRAVMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCSEEQRFERLMEYFKN------EDNNIDFMVACMQFINIVVHSVEDMNFR-SCKHSFINIQFNK-----HEPQYDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENMSHLTEKLQDTENEAMSKIVELEKQLMHKNKELDAVREVYKDVNTQVHTLKRMVKEKDEAIQRQCNLEKKIHELEKQGTIKIQKKGDGDISILASAPSTNAIPEPPPPPPPPPPPPPLPGPALEISAPLPPPPPPMAPPLPGCGSPTVIFNSGLAAVKIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTRAQGPAI----DVTSSKQKTIQKGPNKITLLDSNRAKNLAITLRKVGKT---PEEICKAIQMFDLRTLPVDFVECLMRFIPTEPEVKALRQYEKERK-PLENLTDEDRFMMQFSKIERLMQKMTIMAFVGNFCESVQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKLTLLHYIANVVREKYQQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYSMHGHN-TLLKDFIQHNESKLKKLQDDAKIAQDAFDEAVKFFGESAKTTPPSVFFPVFVRFVKAYRQAEEENEARKRQEQLMMEKLLEQEAMMEMEDQKSPSHKNKRQQQELIAELRKKQVKDSRHVYE---------GKDGAIEDIITG 919          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 234.572 bits (597), Expect = 4.627e-63
Identity = 173/493 (35.09%), Postives = 282/493 (57.20%), Query Frame = 1
Query: 1699 VFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTEET----PKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEV 3150
            +F  G  A       I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT ++ P K TLLD ++ + L + L+ + +     + +CK+I   ++    V+  + ++  +PT  +VK  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   + E + + +    LK F + NE+    L   A  A++ F +A ++FGE      P VFF +F RF + ++++ E  + RKR+ Q ++  ++  E       +  P  KN   +  Q++L  E RKK  + +    +   DG ++DI+  L   P  A    KR +  + EE+
Sbjct:  564 IFNSGLAAV-----KIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTRAQGPAI----DVTSSKQKTIQKGPNKITLLDSNRAKNLAITLRKVGKT---PEEICKAIQMFDLRTLPVDFVECLMRFIPTEPEVKALRQYEKERK-PLENLTDEDRFMMQFSKIERLMQKMTIMAFVGNFCESVQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKLTLLHYIANVVREKYQQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYSMHGHN-TLLKDFIQHNESKLKKLQDDAKIAQDAFDEAVKFFGESAKTTPPSVFFPVFVRFVKAYRQAEEENEARKRQEQLMMEKLLEQEAMMEMEDQKSPSHKN---KRQQQELIAELRKKQVKDSRHVYE-GKDGAIEDIITVLKTVPFTART-AKRGSRFFNEEL 1037          

HSP 2 Score: 217.624 bits (553), Expect = 1.609e-57
Identity = 149/447 (33.33%), Postives = 243/447 (54.36%), Query Frame = 1
Query:  247 LDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            +++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K+       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   + +N         +S +++                 +I R       R + +   +  K+S     K+ +H  + C+RA++N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E +RF+ L+ YF++      +D NIDFMV+C QFINIVVHS ED+N RV+LQ +FT L LD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +     + +D+++   ++ + +  TL+  + E   +  R+  L  +I+ L+K
Sbjct:    1 MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKSYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDGDSIENGADNAMDKSKSWSRSIEDLHGGSNLPSPIVGNNINRAGRHSTLRCNTLPSRRTLKNSRLVCKKDDVHVCIMCLRAVMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCSEEQRFERLMEYFKN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQYDFTKLCLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENMSHLTEKLQDTENEAMSKIVELEKQLMHKNKELDAVREVYKDVNTQVHTLKRMVKEKDEAIQRQCNLEKKIHELEK 437          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 232.646 bits (592), Expect = 2.136e-62
Identity = 166/475 (34.95%), Postives = 272/475 (57.26%), Query Frame = 1
Query: 1708 LGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE--------ETPKAKPKDKNLSM-EELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDK 3090
            L  G     +  I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT ++ P K TLLD ++ + L + L+ + +     + +CK+I   ++    V+  + ++  +PT  +VK  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   + E + + +    LK F + NE+    L   A  A++ F +A ++FGE      P VFF +F RF + ++++ E  + RKR+ Q ++  ++  E        ++P  K K +   +  EL+KK   ++R               DG ++DI+  L K
Sbjct:  569 LAEGPIKLFSVKIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTRAQGPAI----DVTSSKQKTIQKGPNKITLLDSNRAKNLAITLRKVGKT---PEEICKAIQMFDLRTLPVDFVECLMRFIPTEPEVKALRQYEKERK-PLENLTDEDRFMMQFSKIERLMQKMTIMAFVGNFCESVQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKLTLLHYIANVVREKYQQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYSMHGHN-TLLKDFIQHNESKLKKLQDDAKIAQDAFDEAVKFFGESAKTTPPSVFFPVFVRFVKAYRQAEEENEARKRQEQLMMEKLLEQEAMMEMEDQKSPSHKNKRQQQELIAELRKKQVKDSRHVYE---------GKDGAIEDIITALKK 1025          

HSP 2 Score: 218.394 bits (555), Expect = 1.021e-57
Identity = 149/447 (33.33%), Postives = 243/447 (54.36%), Query Frame = 1
Query:  247 LDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            +++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K+       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   + +N         +S +++                 +I R       R + +   +  K+S     K+ +H  + C+RA++N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E +RF+ L+ YF++      +D NIDFMV+C QFINIVVHS ED+N RV+LQ +FT L LD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +     + +D+++   ++ + +  TL+  + E   +  R+  L  +I+ L+K
Sbjct:    1 MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKSYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDGDSIENGADNAMDKSKSWSRSIEDLHGGSNLPSPIVGNNINRAGRHSTLRCNTLPSRRTLKNSRLVCKKDDVHVCIMCLRAVMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCSEEQRFERLMEYFKN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQYDFTKLCLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENMSHLTEKLQDTENEAMSKIVELEKQLMHKNKELDAVREVYKDVNTQVHTLKRMVKEKDEAIQRQCNLEKKIHELEK 437          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Match: fmnl2a (formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70])

HSP 1 Score: 233.032 bits (593), Expect = 2.354e-62
Identity = 166/467 (35.55%), Postives = 272/467 (58.24%), Query Frame = 1
Query: 1708 LGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEV---SVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTEET----PKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAG 3081
            L  G     +  I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + + L  ++FE +FK    G +I    D   S +KT ++ P K TLLD ++ + L + L+ + +     + +CK+I   ++    V+  + ++  +PT  +VK  R+YE   K P+  LTDEDR ++   K+ERL QK+ ++ ++ NF E+ + L  ++  V  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+Q +S F +E+ +VE+A+ + +E +  DV  L  GM   + E + + +    LK F + NE+    L   A  A++ F +A ++FGE      P VFF +F RF + ++++ E  + RKR+ Q ++  ++  E       +  P  KN   +  Q++L  E RKK  + +    +   DG ++DI+ G
Sbjct:  569 LAEGPIKLFSVKIKKPIKTKFRMPVFNWVALKPNQINGTVFNEIDDERILEDLNVDEFEEMFKTRAQGPAI----DVTSSKQKTIQKGPNKITLLDSNRAKNLAITLRKVGKT---PEEICKAIQMFDLRTLPVDFVECLMRFIPTEPEVKALRQYEKERK-PLENLTDEDRFMMQFSKIERLMQKMTIMAFVGNFCESVQMLTPQLHAVIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKLTLLHYIANVVREKYQQVSLFYNELHYVEKAAAVSLENVLLDVKELQRGMDLTKREYSMHGHN-TLLKDFIQHNESKLKKLQDDAKIAQDAFDEAVKFFGESAKTTPPSVFFPVFVRFVKAYRQAEEENEARKRQEQLMMEKLLEQEAMMEMEDQKSPSHKN---KRQQQELIAELRKKQVKDSRHVYE-GKDGAIEDIITG 1022          

HSP 2 Score: 217.624 bits (553), Expect = 1.986e-57
Identity = 149/447 (33.33%), Postives = 243/447 (54.36%), Query Frame = 1
Query:  247 LDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKR-------RSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQ-------TQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKK 1524
            +++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K+       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F   + +N         +S +++                 +I R       R + +   +  K+S     K+ +H  + C+RA++N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E +RF+ L+ YF++      +D NIDFMV+C QFINIVVHS ED+N RV+LQ +FT L LD++  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK Q       ++IV +E +     + +D+++   ++ + +  TL+  + E   +  R+  L  +I+ L+K
Sbjct:    1 MNLPPDKARLLRQYDNEKKWELICDQERFQVKNPPHT---YIQKLKSYLDPAVTRKKFRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLVEYLSFAQYAVTFDGDSIENGADNAMDKSKSWSRSIEDLHGGSNLPSPIVGNNINRAGRHSTLRCNTLPSRRTLKNSRLVCKKDDVHVCIMCLRAVMNYQYGFNMVMSHPHAVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCSEEQRFERLMEYFKN------EDNNIDFMVACMQFINIVVHSVEDMNFRVHLQYDFTKLCLDEYLDKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEENMSHLTEKLQDTENEAMSKIVELEKQLMHKNKELDAVREVYKDVNTQVHTLKRMVKEKDEAIQRQCNLEKKIHELEK 437          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010834.1 (pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1 gene:ENSPMAG00000009817.1 transcript:ENSPMAT00000010834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 226.483 bits (576), Expect = 6.208e-61
Identity = 143/406 (35.22%), Postives = 238/406 (58.62%), Query Frame = 1
Query: 1711 GTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS------VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS-LEDVRKRRAQSII 2907
              GAT  +   I+ PI+TK+++PVFNW  LK  Q+ GTVF  ++DE + ++L+ ++FE +FK    G +    VD   S  K   +   K TLL+ ++ + L + L+   +  L ++ +C++I   ++       VE   R L   P+  +VK  R+YE   K P++ L DEDR +L   K+ERL Q++ ++++I NF E  + L  ++  +  AS++++SS K+K+ILEIILA+GN MNSS+RG +YGF+LQSLDLL +TKS D+  TL+ +  +IV+ K+ +L  F +E+R++E+A+ + ME +  DV  L  GM   + E + + +    L++F   +E     L      A+E +    ++FGE      P VFF +  RF + +K++ L++  KRR +  +
Sbjct:  611 AIGATAVR---IKKPIKTKFRMPVFNWVALKPNQINGTVFNELDDEKILEELDMDEFEEMFKTRAQGAT----VDLCLSKIKMVHKTQNKVTLLETNRAKNLAITLR---KGGLTTEEICRAIQMFDLQTLRLDFVECLTRFL---PSEAEVKLLRQYERERK-PLDELADEDRFMLQFSKIERLTQRMTIMIFIGNFTENVQMLTPQLNAIIAASMSIKSSHKIKKILEIILAFGNYMNSSKRGAVYGFKLQSLDLLIETKSTDRKLTLLHYISNIVQHKYPDLVTFYNELRYIEKAAAVSMENVLQDVRELQRGMDLTKREFSMHESN-TLLREFLAPSEARLERLLSDTKTAQEAYNTVVQYFGENPKTTPPSVFFPLLVRFVKAYKQAELDNEMKRRQEEAL 1001          

