P2X purinoceptor

Overview
NameP2X purinoceptor
Smed IDSMED30005937
Length (bp)380
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of P2X purinoceptor (SMED30005937) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for P2X purinoceptor (SMED30005937) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005937

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig4272newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig4272uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig9486newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig9486uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig27024newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000046807.1 Contig27024uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000078148.1 Contig4272newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005937SMESG000078148.1 Contig4272uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30005937 dd_Smed_v4_16290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005937 dd_Smed_v4_16290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005937 dd_Smed_v4_16290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005937 dd_Smed_v4_16290_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005937 dd_Smed_v6_16290_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 65.4698 bits (158), Expect = 5.329e-13
Identity = 36/78 (46.15%), Postives = 47/78 (60.26%), Query Frame = 1
Query:    1 KGRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY +    E RTL K +G+R  I V G   KF I    +NIGSG+ LL  ATV+CD+I+ + + KR  Y
Sbjct:  263 PGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYY 340          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 65.4698 bits (158), Expect = 6.025e-13
Identity = 36/78 (46.15%), Postives = 47/78 (60.26%), Query Frame = 1
Query:    1 KGRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY +    E RTL K +G+R  I V G   KF I    +NIGSG+ LL  ATV+CD+I+ + + KR  Y
Sbjct:  290 PGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYY 367          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 65.4698 bits (158), Expect = 6.099e-13
Identity = 38/79 (48.10%), Postives = 48/79 (60.76%), Query Frame = 1
Query:    1 KGRNFRYANYYERD--DKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY RD    E RTL K +G+R  I V G   KF I    +NIGSG+ LL  ATV+CD+I+ + + KR  Y
Sbjct:  306 PGYNFRFAKYY-RDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYY 383          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX1 (purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:HGNC:8533])

HSP 1 Score: 61.2326 bits (147), Expect = 1.628e-11
Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFR+A ++  +   YR L+KVFG+R  I V G   KF I      IGSGIG+   ATV+CDL++   +PKR  Y
Sbjct:  288 GFNFRFARHFVENGTNYRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYY 363          
BLAST of P2X purinoceptor vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 58.9214 bits (141), Expect = 1.206e-10
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFR+A YY+ +    RTL K +G+RI + V G   KFS+    +N+ + +  +   + +CD I+  F+ K K Y
Sbjct:  206 GYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNKNKVY 281          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 77.411 bits (189), Expect = 1.945e-17
Identity = 40/105 (38.10%), Postives = 59/105 (56.19%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQISADHE 318
            G NFR+A YY  +  + RTL KVFG+RI I V G   KF I      IGSG+G+   ATVVCDL++ + +PK+  Y    +++ +I +      +T+    +  E
Sbjct:  294 GYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTMKFKDAEICEETPALPQTQEDSESQKE 398          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 76.6406 bits (187), Expect = 3.915e-17
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTE 294
            G NFR+A YY  +  + RTL KVFG+RI I V G   KF I      IGSG+G+   ATVVCDL++ + +PK+  Y    +++ +I +      +T+
Sbjct:  263 GYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTMKFKDAEICEETPALPQTQ 359          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 76.2554 bits (186), Expect = 6.398e-17
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTE 294
            G NFR+A YY  +  + RTL KVFG+RI I V G   KF I      IGSG+G+   ATVVCDL++ + +PK+  Y    +++ +I +      +T+
Sbjct:  294 GYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTMKFKDAEICEETPALPQTQ 390          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:ZFIN;Acc:ZDB-GENE-030319-1])

HSP 1 Score: 76.2554 bits (186), Expect = 6.398e-17
Identity = 39/97 (40.21%), Postives = 57/97 (58.76%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTE 294
            G NFR+A YY  +  + RTL KVFG+RI I V G   KF I      IGSG+G+   ATVVCDL++ + +PK+  Y    +++ +I +      +T+
Sbjct:  294 GYNFRFAKYYVENSVQKRTLMKVFGVRIDIIVHGLAGKFDIIPTLTAIGSGVGIFGVATVVCDLLLLYILPKKNFYKTMKFKDAEICEETPALPQTQ 390          
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 64.6994 bits (156), Expect = 6.708e-13
Identity = 32/83 (38.55%), Postives = 48/83 (57.83%), Query Frame = 1
Query:    4 GRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYE 249
            G NFR+A YY +   + YR L+KV+G+R  I V G   +FSI    +NIGSG+ L+      CD+I+ + + K   Y +  +E
Sbjct:  290 GYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSKSSFYRETKFE 372          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: P2RX1 (purinergic receptor P2X, ligand gated ion channel, 1 [Source:NCBI gene;Acc:100485618])