HSP 2 Score: 223.402 bits (568), Expect = 6.465e-60
Identity = 150/420 (35.71%), Postives = 231/420 (55.00%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS-KTLVLFLNINYKNIETKKTLNLQS--DTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNS-------KDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQI 1458
            S+++ P+  R + Q D ++K +L+ +   F+ KNP ++   Y+  +K+       RK   ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S     +  +I         TL+     D      S          C  + K     ++   NS       K+S   S K+ +H  + C+RAI+N Q G  M   H + ++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+ GE +RF+ L+ YFR+      +D NIDFMV+C QFINIVVHS +D+N RV+LQ EFT L LD +  KL+    D+L+ Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++  ENE   + +I++ L+ Q  + +KE  ++++Q+
Sbjct:    2 SMNLPPDKARLLRQYDAEKKWELICDQERFQVKNPPHT---YIQKLKSYLDPGVTRKKLRRRVQES-TQVLRELEISLRTNHIGWVREFLNEENKGLDVLIEYLSFAQYAVTFDIEGAEGAGNGTLSRSKSLDRSIEDLSGKNNGLHAAVCTTTAKMARHHLSLRYNSLPSRKTLKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNMVMAHPQCVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCGEKQRFERLMEYFRN------EDSNIDFMVACMQFINIVVHSVDDMNFRVHLQYEFTKLALDSYLEKLKHTESDKLQVQIQAYLDNVFDVGALLEDAETKNAALERVEELEEHISHLTEK----LIDCENEA--MAKIVE-LEKQLMQANKELESIKKQL 404          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001635.1 (pep scaffold:Pmarinus_7.0:GL479577:17910:32690:1 gene:ENSPMAG00000001475.1 transcript:ENSPMAT00000001635.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.823 bits (499), Expect = 4.972e-55
Identity = 142/416 (34.13%), Postives = 221/416 (53.12%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYM--SKTLVLFLNINYKNIETKKTLNLQSDTKT----------HXXXXXXXXXXXXNCCASIKR---RSSVVTK---FQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEI---TGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQ 1413
            S+++ P+  + +   D ++K +L+ +   F+ KNP ++   Y+  +K+       RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL+DY+  +++   + +      ++  T ++    K+          H SS     S   +   + K+   R + + +   F+N K    + V    H  + C+RAI+N Q G  +   H   ++ I L L + + +TK LVLE LAA+CL++ G  K+LAAF  FKE+    GE  RF+ L+ YF        +D NIDFMV+C QFINIVVHS ED+NLRV+LQ EFT LGLD     L+E   +RL  Q+ AY  N  DV  LLED+ET+   L   + L       E++  +   H+E ++ E +  I  L+ Q
Sbjct:    5 SMNLPPDKAQLLQDYDVEKKWELVCDQERFQVKNPPHT---YIQQLKSHMEFSMARKQFKRRVQE-STQVLREIEISLRTNHIGWVREFLNEENRGLDVLVDYLCHTQSSGTYDDAAAATTDSGATPSMAERQKSLDGAVDEDAEHESSGGGLTSAASSVSRAAKQLLLRHNTLNRRWTFRNQKAVSQDDV----HVCIMCLRAIMNYQSGFNLVMSHPSCVNEITLSLNNRSPRTKALVLELLAAVCLVLGGHSKILAAFSNFKEVKQSCGEKNRFERLMEYF------GTEDNNIDFMVACMQFINIVVHSVEDMNLRVHLQYEFTELGLDGVLESLKETESERLLMQIQAYLDNVFDVGALLEDAETRTAALEHVDSL-------EDQIASVTRHMEEKELEAMARIAELEKQ 399          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000660.1 (pep scaffold:Pmarinus_7.0:GL482229:53:18716:-1 gene:ENSPMAG00000000600.1 transcript:ENSPMAT00000000660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.54 bits (410), Expect = 4.717e-42
Identity = 101/271 (37.27%), Postives = 156/271 (57.56%), Query Frame = 1
Query:  775 CMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVN-GLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQ-------IVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKEL-----VLEINSLKKVLTEKNIP 1548
            C+R  L  Q G E    H + ++ IAL L + N +T+TLVLE LAA+CL+   G    LAAF+ FKE+  E  RF+ L+TYF+D      D+ ++DFMV+C QFINIVVHS E +N RV+LQ EFT LG+D++  KL++   ++L+ Q+ AY  N  DVA+L++D+ETK   +   ++L  +    +E  Q Q       IV +E +     + ++ L+   +E+  +  TLR  + E   +  R+ EL      +E +    VL++  +P
Sbjct:    3 CVRVPL--QYGFEKVLSHPQCVNEIALSLNNKNQRTRTLVLELLAAVCLVRGEGHDTTLAAFDNFKEVCKERHRFERLLTYFKD------DESSMDFMVACMQFINIVVHSVEHMNYRVHLQYEFTKLGMDEYLEKLKKTESEKLQVQIQAYLDNVFDVAVLVDDAETKNAAVERVQQLNEQVSHLQENLQEQEDAAVSRIVELEKKLLNYCKEVEKLQVSLKEERGQVSTLRHSVKEKDLALRRQSELEKRLEEMEAHRSSIVLSQDGLP 265          

HSP 2 Score: 124.02 bits (310), Expect = 1.763e-29
Identity = 78/217 (35.94%), Postives = 121/217 (55.76%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSI---NQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEI 2385
            I+  I TKY+LPVFNW+ LK  Q+ GTVF  M+DE L   L+ + FE +FK    G      VD    +    K  P K +LLD ++ R L + L+     + H +I CK++   N  E+ VE  + +   +PT  +    R+YE   + P + L +E+R +L   +VERL Q++ V++++ NF +    L   V  +  ASL+++SSQK K+ILE+
Sbjct:  386 IKKAIPTKYRLPVFNWTALKPSQVNGTVFTDMDDEELLQVLDMDSFEELFKTKAQGPVATIQVDGPRCNAAQPKVAP-KVSLLDANRARNLAITLR--KTARSHGEI-CKAVQTFNVQELPVERLECLQRFVPTESEAMLLRQYERDLRSPED-LAEEERFMLQFGRVERLSQRITVMLFMGNFMDTVSRLTPFVNAIIAASLSIKSSQKFKKILEV 597          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000664.1 (pep scaffold:Pmarinus_7.0:GL482229:65:18719:-1 gene:ENSPMAG00000000600.1 transcript:ENSPMAT00000000664.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.836 bits (390), Expect = 1.130e-39
Identity = 105/268 (39.18%), Postives = 157/268 (58.58%), Query Frame = 1
Query:  775 CMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVN-GLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINS-LKKVLTEKNIPFNSSVLTE 1572
            C+R  L  Q G E    H + ++ IAL L + N +T+TLVLE LAA+CL+   G    LAAF+ FKE+  E  RF+ L+TYF+D      D+ ++DFMV+C QFINIVVHS E +N RV+LQ EFT LG+D++  KL++   ++L+ Q+ AY  N  DVA+L++D+ETK   +   ++L      NE     Q+ H+ + +  +  +I    +Q        +  R Q+S  R+S  +EK+L L   S L+K L E     +S VL++
Sbjct:    4 CVRVPL--QYGFEKVLSHPQCVNEIALSLNNKNQRTRTLVLELLAAVCLVRGEGHDTTLAAFDNFKEVCKERHRFERLLTYFKD------DESSMDFMVACMQFINIVVHSVEHMNYRVHLQYEFTKLGMDEYLEKLKKTESEKLQVQIQAYLDNVFDVAVLVDDAETKNAAVERVQQL------NE-----QVSHV-SARLYVNDVILHKSSQLAADGVSLKEERGQVSTLRHSV-KEKDLALRRQSELEKRLEEMEAHRSSIVLSQ 250          

HSP 2 Score: 124.405 bits (311), Expect = 1.197e-29
Identity = 78/223 (34.98%), Postives = 123/223 (55.16%), Query Frame = 1
Query: 1726 NTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQ---LEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEI 2385
            NT    I+  I TKY+LPVFNW+ LK  Q+ GTVF  M+DE L   L+ + FE +FK    G      VD    +    K  P K +LLD ++ R L + L+     + H +I CK++     +++ VE  + +   +PT  +    R+YE   + P + L +E+R +L   +VERL Q++ V++++ NF +    L   V  +  ASL+++SSQK K+ILE+
Sbjct:  356 NTVGMRIKKAIPTKYRLPVFNWTALKPSQVNGTVFTDMDDEELLQVLDMDSFEELFKTKAQGPVATIQVDGPRCNAAQPKVAP-KVSLLDANRARNLAITLR--KTARSHGEI-CKAVQTRSLMKLPVERLECLQRFVPTESEAMLLRQYERDLRSPED-LAEEERFMLQFGRVERLSQRITVMLFMGNFMDTVSRLTPFVNAIIAASLSIKSSQKFKKILEV 573          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Match: daam1a (dishevelled associated activator of morphogenesis 1a [Source:ZFIN;Acc:ZDB-GENE-030911-6])