HSP 1 Score: 83.1889 bits (204), Expect = 2.232e-19
Identity = 45/104 (43.27%), Postives = 59/104 (56.73%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQISAD 312
            +G NFR+A YY+ D    RTL+KVFG+R  I V G G KF I      IGSGIG+   ATVVCDL++   +PKR  Y          K+ K +  KT  ++S +
Sbjct:  288 QGFNFRHARYYKEDGVSKRTLFKVFGIRFDILVNGQGGKFDIIPTMTTIGSGIGIFGVATVVCDLMLLHVLPKRNYY----------KEKKFKQAKTAQKVSQN 381          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: P2RX1 (purinergic receptor P2X, ligand gated ion channel, 1 [Source:NCBI gene;Acc:100485618])

HSP 1 Score: 83.1889 bits (204), Expect = 2.871e-19
Identity = 46/108 (42.59%), Postives = 60/108 (55.56%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQISADHELI 324
            +G NFR+A YY+ D    RTL+KVFG+R  I V G G KF I      IGSGIG+   ATVVCDL++   +PKR  Y          K+ K +  KT  + S + E +
Sbjct:  286 QGFNFRHARYYKEDGVSKRTLFKVFGIRFDILVNGQGGKFDIIPTMTTIGSGIGIFGVATVVCDLMLLHVLPKRNYY----------KEKKFKQAKTAQKDSQEKEEV 383          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: P2RX1 (purinergic receptor P2X, ligand gated ion channel, 1 [Source:NCBI gene;Acc:100485618])

HSP 1 Score: 82.0333 bits (201), Expect = 6.743e-19
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            +G NFR+A YY+ D    RTL+KVFG+R  I V G G KF I      IGSGIG+   ATVVCDL++   +PKR  Y
Sbjct:  286 QGFNFRHARYYKEDGVSKRTLFKVFGIRFDILVNGQGGKFDIIPTMTTIGSGIGIFGVATVVCDLMLLHVLPKRNYY 362          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 68.9366 bits (167), Expect = 3.112e-14
Identity = 37/100 (37.00%), Postives = 53/100 (53.00%), Query Frame = 1
Query:    4 GRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQ 300
            G NFR+A YY + +  +YRTL K +G+R  I V G   KF+I    +NIGSG+ LL      CDL++ + + K   Y D  +E        + NLK   +
Sbjct:  294 GYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFEEVKSASKMSLNLKVNGK 393          
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 65.855 bits (159), Expect = 4.201e-13
Identity = 34/83 (40.96%), Postives = 48/83 (57.83%), Query Frame = 1
Query:    4 GRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYE 249
            G NFR+A YY + +  +YRTL K +G+R  I V G   KF+I    +NIGSG+ LL      CDL++ + + K   Y D  +E
Sbjct:  294 GYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSNFYRDKKFE 376          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 63.5438 bits (153), Expect = 1.622e-12
Identity = 34/70 (48.57%), Postives = 44/70 (62.86%), Query Frame = 1
Query:    4 GRNFRYANYYERD--DKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTW 207
            G NFR+A YY RD    E RTL K +G+R  I V G   KF I    +N+GSG+ LL  ATV+CD+I+ +
Sbjct:  291 GYNFRFAKYY-RDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLY 359          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:MGI Symbol;Acc:MGI:2137026])