HSP 1 Score: 107.457 bits (267), Expect = 7.434e-24
Identity = 100/422 (23.70%), Postives = 191/422 (45.26%), Query Frame = 1
Query: 1774 LPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIF-----------KLNP-----------VGDSIP--NGVDSNDSSEKTSK--------------------RKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQL----PTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXX-XXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFED--NENLT------ADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS 2868
            L  FNW+ L   ++ GT++  ++D+  +  L+ +  E +F           K N            VGD     NG      S++ S+                    ++ ++ +++DG + +   +LL  L   K+ ++ + +++ +++   E+   +L QL    P   DV     + +     I  +   DR L  + ++   QQ+L+ + +   F E       KV  +  AS  V  S++L+Q+LE++LA GN MN  +RG  YGF++ SL+ +     S DK+  L+ + + +VE KF ++   SD+++ V +A+K+ +  +  ++ ++  G+K V  E+         +   F    ++ +T      ++L    + AKE F ++   FGE      P+ FFG+F  F   F  S
Sbjct:  452 LKSFNWAKLPENKIDGTIWSELDDQRAFRVLDLQDIERVFSAYQRQQLACVKKNQIILQEKQCSFDVGDKYRPFNGTRRKTLSKRASQLEANLAHKELGSTEDLHHGNKRAKELSVIDGRRAQNCVILLSKL---KMSNEEIKRALMRMDEQEELPKDMLEQLLKFVPEKSDVDVLEEHRHE----IERMARADRFLFDMSRIPHYQQRLQALFFKKKFAERLGECKPKVEAILLASREVSRSRRLRQLLELVLALGNYMNKGQRGNAYGFKISSLNKIADTKSSTDKNINLLHYLIIVVEKKFPDVLGISDDLQHVPEAAKVNLTEMEKEINNIKIGLKAVEAELEFQRTHASAIGDRFISVMSDFITVASFSFSELEDLLSEAKEKFNKSVSHFGEEGGRTQPEEFFGMFDAFLSAFGDS 866          

HSP 2 Score: 80.4925 bits (197), Expect = 1.765e-15
Identity = 50/152 (32.89%), Postives = 81/152 (53.29%), Query Frame = 1
Query:  739 ESVKNSLHQG-LKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSG---EDINLRVYLQQEFTILGLDDFYRKL 1182
            E+ ++ +H   + C++A++NN +G      H  +I+VI+  L   N  TK  VLE L A+CL+  G +KVL A   +++   E     TLIT   D  T K  D  +    +   FIN ++++G   E++  RV+L+ EF +LG+     KL
Sbjct:   25 ETAESQIHTSVIGCIKALMNNSQGRAHVLAHPESINVISQSLSSENA-TKVAVLEILGAVCLVPGGHRKVLQAMLRYQQHAAERTLLQTLITEL-DRNTGKYRD-EVSLKTAIMSFINAILNAGTGQENLEFRVHLRYEFLMLGIQSLVDKL 173          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Match: EDO32868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STU3])

HSP 1 Score: 121.709 bits (304), Expect = 7.015e-28
Identity = 97/387 (25.06%), Postives = 193/387 (49.87%), Query Frame = 1
Query: 1774 LPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKT-SKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSI----NQLEVSVEVADRILYQLPT-------NDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQX-XXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPR---------LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKS 2868
            L  FNWS L + ++KGTV+  ++D  +Y++++ E F+ +F       S   G ++    + T S  KP++ +L+D  + +  G+LL  L   KL  + + K+I     + E+S ++ +++L  +PT       N++ K    +  +DK            L  + ++   +Q+L+ + +   FPE    L  KV  V  A   V  S++++ +LE+ILA+GN MN   RG   GF+L S   ++    S +   TL+ + V ++E  + ++    +++  V  A+K+ +  + +++ +L   +K+V  E++  T +  +         +  F +  +    ++ ++    K+ F +A + FGE   N + D FFGIF+ F  +F ++
Sbjct:  687 LKSFNWSKLPDSKIKGTVWTDIDDTKVYNEMDLEDFDRMF-------SAYQGKENQGIKDFTDSAAKPKELSLIDSRRAQNCGILLTKL---KLSDEEITKAILTIDEEEELSKDMVEQLLKYVPTAAEKNLLNENNKEKDNFARADKF-----------LYDMSRIVHYEQRLKALFFKKKFPERMGDLKPKVQAVIMACKEVTRSKRIRTLLEVILAFGNYMNRGARGNATGFKLASLNRIVDTKSSANSRITLLNYLVTVLEKSYPDVLKLEEDLANVRTAAKVNLAELESEIVALRKELKEVEKELDFQTRKREKIPGDKFVDVIGSFVKVAQFSCCEVEEAWEELKQKFFKAVKLFGEDPKNLSSDQFFGIFNVFLVSFAEA 1052          

HSP 2 Score: 83.9593 bits (206), Expect = 2.776e-16
Identity = 48/152 (31.58%), Postives = 78/152 (51.32%), Query Frame = 1
Query:  739 ESVKNSLHQG-LKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSG---EDINLRVYLQQEFTILGLDDFYRKL 1182
            E+ ++ +H   + C +A++N+  G      H   ID+IA  LL  N +TK  VLE L A+CL+  G +K L A  +F++   E  RF TL+           +++N+   ++   FIN  +  G   E +  RV+L+ EF +LG+     KL
Sbjct:  183 ETSQSKIHTAVIGCFKALMNSSHGRAHVLAHPTCIDIIAQSLLTENIKTKIQVLEILGAVCLVPGGHKKALDAMTHFQKFAEERTRFQTLVNDLDRSTGVYKEEFNLK--IAIMSFINAALKYGAGAEYLEFRVHLRFEFLMLGIQPVIEKL 332          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Match: EDO35335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLQ1])

HSP 1 Score: 82.4185 bits (202), Expect = 7.761e-16
Identity = 95/373 (25.47%), Postives = 172/373 (46.11%), Query Frame = 1
Query: 1786 NWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTL--LDGSKHRCLGVLLKFL--DQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNS-SRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQN-LSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNC---NTNQPPR----LKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKK 2865
            NW+ + N+ +    F    +E   +KLE E             S P  +D+ D  EK S  K + K L  LD    + L + L  L    E++ S IL    +Q ++S    + +L  LP+ + ++         K  I+ L++ ++  + +  +++L+Q+L  +++   FPE        V   T A   V++S K  ++LE+IL  GN MN+ SR     GF +  L  L+ TKS+D    L+ F  D VE+K+ + ++ F +E+  VE A K+  E +   ++++   ++++  E+     NTN   R    +K+F+   ++    L +   N    F    E+F       + + FFG    F + + +
Sbjct:  510 NWTKINNRNITDNCFWKKVNE---EKLEREDMLAELTRTFAAKSAPKKLDNPDGEEKKSVAKKKAKELKVLDPKSAQNLSIFLGSLKSSHEEIKSHIL--HCDQEKLSESAIESLLKYLPSPEQMEQLSNM----KDQISELSEPEQFAVHISDIKKLEQRLNCLLFRTRFPEEMSDTKPGVVNATAACREVKTSPKFAKLLELILLMGNYMNTGSRNEGTIGFEISYLTKLSSTKSVDGQRNLLHFIADAVENKYSSEIAGFENELGHVEAAGKVSEEILGKSISNMSANLRKIEKELEAKQQNTNPEDRFHDAMKEFYSSAKDQVDVLVEMHKNMVTMFKDVLEFFCMDPKKTSMEEFFGDLKTFMDQYSQ 873          

HSP 2 Score: 73.9442 bits (180), Expect = 2.778e-13
Identity = 48/176 (27.27%), Postives = 92/176 (52.27%), Query Frame = 1
Query:  730 SVNESVKNSL-HQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTK-TLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVA 1251
            SV  SV+  + H+ ++C++A +NN+ G ++       + ++A  +  PNY +  T V++ +AA+CL+ +   + + A     E+  E  RF  ++    D  T           V+C QFIN ++ + +D++ R++L+ EF   GL+D ++ L +   D L  Q+  +  +R D A
Sbjct:  100 SVRGSVEKRIQHECVRCLKAYMNNKYGLQLMLKSEDGLTLLARSM-DPNYPSMMTDVVKVMAAVCLVKH--DRAVEAMTVCGELE-EKGRFSKIVDALHDDHT--------SLKVACIQFINALISTPDDLDFRLHLRNEFVREGLNDAFQDLRDLENDDLNVQLDIWEEHRDDDA 263          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Match: EDO29831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2I4])

HSP 1 Score: 70.4774 bits (171), Expect = 3.202e-13
Identity = 49/177 (27.68%), Postives = 94/177 (53.11%), Query Frame = 1
Query:  730 SVNESVKNSL-HQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTK-TLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRD-HETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVA 1251
            SV  SV+  + H+ ++C++A +NN+ G ++       + ++A  +  PNY +  T V++ +AA+CL+ +   + + A     E+  E  RF  ++    D H + KV         +C QFIN ++ + +D++ R++L+ EF   GL+D ++ L +   D L  Q+  +  +R D A
Sbjct:   60 SVRGSVEKRIQHECVRCLKAYMNNKYGLQLMLKSEDGLTLLARSM-DPNYPSMMTDVVKVMAAVCLVKH--DRAVEAMTVCGELE-EKGRFSKIVDALHDDHTSLKV---------ACIQFINALISTPDDLDFRLHLRNEFVREGLNDAFQDLRDLENDDLNVQLDIWEEHRDDDA 223          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Match: EDO35348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLR7])

HSP 1 Score: 70.8626 bits (172), Expect = 4.865e-13
Identity = 46/162 (28.40%), Postives = 76/162 (46.91%), Query Frame = 1
Query:  763 QGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIV-NGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVD 1245
            + ++C++A++N++ G      H      +   L   N   K  V E L+A+CL    G Q  + A E +K   G+  RF  ++   ++ E        + +M +C  FIN ++ S +D + RV L+ EF  LGL D   KL     D L  Q+  +   R+D
Sbjct:   93 ECVQCIKAVMNSKAGLTCIIEHGEYSRKLVKALDTDNTMIKKQVFELLSALCLYSEQGYQLAIDALENYKMTKGQRYRFSLIVNELKNAEV-------VPYMSACLAFINTILISTDDFDERVRLRNEFVGLGLLDILTKLRHLDDDDLAVQIDVFEERRLD 247          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Match: EDO40029 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8A4])

HSP 1 Score: 68.1662 bits (165), Expect = 1.904e-11
Identity = 77/326 (23.62%), Postives = 142/326 (43.56%), Query Frame = 1
Query:  337 PKYSAFHYVTLI---KALQTGKSIRKSFNKK---PDDDPVH-VLSATEVSLRTN-NVDWVYDFLNN--NGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESV--KNSL--HQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGL--DDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLED 1266
            PKY++  Y+  +   K + +G   +   N K      +PV  VL + E+ LRT+ N  W+ +F+++   G   L++++      FL++N  + ++   +    DT                         S V+K   S+ SV   V  ++ +  H  L+ +R ++ N+ G +        +  I LCL   N +T+ LVL+ L  IC      +KV+ +  ++ + + ESR F+ ++       T      +  F      FIN  V      NL+V+ QQEF   GL  D   R LE      +++ +  +  N ++V  ++++
Sbjct:    9 PKYTSGFYIEQLRGHKEIVSGSGQKTGANYKRLIKTLEPVEMVLRSLEIDLRTHPNTTWLREFIDDPYRGHMALVEFLQ-----FLHLNPPSNDSSDDI---GDTD-----------------------KSKVSKKTGSQKSVKPDVLARSHIDEHLCLQSLRVLMKNKYGFQSVMRAPEVVKAIILCLKINNRKTQALVLKILTHICEESEHYEKVIDSVRFYTKTSRESRPFENIVQLIFSKPT------SPTFQTIILNFINKFVSCAPSFNLKVFHQQEFEDAGLDVDKIERTLEGAEATAVREALKIWRDNYINVQNVMDE 297          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Match: ENSORLT00000034540.1 (formin-like protein 1 [Source:NCBI gene;Acc:101165675])

HSP 1 Score: 379.022 bits (972), Expect = 1.641e-113
Identity = 317/1016 (31.20%), Postives = 530/1016 (52.17%), Query Frame = 1
Query:  223 RWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKN-IETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE-KTELLQIIDSLKAQKEEQDKEYRTLREQISEP--RNSTDREKELVLEINSL--KKVLTEKNIPFNSSVL----------TELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQS----IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSI---NQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRR------AQSIILNIVPTEE---TPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTP---LQAEIHPKRSNLRYQEEV 3150
            R+   + ++++ P+ V  + Q D ++K +L+ +   F+ KNP  +   Y+  +KA Q    I   F ++ ++    VL   E+SLRTN++ W  +FLN  N GL+VL++Y+S     F+N   KN ++T        D  T+ S  +L  S      AS  R S   T  +  ++S   S K+ +H  + C+RAI+N Q G      H   ++ I L L   + +T  LVLE LAA+CL+  G   +L+AF  FKE+ GE RRF+ L+ YFR  E+      N+DFMV+C QFINIVVHS ED+N RVYLQ EFT L LDD+  +L+    DRL  Q+ AY  N  DV  LLED+E K  ++   E+L+ +      K  T++   E+E K ++ Q+ + L     +  KE   L+  ++ P  + +TD   +LV  +  L  + VL  +  P   +V+             SP   +          PP  PPPP  PPP  A  PP  PP     G G TN +  +     + PIQTKY++P+ NW  L++ Q++GT+F  ++D  +   L+   FE+ FK      ++  G     +S K S     K ++++  + + L + L+   QE   +  +C +I   N   + ++  + +   +PT  ++K  + +E   +  ++ L++ DR ++   K+ RL Q++  + ++ NFP++ + +  ++  +  AS++++SS KLK+ILEIILA+GN MNS ++G +YGFRL+SL+LL +TKS D+  TL+ F V++++ ++ +L  F  E+ F+++A  + ++ +  DV +L  GM+  + E+ C       LK F + N  L + L      A++ +  A  +FGE   +  P  FF  F+RF + +K++ ++ ++++      A+S  +N    E     P  KP   +L M EL+K+            +    +   DG ++DI++ L   P   L +  H  +  L+ Q +V
Sbjct:   44 RFSAALNTMNLPPDKVEILVQYDNEKKWELICDQERFKVKNPPSA---YLEKLKAHQVNGGIGWMFKRRVEES-TPVLRELEISLRTNHIGWAKEFLNEENRGLDVLVNYLS-----FINSTVKNDVDTSDRNTECRDQHTYASVDNLNGSPPPKSSAS--RASRGFTLRRPMRNSRVSSQKDDVHLCIMCLRAIMNYQSGFSQVMQHPSCVNEITLSLNDRHPRTNALVLELLAAVCLVQGGHGIILSAFNNFKEVCGEKRRFEKLMEYFRSEES------NLDFMVACMQFINIVVHSVEDLNFRVYLQHEFTQLQLDDYLEQLKLSESDRLLVQIQAYLDNLFDVGSLLEDAEAKNAMMEHVEQLQEK----NVKLNTRLQESESEAKVKVSQLENKLI----QTTKELELLKGSLNSPSSQGNTDDPHKLVSRVQVLVQQGVLCVERSPTGEAVVKVQQTDETDAAATSPQPPTEESPQTPAAAPPPPPPPPPPPPPPPALIPPPPPPPPLSSG-GFTNQKEDAGGNKTKKPIQTKYRMPLLNWKPLQSYQVEGTIFSELDDTSVLKTLDMSTFEDQFKTKAQASTVDLGTLKTKASPKPSI----KVSVVNLHRSKNLAITLR---QEDKDASEICHAIKTYNLKALRLDFLELLEPFIPTKHEMKLIQDFEAEGRC-LDELSEADRFMVHFSKIPRLPQRISTLTFMGNFPDSVQLIQPQLDAIIAASMSIKSSNKLKRILEIILAFGNYMNSGKQGPVYGFRLESLNLLFETKSTDRKQTLLHFIVNVIQEQYSDLQTFYTELHFLDKAVLVSLDQLLADVGALERGMELTKQEL-CEEEDNAVLKTFVDSNTQLLSSLVADGKTAQDAYESAVLYFGEDPKSTPPSAFFSHFNRFIKAYKEAEKEQKRKKFDLQYEARSGPVNAKGAERKSLAPCVKPH-MDL-MAELKKR-----------QSTPLVREGKDGTIEDIISDLRNQPYRRLDSGRHSSKGKLKQQLQV 1011          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Match: ENSORLT00000017623.2 (formin-like protein 1 [Source:NCBI gene;Acc:101165675])

HSP 1 Score: 377.867 bits (969), Expect = 3.377e-113
Identity = 316/1013 (31.19%), Postives = 529/1013 (52.22%), Query Frame = 1
Query:  223 RWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKN-IETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE-KTELLQIIDSLKAQKEEQDKEYRTLREQISEP--RNSTDREKELVLEINSL--KKVLTEKNIPFNSSVL----------TELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQS----IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSI---NQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRR------AQSIILNIVPTEE---TPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEV 3150
            R+   + ++++ P+ V  + Q D ++K +L+ +   F+ KNP  +   Y+  +KA Q    I   F ++ ++    VL   E+SLRTN++ W  +FLN  N GL+VL++Y+S     F+N   KN ++T        D  T+ S  +L  S      AS  R S   T  +  ++S   S K+ +H  + C+RAI+N Q G      H   ++ I L L   + +T  LVLE LAA+CL+  G   +L+AF  FKE+ GE RRF+ L+ YFR  E+      N+DFMV+C QFINIVVHS ED+N RVYLQ EFT L LDD+  +L+    DRL  Q+ AY  N  DV  LLED+E K  ++   E+L+ +      K  T++   E+E K ++ Q+ + L     +  KE   L+  ++ P  + +TD   +LV  +  L  + VL  +  P   +V+             SP   +          PP  PPPP  PPP  A  PP  PP     G G TN +  +     + PIQTKY++P+ NW  L++ Q++GT+F  ++D  +   L+   FE+ FK      ++  G     +S K S     K ++++  + + L + L+   QE   +  +C +I   N   + ++  + +   +PT  ++K  + +E   +  ++ L++ DR ++   K+ RL Q++  + ++ NFP++ + +  ++  +  AS++++SS KLK+ILEIILA+GN MNS ++G +YGFRL+SL+LL +TKS D+  TL+ F V++++ ++ +L  F  E+ F+++A  + ++ +  DV +L  GM+  + E+ C       LK F + N  L + L      A++ +  A  +FGE   +  P  FF  F+RF + +K++ ++ ++++      A+S  +N    E     P  KP   +L M EL+K+            +    +   DG ++DI++ L      A  + KRS+  + +E 
Sbjct:   44 RFSAALNTMNLPPDKVEILVQYDNEKKWELICDQERFKVKNPPSA---YLEKLKAHQVNGGIGWMFKRRVEES-TPVLRELEISLRTNHIGWAKEFLNEENRGLDVLVNYLS-----FINSTVKNDVDTSDRNTECRDQHTYASVDNLNGSPPPKSSAS--RASRGFTLRRPMRNSRVSSQKDDVHLCIMCLRAIMNYQSGFSQVMQHPSCVNEITLSLNDRHPRTNALVLELLAAVCLVQGGHGIILSAFNNFKEVCGEKRRFEKLMEYFRSEES------NLDFMVACMQFINIVVHSVEDLNFRVYLQHEFTQLQLDDYLEQLKLSESDRLLVQIQAYLDNLFDVGSLLEDAEAKNAMMEHVEQLQEK----NVKLNTRLQESESEAKVKVSQLENKLI----QTTKELELLKGSLNSPSSQGNTDDPHKLVSRVQVLVQQGVLCVERSPTGEAVVKVQQTDETDAAATSPQPPTEESPQTPAAAPPPPPPPPPPPPPPPALIPPPPPPPPLSSG-GFTNQKEDAGGNKTKKPIQTKYRMPLLNWKPLQSYQVEGTIFSELDDTSVLKTLDMSTFEDQFKTKAQASTVDLGTLKTKASPKPSI----KVSVVNLHRSKNLAITLR---QEDKDASEICHAIKTYNLKALRLDFLELLEPFIPTKHEMKLIQDFEAEGRC-LDELSEADRFMVHFSKIPRLPQRISTLTFMGNFPDSVQLIQPQLDAIIAASMSIKSSNKLKRILEIILAFGNYMNSGKQGPVYGFRLESLNLLFETKSTDRKQTLLHFIVNVIQEQYSDLQTFYTELHFLDKAVLVSLDQLLADVGALERGMELTKQEL-CEEEDNAVLKTFVDSNTQLLSSLVADGKTAQDAYESAVLYFGEDPKSTPPSAFFSHFNRFIKAYKEAEKEQKRKKFDLQYEARSGPVNAKGAERKSLAPCVKPH-MDL-MAELKKR-----------QSTPLVREGKDGTIEDIISALKSVAFVAR-YTKRSSRLFCDET 1007          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Match: ENSORLT00000027976.1 (formin-like protein 1 [Source:NCBI gene;Acc:101165675])