HSP 1 Score: 63.5438 bits (153), Expect = 1.852e-12
Identity = 43/115 (37.39%), Postives = 64/115 (55.65%), Query Frame = 1
Query:    4 GRNFRYANYYERDDK--EYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTE-NLKTE-NQISAD-HELIPLE 333
            G NFR+A YY RD    E+R L K +G+R  + V G   KFSI    +NIGSG+ L+      CDL++ + + K + Y D  +E   ++  K E N++ E N++  +  E  PLE
Sbjct:  292 GYNFRFARYY-RDPHGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEK--VRGQKEEDNVEVEANEMEQELPEDKPLE 403          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 61.2326 bits (147), Expect = 1.065e-11
Identity = 32/68 (47.06%), Postives = 42/68 (61.76%), Query Frame = 1
Query:    1 KGRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIM 201
             G NFR+A YY +    E RTL K +G+R  I V G   KF I    +N+GSG+ LL  ATV+CD+I+
Sbjct:  263 PGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIV 330          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx7 (purinergic receptor P2X, ligand-gated ion channel, 7 [Source:MGI Symbol;Acc:MGI:1339957])

HSP 1 Score: 59.6918 bits (143), Expect = 4.049e-11
Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWF 210
            G NFRYA YY+ ++ E RTL K FG+R  I V G G KF I    + IGS +     ATV  DL++  +
Sbjct:  287 GYNFRYAKYYKENNVEKRTLIKAFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLATVCIDLLINTY 355          
BLAST of P2X purinoceptor vs. Ensembl Mouse
Match: P2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:MGI Symbol;Acc:MGI:1098235])