HSP 1 Score: 377.096 bits (967), Expect = 8.045e-113
Identity = 311/990 (31.41%), Postives = 520/990 (52.53%), Query Frame = 1
Query:  223 RWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKN-IETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENE-KTELLQIIDSLKAQKEEQDKEYRTLREQISEP--RNSTDREKELVLEINSL--KKVLTEKNIPFNSSVL----------TELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQS----IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSI---NQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRR------AQSIILNIVPTEE---TPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAG 3081
            R+   + ++++ P+ V  + Q D ++K +L+ +   F+ KNP  +   Y+  +KA Q    I   F ++ ++    VL   E+SLRTN++ W  +FLN  N GL+VL++Y+S     F+N   KN ++T        D  T+ S  +L  S      AS  R S   T  +  ++S   S K+ +H  + C+RAI+N Q G      H   ++ I L L   + +T  LVLE LAA+CL+  G   +L+AF  FKE+ GE RRF+ L+ YFR  E+      N+DFMV+C QFINIVVHS ED+N RVYLQ EFT L LDD+  +L+    DRL  Q+ AY  N  DV  LLED+E K  ++   E+L+ +      K  T++   E+E K ++ Q+ + L     +  KE   L+  ++ P  + +TD   +LV  +  L  + VL  +  P   +V+             SP   +          PP  PPPP  PPP  A  PP  PP     G G TN +  +     + PIQTKY++P+ NW  L++ Q++GT+F  ++D  +   L+   FE+ FK      ++  G     +S K S     K ++++  + + L + L+   QE   +  +C +I   N   + ++  + +   +PT  ++K  + +E   +  ++ L++ DR ++   K+ RL Q++  + ++ NFP++ + +  ++  +  AS++++SS KLK+ILEIILA+GN MNS ++G +YGFRL+SL+LL +TKS D+  TL+ F V++++ ++ +L  F  E+ F+++A  + ++ +  DV +L  GM+  + E+ C       LK F + N  L + L      A++ +  A  +FGE   +  P  FF  F+RF + +K++ ++ ++++      A+S  +N    E     P  KP   +L M EL+K+            +    +   DG ++DI++G
Sbjct:   44 RFSAALNTMNLPPDKVEILVQYDNEKKWELICDQERFKVKNPPSA---YLEKLKAHQVNGGIGWMFKRRVEES-TPVLRELEISLRTNHIGWAKEFLNEENRGLDVLVNYLS-----FINSTVKNDVDTSDRNTECRDQHTYASVDNLNGSPPPKSSAS--RASRGFTLRRPMRNSRVSSQKDDVHLCIMCLRAIMNYQSGFSQVMQHPSCVNEITLSLNDRHPRTNALVLELLAAVCLVQGGHGIILSAFNNFKEVCGEKRRFEKLMEYFRSEES------NLDFMVACMQFINIVVHSVEDLNFRVYLQHEFTQLQLDDYLEQLKLSESDRLLVQIQAYLDNLFDVGSLLEDAEAKNAMMEHVEQLQEK----NVKLNTRLQESESEAKVKVSQLENKLI----QTTKELELLKGSLNSPSSQGNTDDPHKLVSRVQVLVQQGVLCVERSPTGEAVVKVQQTDETDAAATSPQPPTEESPQTPAAAPPPPPPPPPPPPPPPALIPPPPPPPPLSSG-GFTNQKEDAGGNKTKKPIQTKYRMPLLNWKPLQSYQVEGTIFSELDDTSVLKTLDMSTFEDQFKTKAQASTVDLGTLKTKASPKPSI----KVSVVNLHRSKNLAITLR---QEDKDASEICHAIKTYNLKALRLDFLELLEPFIPTKHEMKLIQDFEAEGRC-LDELSEADRFMVHFSKIPRLPQRISTLTFMGNFPDSVQLIQPQLDAIIAASMSIKSSNKLKRILEIILAFGNYMNSGKQGPVYGFRLESLNLLFETKSTDRKQTLLHFIVNVIQEQYSDLQTFYTELHFLDKAVLVSLDQLLADVGALERGMELTKQEL-CEEEDNAVLKTFVDSNTQLLSSLVADGKTAQDAYESAVLYFGEDPKSTPPSAFFSHFNRFIKAYKEAEKEQKRKKFDLQYEARSGPVNAKGAERKSLAPCVKPH-MDL-MAELKKR-----------QSTPLVREGKDGTIEDIISG 985          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Match: fmnl3 (formin like 3 [Source:NCBI gene;Acc:101171244])

HSP 1 Score: 251.521 bits (641), Expect = 8.257e-69
Identity = 162/462 (35.06%), Postives = 270/462 (58.44%), Query Frame = 1
Query: 1744 IRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVS---VEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLE--DVRKRRAQSIILNIVPTE---ETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQA 3105
            I+ PI+TK++LP+FNW+ LK  Q+ GTVF  ++DE + ++L+ EKFE +FK    G      VD + +  K +++   K TLLD ++ + L + L+  ++    ++ +CK+I + ++    V+  + ++  LPT  +VK  R+YE  ++ P++ L +EDR +L   K+ERL Q++ ++ ++ NF +    L  ++  V  AS +V+SS KLK++LEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +   IV+ K+  L++F +E+ FV++A+ + +E +  DV  L  GM  +R E  C+ +  P LK F + ++     L K +  A+E F     +FGE      P VFF +F RF + +K ++E  ++RK++ ++I   ++  E   + PK +P  K    +EL  +L     K +R +         DG ++DI+  L   P  A
Sbjct:  522 IKKPIKTKFRLPIFNWTALKPNQINGTVFNEIDDERVLEELDLEKFEELFKTKAQGPV----VDLSCTKNKVAQKTVNKVTLLDANRSKNLAITLRKANKT---TEEICKAIEKFDLKALPVDFVECLMRFLPTEAEVKVLRQYE-RERRPLDQLAEEDRFMLLFSKIERLTQRMNIITFVGNFADNISMLTPQLNAVIAASGSVKSSPKLKRMLEIILALGNYMNSSKRGCVYGFKLQSLDLLLDTKSTDRKMTLLHYIALIVKEKYPELANFYNELHFVDKAAAVSLENVLLDVRELGKGMDLIRRE--CSLHDHPVLKSFLQGSDAQLDKLQKDSKAAEEAFNSVVNYFGESAKTTPPSVFFPVFVRFIKAYKDAVEENEMRKKQEEAIREKLLAQEAKQQDPKVQPSRKRHQQQELIAELRRRQAKDHRPVYE-----GKDGAIEDIITVLKSVPFTA 968          

HSP 2 Score: 219.935 bits (559), Expect = 2.111e-58
Identity = 153/441 (34.69%), Postives = 233/441 (52.83%), Query Frame = 1
Query:  244 SLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPF 1551
            S+++ P+  R + Q D ++K  L+ +   F+ KNP ++   Y+  ++        RK F ++  +    VL   E+SLRTN++ WV +FLN  N GL+VL++Y+S     F                                     CA I      V+  +  K+S   S K+ +H  + C+RAI+N Q G  M   H+ A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FKE+  E  RF+ L+ +FR  E       NID+MV+C QFINIVVHS ED+N RV+LQ EFT LGLDD+  K +    D+L  Q+ AY  N  DV  LLED+ETK   L   E+LE       EK    ++ +ENE   ++++ D L+     +DKE + +RE   E  N+         ++++L++++ EK+  F
Sbjct:   45 SMNLPPDKARLLRQYDNEKKWDLICDQERFQVKNPPHT---YIQKLRGYLDPGVTRKKFRRRVQES-TKVLRELEISLRTNHIGWVREFLNDENRGLDVLVEYLS-----FAQ-----------------------------------CAVI---YGTVSNSRTIKNSRLVSQKDDVHVCIMCLRAIMNYQYGFNMVMSHAHAVNEIALSLNNKNSRTKALVLELLAAVCLVRGGHEIILSAFDNFKEVCKEKHRFERLMDFFRSEEG------NIDYMVACMQFINIVVHSVEDMNFRVHLQYEFTKLGLDDYLEKCKHTESDKLSVQIQAYLDNVFDVGGLLEDAETKNAALEKVEELEEHLSHVTEK----LLEVENET--MMKVAD-LEKILLHKDKELQVIRETY-ESTNT---------QVHTLRRMIKEKDAAF 415          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Match: ENSORLT00000023606.2 (formin-like protein 2 [Source:NCBI gene;Acc:101160379])