HSP 1 Score: 58.5362 bits (140), Expect = 1.207e-10
Identity = 34/76 (44.74%), Postives = 46/76 (60.53%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFR+A ++ ++    R L+KVFG+R  I V G   KF I      IGSGIG+   ATV+CDL++   +PKR  Y
Sbjct:  288 GFNFRFARHFVQNGTNRRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVATVLCDLLLLHILPKRHYY 363          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.938e-12
Identity = 35/70 (50.00%), Postives = 45/70 (64.29%), Query Frame = 1
Query:    4 GRNFRYANYYERD--DKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTW 207
            G NFR+A YY RD   KE RTL K +G+R  I V G   KF I    +N+GSG+ LL  ATV+CD+I+ +
Sbjct:  291 GYNFRFAKYY-RDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLY 359          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 2.893e-12
Identity = 36/78 (46.15%), Postives = 47/78 (60.26%), Query Frame = 1
Query:    1 KGRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY +    E RTL K +G+R  I V G   KF I    +NIGSG+ LL  ATV+CD+I+ + + KR  Y
Sbjct:  290 PGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKRLYY 367          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|P51578|P2RX5_RAT (P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 GN=P2rx5 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 7.976e-12
Identity = 35/109 (32.11%), Postives = 59/109 (54.13%), Query Frame = 1
Query:    4 GRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYE---------NYDIKDSKTENLKTENQ 300
            G NFR+A YY + +  E+R L K +G+R  + V G   KFSI    +NIGSG+ L+      CDL++ + + K + Y D  +E         N +++ ++ E  + E++
Sbjct:  292 GYNFRFARYYRDPNGVEFRDLMKAYGIRFDVIVNGKAGKFSIIPTVINIGSGLALMGAGAFFCDLVLIYLIRKSEFYRDKKFEKVRGQKEDANVEVEANEMEQERPEDE 400          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q9JJX6|P2RX4_MOUSE (P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.113e-11
Identity = 34/70 (48.57%), Postives = 44/70 (62.86%), Query Frame = 1
Query:    4 GRNFRYANYYERD--DKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTW 207
            G NFR+A YY RD    E RTL K +G+R  I V G   KF I    +N+GSG+ LL  ATV+CD+I+ +
Sbjct:  291 GYNFRFAKYY-RDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLY 359          
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.239e-11
Identity = 33/68 (48.53%), Postives = 43/68 (63.24%), Query Frame = 1
Query:    1 KGRNFRYANYY-ERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIM 201
             G NFR+A YY +    E+RTL K +G+R  I V G   KF I    +NIGSG+ LL  ATV+CD+I+
Sbjct:  290 PGYNFRFAKYYSDLKGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIV 357          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A3L5TUM1 (p2x 4 purinoceptor (Fragment) OS=Mytilus galloprovincialis OX=29158 GN=AM593_06438 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.552e-18
Identity = 43/104 (41.35%), Postives = 65/104 (62.50%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIY------ENYDIKDSKTENLKTE 294
            KG NFRYA YY+ +DKEYRTL+K FG++ ++ V G   KF++    +N+GSG+ +L  ATV+CD+++ +F+  R  Y D  Y      + Y   D + E  K+E
Sbjct:  100 KGYNFRYAKYYKENDKEYRTLFKAFGIKFILSVTGEAGKFNLEPFLINVGSGLAILGMATVICDIVVLYFLKARNLYKDKKYLQVVGDDAYKQLDDQNEEDKSE 203          
BLAST of P2X purinoceptor vs. TrEMBL
Match: V9KU17 (P2X purinoceptor OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 7.682e-18
Identity = 48/101 (47.52%), Postives = 61/101 (60.40%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQIS 306
            G NFRYA YY  D  E R LYKVFG+R  I V+G   KF++   ++ IGSGIG+   ATVVCDL++  F+PKR  Y          K  K +N +T+ QIS
Sbjct:  288 GFNFRYARYYREDGIEKRDLYKVFGIRFDIMVQGKAGKFNLLQTTVAIGSGIGVFGLATVVCDLVLLNFLPKRDYY----------KQKKFKNAETKPQIS 378          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A3P8VSC7 (P2X purinoceptor OS=Cynoglossus semilaevis OX=244447 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.332e-17
Identity = 47/103 (45.63%), Postives = 62/103 (60.19%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCD--FIYENYDIKDSKTENLKTENQIS 306
            G NFRYA YY  D  + RTL KVFG+RI I V+    KF I      IGSG+G+   ATVVCDL++ + +PKR+ Y D  F Y    ++D +TE    E ++S
Sbjct:  266 GYNFRYAKYYVEDKIKKRTLLKVFGIRIDIIVQSLARKFDIIPTLTAIGSGVGIFGVATVVCDLMLLYLLPKREFYKDMKFKYAETYVQDPETEPGSMETELS 368          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A401NL77 (Uncharacterized protein (Fragment) OS=Scyliorhinus torazame OX=75743 GN=scyTo_0011341 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.439e-17
Identity = 39/76 (51.32%), Postives = 50/76 (65.79%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFRYA YY+ +  E R LYKVFG+R+ + V G   KF+I    M IGSG+G+   AT+VCDL+M   +PKR  Y
Sbjct:  123 GFNFRYAKYYQENGTEMRDLYKVFGIRLDVLVNGKAGKFNIIPTMMTIGSGVGVFGVATLVCDLVMLHMLPKRNYY 198          
BLAST of P2X purinoceptor vs. TrEMBL
Match: A0A3P8VSB9 (P2X purinoceptor OS=Cynoglossus semilaevis OX=244447 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.753e-17
Identity = 47/103 (45.63%), Postives = 62/103 (60.19%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCD--FIYENYDIKDSKTENLKTENQIS 306
            G NFRYA YY  D  + RTL KVFG+RI I V+    KF I      IGSG+G+   ATVVCDL++ + +PKR+ Y D  F Y    ++D +TE    E ++S
Sbjct:  286 GYNFRYAKYYVEDKIKKRTLLKVFGIRIDIIVQSLARKFDIIPTLTAIGSGVGIFGVATVVCDLMLLYLLPKREFYKDMKFKYAETYVQDPETEPGSMETELS 388          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 81.6481 bits (200), Expect = 5.660e-19
Identity = 43/98 (43.88%), Postives = 57/98 (58.16%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTEN 297
            G NFR A YY  D  E RTL KVFGLRI I V G   KF I      IGSG+G+   ATVVCDL++ + +PKR  Y +  ++   ++D +    + E+
Sbjct:  287 GYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFKYTTVQDEENAEDQHEH 384          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 80.8777 bits (198), Expect = 1.021e-18
Identity = 42/89 (47.19%), Postives = 53/89 (59.55%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDS 270
            G NFR A YY  D  E RTL KVFGLRI I V G   KF I      IGSG+G+   ATVVCDL++ + +PKR  Y +  ++   ++D 
Sbjct:  287 GYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRDFYKNMKFKYTTVQDE 375          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 65.4698 bits (158), Expect = 3.344e-13
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKE-YRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFRYA+Y++    E +RTL KV+G+R  I+V G   KF+I    +NIGSG+ L+   +  CD+++ + + K   Y
Sbjct:  293 GYNFRYAHYFKNPAGETHRTLLKVYGIRFDIQVHGRAGKFNIIPTIINIGSGLALMGAGSFFCDMVLLYMMKKSTLY 369          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 63.929 bits (154), Expect = 1.048e-12
Identity = 34/78 (43.59%), Postives = 48/78 (61.54%), Query Frame = 1
Query:    1 KGRNFRYANYYERDD-KEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY+  + +E RTL K +G+R  I V G   KF++    +NIG+G+GL+   TVVCD  +  F+ KR  Y
Sbjct:  357 PGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLY 434          
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 63.929 bits (154), Expect = 1.118e-12
Identity = 34/78 (43.59%), Postives = 48/78 (61.54%), Query Frame = 1
Query:    1 KGRNFRYANYYERDD-KEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
             G NFR+A YY+  + +E RTL K +G+R  I V G   KF++    +NIG+G+GL+   TVVCD  +  F+ KR  Y
Sbjct:  357 PGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVLVFMRKRHLY 434          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.101e-13
Identity = 35/85 (41.18%), Postives = 52/85 (61.18%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDK--EYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYE 249
             G NFR+  YY +D K  E RTL K +G+R ++EV G   K S+    +++GSG+GLL    V+CDLI+ +   K + Y + +YE
Sbjct:  256 PGYNFRFPKYY-KDAKGIETRTLVKAYGIRFMVEVIGQAGKASLLRSLISLGSGVGLLGMVWVICDLIVLFCCRKSRIYREQLYE 339          
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 1.407e-7
Identity = 30/76 (39.47%), Postives = 44/76 (57.89%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFR+A Y  +D  E R+L KV+G+R  + V G   KFSI    +N+G+G+ LL     +CDL + +   +  QY
Sbjct:  292 GHNFRFARYSWQDGAETRSLLKVYGVRFDVMVSGKAGKFSIVPTLLNLGAGLALLGAGAFLCDLFLLYASKESPQY 367          
BLAST of P2X purinoceptor vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 80.4925 bits (197), Expect = 5.539e-19
Identity = 37/93 (39.78%), Postives = 66/93 (70.97%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTE 279
            KG NFR+ANYY ++D  +RTL+K +G+R ++ V G G KF++    +N+GSG+ LL+ ATV+CD+++ + + +++ Y +  Y+ Y +++S  E
Sbjct:  296 KGYNFRHANYYVKNDTLHRTLFKAYGIRFVVTVTGQGGKFNVVPLFLNLGSGLALLSIATVLCDVVVLYVLRRKEFYREKKYQ-YVVENSSDE 387          
BLAST of P2X purinoceptor vs. Ensembl Nematostella
Match: EDO43233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ68])

HSP 1 Score: 46.595 bits (109), Expect = 4.340e-7
Identity = 25/83 (30.12%), Postives = 40/83 (48.19%), Query Frame = 1
Query:   40 DDK-----EYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSK 273
            DDK     E R   K +G++I     G   +FS+    + + SG+GLL     + D    + +P R QY +F+YE   + D +
Sbjct:  295 DDKTLTRPEKRLFRKRYGIKIEFHQSGKLGRFSLPALLLKLVSGVGLLTLTATIVDTAALYLLPDRFQYREFVYEESPVIDKR 377          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 78.5666 bits (192), Expect = 6.029e-18
Identity = 44/101 (43.56%), Postives = 58/101 (57.43%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDI----KDSKTENLKTE 294
            G NFRYA YY  D  E RTL KVFG+R  I V+  G KF I      IGSG+G+   ATVVCDL++ + +P+R  Y +  ++  D      D  T ++KT 
Sbjct:  290 GYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFYKNMKFKYTDTAAQDPDLDTGSIKTS 390          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 78.1814 bits (191), Expect = 9.209e-18
Identity = 39/76 (51.32%), Postives = 48/76 (63.16%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            G NFRYA YY  D  E RTL KVFG+R  I V+  G KF I      IGSG+G+   ATVVCDL++ + +P+R  Y
Sbjct:  290 GYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRDFY 365          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 65.4698 bits (158), Expect = 3.130e-13
Identity = 37/95 (38.95%), Postives = 56/95 (58.95%), Query Frame = 1
Query:    4 GRNFRYANYYERDDKE-YRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYE--NYDIKDSKTE 279
            G NFR+A YY+ +  E YRTLYKV+G+R  I + G   KF+I    + IGSG+ L+     VCD+I+ + +     Y +  +E  N+  + SKT+
Sbjct:  287 GYNFRHARYYKDEKGETYRTLYKVYGIRFDIMINGQAGKFNIVPTIIAIGSGVALMGIGAFVCDMILLYMMNTSSFYRERKFEIINFKKERSKTK 381          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx3a (P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153])