HSP 1 Score: 245.743 bits (626), Expect = 1.670e-66
Identity = 147/400 (36.75%), Postives = 240/400 (60.00%), Query Frame = 1
Query: 1708 LGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLE---VSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQ 2898
            L  G     +  I+ PIQTK+++PV NW  LK  Q+ GTVF  ++DE +   L+ E+FE +FK    G +    VD   S +K  ++ P K +LL+ ++ + L + L+   Q    S+++C++I   +   V V+  + ++  LPT  +VK  R+YE  D+ P+ AL+DEDR ++   ++ERL Q++ ++ ++ NF +  + L  ++  +  AS++++SSQKLK+ILEIILA GN MNSS+RG +YGF+LQSLDLL DTKS D+  TL+ +  ++V  K+Q +S F +E+ +V++A+ + +E +  DV  L  GM+    E + + N    LK F   NE+    L + A  A++ F  A ++FGE      P VFF +F RF + ++ + E+  +RR Q
Sbjct:  611 LAEGPLKLFSVKIKKPIQTKFRMPVLNWVALKPSQINGTVFNDIDDESILQNLDMEEFEELFKTKAQGPA----VDLTLSRQKLPQKGPSKVSLLEANRAKNLAITLRKAGQ---GSEVICRAIQMFDLRTVRVDFVECLMRFLPTEAEVKLLRQYE-RDRKPLEALSDEDRFMMQFSRIERLSQRMTIMTFMGNFADNVQMLTPQLHAIIAASVSIKSSQKLKKILEIILALGNYMNSSKRGAVYGFKLQSLDLLLDTKSTDRKQTLLHYISNVVREKYQAVSLFYNELHYVDKAAAVSLENVLCDVKELQRGMELTWREFSVSHNAT--LKDFISRNESRLTKLQEDARIAQDAFEDAVKFFGESSKTMPPSVFFPVFVRFIKAYRLADEENEQRRRQ 1000          

HSP 2 Score: 227.254 bits (578), Expect = 1.668e-60
Identity = 163/491 (33.20%), Postives = 268/491 (54.58%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEG--RLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLN---FESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLN--NNGLEVLLDYMS--KTLVLFLN---------INYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKN 1542
            MG+  S  + Q   I S     RL M P   + E+R+   + S+++ P+ VR +   D ++K +L+ +   F+ KNP ++   Y+  ++        RK F ++  +    +L   E+SLRTN++ WV +FLN  N GL+VL++Y+S  +  V F            +  +  ++   +L  +      SS + ++ + +  +++  RS+ +   +  K+S     K+ +H  + C+RAI+N Q G  M   H  A++ IAL L + N +TK LVLE LAA+CL+  G + +L+AF+ FK +  ES RF+ L+      E FK +D NIDF+V+C QFINIVVHS ED+N RV+LQ +FT L LD+   +L+    DRLK Q+ AY  N  DV  LLED+ETK   L   E+LE       E+    ++ +ENE   +L+I++ L+ Q  + +KE   LRE  +   +          ++++L++++ EK+
Sbjct:    1 MGNAESMES-QLAVIRSRAAPVRLPM-PDPAELEERFSIALNSMNLPPDKVRLLRSYDNEKKWELICDQERFQVKNPPHT---YIQKLRGFLDPAVTRKKFRRRVQES-TQMLRELEISLRTNHIGWVREFLNEENRGLDVLVEYLSFAQYAVTFDGEQLEGGSEVASIDSPWSRSIEDLHGECSLPSPSSSISRAARHSISSTLVTRSNTLPSRRTLKNSRLVCKKDDVHVCIMCLRAIMNYQYGFNMVMAHPHAVNEIALSLNNRNPRTKALVLELLAAVCLVRGGHEIILSAFDNFKTVCSESMRFEKLM------EDFKNEDDNIDFLVACMQFINIVVHSVEDMNFRVHLQYDFTKLNLDEHLERLKHTESDRLKVQIQAYLDNVFDVGTLLEDAETKTAALERVEELEESLAGMSER----LLDVENEA--MLKIVE-LEKQLMQTNKELDQLREGYANANS----------QVHTLRRIVREKD 462          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 1904.8 bits (4933), Expect = 0.000e+0
Identity = 1009/1010 (99.90%), Postives = 1010/1010 (100.00%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 3153
            MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDD+KTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF
Sbjct:    1 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 1010          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 1880.53 bits (4870), Expect = 0.000e+0
Identity = 1000/1010 (99.01%), Postives = 1001/1010 (99.11%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 3153
            MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDD+KTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKD         KKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF
Sbjct:    1 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKD---------KKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 1001          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Match: SMESG000040024.1 (SMESG000040024.1)

HSP 1 Score: 1865.51 bits (4831), Expect = 0.000e+0
Identity = 994/1010 (98.42%), Postives = 995/1010 (98.51%), Query Frame = 1
Query:  124 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNINYKNIETKKTLNLQSDTKTHXXXXXXXXXXXXNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 3153
            MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFL               QSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDD+KTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF
Sbjct:    1 MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLK--------------QSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPPPPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYKLPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIPNGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCKSINQLEVSVEVADRILYQLPTNDDIKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKRSNLRYQEEVF 996          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Match: SMESG000044336.1 (SMESG000044336.1)

HSP 1 Score: 383.645 bits (984), Expect = 1.694e-114
Identity = 225/508 (44.29%), Postives = 315/508 (62.01%), Query Frame = 1
Query:  124 MGSTSSKST-PQYKFINSGEGRLEMRPTNLQ-FEKRWDTFIQSLDVGPENVRQIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKPDD--DPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFL------------------NINYKNIETKKTLN-LQSDTKTHXXX-------XXXXXXXXXNCCAS----IKRRSSVVTKFQNSKDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPNYQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRDHETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRNSTDREKELVLEINSLKKVLTEKNI 1545
            MG+    S  P+ K+ NS        P NL+ FEKRW  FIQSLDV P+N++ IDQL+  QK +LLLNFE+KNPK SAFHYVTLIK L   +S + + +K+ D+  +   +LSATE+SLRTN+V+WVYDFL ++GLE+L+DYMS+ L+  +                  + NY++     + N ++SD     +        +    S + +C  S    I R +S V+K   S  +V +S+K  LH  LKC R ILNNQ+GC+MAF +   I+VI +CL+HP+YQTK+L+L+ L+A+CLI  G ++VL AF+ FK +T E +RFDTL+ ++R HET  +DDYNID+ VS  QFINI+VHS E+INLRVYLQ EFT+LGLD F +KL+ER GDRL +QV AY  N VD ++LLED+E KE  + + E+LE +        Q Q+   E EK   +         KE +D+    +R+   E   +  RE EL L + SL+  + + N+
Sbjct:    1 MGNQQQGSPYPRLKYSNSNNEAPP--PQNLEDFEKRWQVFIQSLDVTPQNIQNIDQLEAPQKIELLLNFEAKNPKCSAFHYVTLIKGL---RSYKMTNSKRKDEFQNAKQILSATEISLRTNHVEWVYDFLKHSGLEILVDYMSQILLHLIKSEEMQIFPITMNGTNTISSNYQSTGATISENGIESDFSPQANQSLRRIFDASQRNSTRMSCSKSRSSGINRNTSSVSKNSKSHSAVGDSIKECLHLCLKCFRTILNNQKGCQMAFEYKDTINVITMCLVHPSYQTKSLLLDLLSAVCLIEGGHERVLKAFDLFKVMTREEKRFDTLMYFYRHHETLPLDDYNIDYAVSNMQFINIIVHSVENINLRVYLQYEFTLLGLDSFLKKLQERPGDRLNRQVDAYLDNLVDCSVLLEDAEAKEAFIAECERLEKDISL----LQEQLTLFEAEKARKI---------KEAEDR----VRKAEKELEKAQSREDELSLLVESLRSKIRDINV 486          

HSP 2 Score: 244.973 bits (624), Expect = 2.294e-66
Identity = 168/486 (34.57%), Postives = 262/486 (53.91%), Query Frame = 1
Query: 1777 PVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVG--------DSIPN---------GVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKL--HSDI--------LCKSINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLLTLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQILEIILAYGNLMNSSRRGIMYGFRLQXXXXXXXXXXXXXXWTLMQFFVDIVESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCNTNQ--------PPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQ-NNPTPDVFFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSMEELQKKLALEAXXXXXXXXXXXXQINADGIMDDILAGLDKTPLQAEIHPKRS 3126
            P+  W++L+NQQ  GTVF  ++   +  +L+ + FE IFK+ P+         D+I            ++ N  S   +  + +K +LLD ++ +C+ +++ +L QEKL  H  I        L  +I   +++ E ADR+LYQLP+  +   YR         +N L +EDRL+  L  ++R++ KLE ++Y+  F E Y +L EK+  V  A  +V  SQKLK+ILEI+LA+GN MN SRRG   GFR+QSLD+L + +S D  W+LM +    +E KF +L +F  E+ +VE AS++ +  +      L  G+ +V +E++   N         P RL  F  +N      L      AK  F++  EWFGE+     +PD+FFG   RF ++FKK++ +  +R+           +E  + K K++ ++          E +    R  NRTRQINADGIMD+I+AGLD  PLQA +H +R 
Sbjct:  649 PLIKWNILRNQQ--GTVFEEIDGSQIEKQLDLDGFEKIFKVPPIEHEYDVPPLDTIDGKGLEIQRERNLNDNQLSGDGANDQSDKISLLDPNRQKCIKMVVTYLIQEKLLQHDSISFREWGRPLACAITNFDMASEAADRLLYQLPSFQETDMYRDITGES---LNVLANEDRLVALLSCIDRVEMKLEAILYMDAFDETYFALQEKIRTVALACRSVMESQKLKKILEIVLAFGNRMNDSRRGKAIGFRIQSLDMLPECRSPDDKWSLMNYIAFCIEEKFPDLKNFFSELEYVEDASRVSLCNLMAAFEELSTGLDRVAEELSLIKNAVENNPDLIPTRLVNFVRENITRVNLLRNQTEQAKIAFVKTVEWFGEKDLQTASPDLFFGALVRFMDSFKKAISENARRQM---------GDENNRKKNKERKIN----------EPKGDQTRKKNRTRQINADGIMDEIMAGLDYQPLQAGLHARRG 1110          
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Match: SMESG000040019.1 (SMESG000040019.1)

HSP 1 Score: 137.117 bits (344), Expect = 1.387e-36
Identity = 72/108 (66.67%), Postives = 80/108 (74.07%), Query Frame = 1
Query: 1066 VSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFYRKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFYANEEKYQTQIVHIENEKTELLQ 1389
            VS  QFIN V H G+DIN+RVY+QQEF ILGLDDFY KLEERSGDRL KQV AYNG+RV V IL+ED ETKET L DY          EEKYQ Q V I+N+K +LLQ
Sbjct:   39 VSFAQFINNVTHFGDDINIRVYIQQEFNILGLDDFYIKLEERSGDRLNKQVVAYNGHRVYVIILIEDLETKETDLFDY----------EEKYQAQFVRIDNKKVKLLQ 136          
The following BLAST results are available for this feature:
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FMNL32.273e-13834.06formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698][more]
FMNL33.911e-13733.53formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698][more]
FMNL36.307e-13633.99formin like 3 [Source:HGNC Symbol;Acc:HGNC:23698][more]
FMNL24.479e-6334.08formin like 2 [Source:HGNC Symbol;Acc:HGNC:18267][more]
FMNL13.132e-6034.54formin like 1 [Source:HGNC Symbol;Acc:HGNC:1212][more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frl-15.489e-4530.33FRL (Formin Related gene in Leukocytes) homolog [... [more]
frl-15.489e-4530.33FRL (Formin Related gene in Leukocytes) homolog [... [more]
daam-11.780e-1922.89DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-11.780e-1922.89DAAM (Disheveled-Associated Activator of Morphogen... [more]
daam-11.960e-1922.89DAAM (Disheveled-Associated Activator of Morphogen... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Frl3.357e-5233.42gene:FBgn0267795 transcript:FBtr0114573[more]
Frl4.018e-5233.42gene:FBgn0267795 transcript:FBtr0334053[more]
Frl4.336e-5233.42gene:FBgn0267795 transcript:FBtr0075775[more]
Frl4.647e-5233.42gene:FBgn0267795 transcript:FBtr0075776[more]
DAAM1.598e-3128.85gene:FBgn0025641 transcript:FBtr0070241[more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmnl34.204e-6833.76formin-like 3 [Source:NCBI gene;Acc:407694][more]
fmnl35.029e-6833.20formin-like 3 [Source:NCBI gene;Acc:407694][more]
fmnl2a8.359e-6635.46formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
fmnl37.628e-6534.19formin-like 3 [Source:NCBI gene;Acc:407694][more]
fmnl2a2.551e-6435.23formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gclm7.669e-12533.26glutamate-cysteine ligase, modifier subunit [Sourc... [more]
gclm1.980e-11832.04glutamate-cysteine ligase, modifier subunit [Sourc... [more]
cat.11.024e-6735.59catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-59184... [more]
cat.11.051e-6735.59catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-59184... [more]
cat.11.591e-6735.59catalase, gene 1 [Source:Xenbase;Acc:XB-GENE-59184... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fmnl31.234e-13533.89formin-like 3 [Source:MGI Symbol;Acc:MGI:109569][more]
Fmnl32.088e-13534.77formin-like 3 [Source:MGI Symbol;Acc:MGI:109569][more]
Fmnl32.632e-13434.22formin-like 3 [Source:MGI Symbol;Acc:MGI:109569][more]
Fmnl21.473e-6334.08formin-like 2 [Source:MGI Symbol;Acc:MGI:1918659][more]
Fmnl22.013e-6334.08formin-like 2 [Source:MGI Symbol;Acc:MGI:1918659][more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVF7|FMNL3_HUMAN3.797e-13733.99Formin-like protein 3 OS=Homo sapiens OX=9606 GN=F... [more]
sp|Q6ZPF4|FMNL3_MOUSE8.635e-13533.89Formin-like protein 3 OS=Mus musculus OX=10090 GN=... [more]
sp|Q6NXC0|FMNL3_DANRE5.759e-6434.19Formin-like protein 3 OS=Danio rerio OX=7955 GN=fm... [more]
sp|A2APV2|FMNL2_MOUSE1.408e-6234.08Formin-like protein 2 OS=Mus musculus OX=10090 GN=... [more]
sp|Q96PY5|FMNL2_HUMAN2.375e-6234.08Formin-like protein 2 OS=Homo sapiens OX=9606 GN=F... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I0AYW00.000e+099.31Dishevelled-associated activator of morphogenesis ... [more]
G4M1J20.000e+044.63Formin-like OS=Schistosoma mansoni OX=6183 GN=Smp_... [more]
A0A074ZXZ80.000e+043.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A3Q0KNX00.000e+044.16Formin-like OS=Schistosoma mansoni OX=6183 PE=4 SV... [more]
A0A3R7JKV50.000e+043.95Formin-like protein OS=Clonorchis sinensis OX=7992... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmnl31.486e-13432.99formin-like 3 [Source:NCBI gene;Acc:407694][more]
fmnl2a6.040e-12032.62formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
fmnl2a4.627e-6335.09formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
fmnl2a2.136e-6234.95formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
fmnl2a2.354e-6235.55formin-like 2a [Source:ZFIN;Acc:ZDB-GENE-081105-70... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010834.16.208e-6135.22pep scaffold:Pmarinus_7.0:GL476428:81056:119857:-1... [more]
ENSPMAT00000001635.14.972e-5534.13pep scaffold:Pmarinus_7.0:GL479577:17910:32690:1 g... [more]
ENSPMAT00000000660.14.717e-4237.27pep scaffold:Pmarinus_7.0:GL482229:53:18716:-1 gen... [more]
ENSPMAT00000000664.11.130e-3939.18pep scaffold:Pmarinus_7.0:GL482229:65:18719:-1 gen... [more]
daam1a7.434e-2423.70dishevelled associated activator of morphogenesis ... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328687.015e-2825.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353357.761e-1625.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298313.202e-1327.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353484.865e-1328.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400291.904e-1123.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034540.11.641e-11331.20formin-like protein 1 [Source:NCBI gene;Acc:101165... [more]
ENSORLT00000017623.23.377e-11331.19formin-like protein 1 [Source:NCBI gene;Acc:101165... [more]
ENSORLT00000027976.18.045e-11331.41formin-like protein 1 [Source:NCBI gene;Acc:101165... [more]
fmnl38.257e-6935.06formin like 3 [Source:NCBI gene;Acc:101171244][more]
ENSORLT00000023606.21.670e-6636.75formin-like protein 2 [Source:NCBI gene;Acc:101160... [more]
back to top
BLAST of dishevelled-associated activator of morphogenesis 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040024.10.000e+099.90SMESG000040024.1[more]
SMESG000040024.10.000e+099.01SMESG000040024.1[more]
SMESG000040024.10.000e+098.42SMESG000040024.1[more]
SMESG000044336.11.694e-11444.29SMESG000044336.1[more]
SMESG000040019.11.387e-3666.67SMESG000040019.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005945
GenBankAFH54448.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005945 ID=SMED30005945|Name=dishevelled-associated activator of morphogenesis 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3477bp
TTTAAATATAAATATCCAATTTACCATTTTTATTAATTCCTGTTCAGATG
TTCTTTATTTTCTTATATTGGATTTTACTTTAATATTAGTGATATTTTGA
AAATTATCTTTTAATATCATACAATGGGTTCAACATCCTCAAAATCTACT
CCACAATACAAATTTATTAATAGTGGTGAAGGTCGTTTAGAAATGAGACC
AACAAATTTACAATTTGAAAAACGATGGGATACATTTATTCAATCACTAG
ATGTTGGTCCAGAAAATGTTCGTCAAATCGATCAATTAGATCCAGATCAA
AAAGAACAACTACTTTTAAATTTTGAGTCTAAAAATCCAAAATACTCGGC
ATTTCATTACGTTACTCTGATTAAGGCTCTTCAAACAGGAAAATCAATTC
GAAAGAGTTTTAATAAAAAGCCAGACGATGATCCAGTCCACGTACTTTCG
GCAACTGAGGTTTCATTGAGAACCAATAATGTTGATTGGGTATATGATTT
TCTTAACAACAACGGCTTAGAAGTTCTACTTGATTACATGTCGAAAACTT
TAGTTCTTTTTCTCAACATCAATTACAAAAATATCGAAACCAAAAAAACA
TTGAATTTACAATCTGACACAAAAACTCATTTATCGTCGAGCGATTTGTT
CAAATCCAAGAAATTTAATTGTTGCGCCAGTATCAAGCGACGCTCGAGCG
TTGTGACGAAATTTCAGAATTCGAAAGATTCGGTGAATGAGTCCGTAAAA
AATAGTTTGCACCAAGGCCTGAAATGTATGAGGGCCATCTTAAATAATCA
ACGCGGTTGTGAAATGGCTTTCGTGCATAGCCGGGCGATTGACGTGATTG
CTCTCTGTTTGCTGCATCCGAATTATCAAACCAAAACTCTAGTATTGGAA
ACATTAGCTGCAATTTGCTTGATCGTGAATGGTTTACAGAAGGTGTTGGC
AGCTTTCGAATACTTTAAAGAGATTACTGGGGAAAGTCGAAGATTCGATA
CCCTAATAACTTATTTTCGTGATCATGAAACCTTTAAAGTGGATGATTAT
AATATCGATTTCATGGTATCTTGTACACAATTTATTAATATTGTTGTACA
TTCCGGCGAAGATATCAATTTGCGAGTCTACTTGCAACAAGAATTCACCA
TTTTAGGTTTGGATGACTTCTACAGAAAACTTGAAGAACGGTCAGGTGAC
CGTCTCAAGAAGCAAGTCGCGGCCTATAATGGCAATCGAGTAGATGTAGC
CATTCTACTCGAAGATTCCGAGACAAAAGAAACTGTATTGTTAGACTATG
AGAAATTAGAACACGAATTTTATGCCAATGAAGAGAAATATCAAACTCAA
ATTGTACATATAGAAAACGAAAAAACAGAACTTTTACAAATTATCGATAG
TTTAAAAGCTCAGAAAGAAGAACAAGATAAAGAATATAGAACATTGAGAG
AACAAATTTCTGAACCGAGAAATTCTACAGATAGAGAAAAAGAACTTGTT
TTGGAAATCAATTCGTTGAAAAAAGTCCTTACTGAAAAAAATATTCCATT
TAATAGTTCTGTTCTGACTGAACTTTCACCAAACAAATCGTCTTTGCCAT
TAGCTTCCATATCTCCTCCACCACCGCCAATAGCTCCACCACCGCCAATA
GCACCACCACCTTCCTGTGCACCTCCTCCTCCAGGTCAACCTCCCGGTGT
TTTTAAACTAGGTACTGGTGCTACTAACACTCAAACACAATCTATCAGAC
CTCCAATTCAAACCAAATATAAATTGCCAGTCTTTAACTGGTCAGTATTA
AAAAATCAGCAATTGAAAGGAACAGTATTCGTATCAATGAATGATGAAGT
GCTTTATGATAAATTAGAATTTGAAAAGTTCGAAAATATTTTCAAATTAA
ACCCTGTTGGGGATTCCATCCCAAATGGTGTTGATAGTAATGACTCCAGC
GAGAAAACTAGCAAAAGAAAGCCTGAAAAGAAAACCCTATTGGATGGTAG
CAAACATCGATGTTTGGGGGTTCTTCTTAAATTTTTGGACCAGGAAAAGT
TGCATAGTGATATCTTATGCAAATCCATCAATCAACTAGAGGTCAGTGTC
GAAGTAGCTGACCGTATCCTTTACCAGTTGCCCACAAATGATGACGTCAA
GACATATAGGAGGTATGAATACAGTGATAAATTGCCAATAAATGCACTCA
CTGATGAAGATCGATTATTGCTCACACTTTGTAAAGTAGAACGGTTACAA
CAGAAATTGGAAGTTGTTGTTTATATTCATAACTTTCCGGAAGCTTATAA
AAGTCTTGTCGAAAAAGTCACATTTGTCACTCGAGCTTCATTAGCTGTTC
GGAGTTCTCAAAAACTGAAACAAATTCTTGAAATAATTCTTGCTTACGGA
AATTTAATGAACAGTTCTCGACGCGGCATTATGTATGGGTTCCGGTTGCA
GAGTTTGGATCTATTGACTGATACAAAAAGCCTCGACAAAAGTTGGACAT
TAATGCAGTTCTTTGTCGATATTGTTGAATCGAAATTTCAAAATCTATCA
GATTTTTCTGATGAAATGAGATTTGTCGAGCAAGCCTCGAAAATCCCAAT
GGAAGCGATAACAACTGACGTAGCCTCACTAGTTGGAGGTATGAAGCAAG
TTCGAGATGAAATGAATTGCAATACCAATCAGCCTCCAAGATTGAAAAAA
TTCTTTGAAGACAATGAAAATCTTACTGCAGACTTATCAAAGAGTGCAGC
AAATGCAAAAGAGACATTTTTACAAGCTGCAGAATGGTTTGGAGAGAGAC
AAAACAACCCAACTCCTGACGTTTTCTTTGGAATTTTCCATCGATTCACA
GAAAATTTCAAAAAATCCCTTGAAGATGTTCGTAAAAGGCGGGCACAAAG
CATTATTTTAAATATAGTACCAACAGAAGAGACCCCAAAAGCCAAACCTA
AAGATAAAAATTTATCAATGGAAGAATTACAAAAAAAGCTCGCTTTAGAA
GCTAGAAAAAAGAATCGCCGTATGAATAACAGAACTAGACAAATCAATGC
TGATGGAATAATGGATGACATTTTAGCAGGGCTTGATAAAACTCCTTTAC
AAGCGGAGATACATCCTAAACGTTCAAACCTTAGGTACCAGGAGGAAGTT
TTCTAAAATGTCGCTGATAACCCCTAAATATGGAATTCATTTGGAAATTG
TATATGAAACTTTTAAACTGACACGATCGAAATTTGAACTTTTATTGTAC
AGTTGTATTTCGACGATGCAATGTTTGCGAGATTGTAAAGATTGAAAATA
ATGCAAAAACTGATATTCTACTAGTAACATATTAAAGTTTATGAATACAT
TATTTTCTCTTTTTTTGCGCAATTCTTTCGTAAAAATTTGATTTTTCATT
AGAATTTTCAGAGTGTTTTTATTCGGTACGTAACAATTTTTATTACGGTC
TGTAAAAATGTGAAATATAATTTTGAG
back to top

protein sequence of SMED30005945-orf-1

>SMED30005945-orf-1 ID=SMED30005945-orf-1|Name=SMED30005945-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1011bp
MGSTSSKSTPQYKFINSGEGRLEMRPTNLQFEKRWDTFIQSLDVGPENVR
QIDQLDPDQKEQLLLNFESKNPKYSAFHYVTLIKALQTGKSIRKSFNKKP
DDDPVHVLSATEVSLRTNNVDWVYDFLNNNGLEVLLDYMSKTLVLFLNIN
YKNIETKKTLNLQSDTKTHLSSSDLFKSKKFNCCASIKRRSSVVTKFQNS
KDSVNESVKNSLHQGLKCMRAILNNQRGCEMAFVHSRAIDVIALCLLHPN
YQTKTLVLETLAAICLIVNGLQKVLAAFEYFKEITGESRRFDTLITYFRD
HETFKVDDYNIDFMVSCTQFINIVVHSGEDINLRVYLQQEFTILGLDDFY
RKLEERSGDRLKKQVAAYNGNRVDVAILLEDSETKETVLLDYEKLEHEFY
ANEEKYQTQIVHIENEKTELLQIIDSLKAQKEEQDKEYRTLREQISEPRN
STDREKELVLEINSLKKVLTEKNIPFNSSVLTELSPNKSSLPLASISPPP
PPIAPPPPIAPPPSCAPPPPGQPPGVFKLGTGATNTQTQSIRPPIQTKYK
LPVFNWSVLKNQQLKGTVFVSMNDEVLYDKLEFEKFENIFKLNPVGDSIP
NGVDSNDSSEKTSKRKPEKKTLLDGSKHRCLGVLLKFLDQEKLHSDILCK
SINQLEVSVEVADRILYQLPTNDDVKTYRRYEYSDKLPINALTDEDRLLL
TLCKVERLQQKLEVVVYIHNFPEAYKSLVEKVTFVTRASLAVRSSQKLKQ
ILEIILAYGNLMNSSRRGIMYGFRLQSLDLLTDTKSLDKSWTLMQFFVDI
VESKFQNLSDFSDEMRFVEQASKIPMEAITTDVASLVGGMKQVRDEMNCN
TNQPPRLKKFFEDNENLTADLSKSAANAKETFLQAAEWFGERQNNPTPDV
FFGIFHRFTENFKKSLEDVRKRRAQSIILNIVPTEETPKAKPKDKNLSME
ELQKKLALEARKKNRRMNNRTRQINADGIMDDILAGLDKTPLQAEIHPKR
SNLRYQEEVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042201FH2_Formin_sf
IPR010472FH3_dom
IPR015425FH2_Formin
IPR010473GTPase-bd
IPR014768GBD/FH3_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0017048Rho GTPase binding
GO:0005488binding
GO:0003779actin binding
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
GO:0016043cellular component organization
GO:0007010cytoskeleton organization
GO:0008360regulation of cell shape
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 410..444
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 601..620
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 432..454
NoneNo IPR availablePANTHERPTHR45857FAMILY NOT NAMEDcoord: 22..995
NoneNo IPR availableSUPERFAMILYSSF101447Formin homology 2 domain (FH2 domain)coord: 498..925
IPR010472Formin, FH3 domainSMARTSM01139Drf_FH3_2coord: 269..467
e-value: 4.3E-27
score: 106.0
IPR010472Formin, FH3 domainPFAMPF06367Drf_FH3coord: 270..454
e-value: 8.4E-24
score: 84.3
IPR015425Formin, FH2 domainSMARTSM00498it6_sourcecoord: 541..1004
e-value: 2.2E-56
score: 203.3
IPR015425Formin, FH2 domainPFAMPF02181FH2coord: 543..913
e-value: 2.0E-71
score: 241.1
IPR015425Formin, FH2 domainPROSITEPS51444FH2coord: 541..938
score: 54.324
IPR010473Formin, GTPase-binding domainSMARTSM01140Drf_GBD_2coord: 23..266
e-value: 2.2E-32
score: 123.6
IPR010473Formin, GTPase-binding domainPFAMPF06371Drf_GBDcoord: 170..266
e-value: 8.2E-12
score: 45.1
IPR042201Formin, FH2 domain superfamilyGENE3DG3DSA:1.20.58.2220coord: 533..925
e-value: 6.1E-97
score: 326.8
IPR014768Rho GTPase-binding/formin homology 3 (GBD/FH3) domainPROSITEPS51232GBD_FH3coord: 23..456
score: 19.003
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 32..408