HSP 1 Score: 63.1586 bits (152), Expect = 2.270e-12
Identity = 31/78 (39.74%), Postives = 47/78 (60.26%), Query Frame = 1
Query:    1 KGRNFRYANYYERDD-KEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            KG NFR+A YY+ ++  E+RTL+K F +R  + V GN  KFS     +N+ +    +   TV+CD+I+  F+   KQY
Sbjct:  284 KGYNFRFAKYYKTENGTEFRTLHKAFAIRFDVMVTGNAGKFSTIPTLINLVAAFTSIGLGTVICDIILLNFLKGAKQY 361          
BLAST of P2X purinoceptor vs. Ensembl Medaka
Match: p2rx3b (purinergic receptor P2X 3 [Source:NCBI gene;Acc:101174325])

HSP 1 Score: 55.8398 bits (133), Expect = 7.823e-10
Identity = 31/93 (33.33%), Postives = 53/93 (56.99%), Query Frame = 1
Query:    4 GRNFRYANYYERDD-KEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTE 279
            G NFR+A YY+ ++  +YRTL K + +R  + V GN  KF++    +N+ +    +   TV+CD+I+  F+   +QY    +E  ++ DS  E
Sbjct:  280 GYNFRFAKYYKMENGTDYRTLIKAYAIRFDVIVNGNAGKFNMIPTLINMVAAFTSVGVGTVLCDIILLNFLKGAEQYKAKKFE--EVSDSPEE 370          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046751.1 (SMESG000046751.1)

HSP 1 Score: 134.42 bits (337), Expect = 1.588e-38
Identity = 61/114 (53.51%), Postives = 81/114 (71.05%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQISADHELIPLEEKI 342
            KG NFRYANYYER++KE+R L+KV+GLRILIEVRG   K S FT SMN+GSGI LL  AT+VCD IM WF+PKR++YC+ +YE +DI +           ++ +    P++E +
Sbjct:  297 KGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIMQWFLPKREKYCEIVYEYHDINNCDK---PPSVNMAINEHFPPIKEPL 407          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046895.1 (SMESG000046895.1)

HSP 1 Score: 110.538 bits (275), Expect = 1.212e-29
Identity = 58/109 (53.21%), Postives = 74/109 (67.89%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTE-NLKTENQISADHELI 324
            KG NFR+ANYY  + +EYR LYKVFGLRIL EVRG   KFS  T +MNIGSG+ LLA ATV+CD I+ + +P R++Y    YE ++  D+  E N  TE+  + D E I
Sbjct:  297 KGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIILFLMPNREKYFQSKYELHNDDDAYQELNENTESNEALDIESI 405          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.127e-24
Identity = 47/77 (61.04%), Postives = 57/77 (74.03%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQY 231
            KG NFRYANY+E D  E+R LYKVFGLRILIEVRG   KFS+ T SMNIGSG+ LL+ A  VCD+++     K+ +Y
Sbjct:  297 KGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKDKY 373          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.912e-20
Identity = 41/57 (71.93%), Postives = 46/57 (80.70%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLA 171
            KG NFRYANY+E D  E+R LYKVFGLRILIEVRG   KFS+ T SMNIGSG+ LL+
Sbjct:  297 KGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLS 353          
BLAST of P2X purinoceptor vs. Planmine SMEST
Match: SMESG000028996.1 (SMESG000028996.1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.125e-19
Identity = 38/86 (44.19%), Postives = 55/86 (63.95%), Query Frame = 1
Query:    1 KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIGSGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYD 258
            KG NFR+ANYY  ++ +YR L K +G+R +I V     KFSI   +MN+GSG+ LLA AT++CD I+ + +  R +Y +  Y   D
Sbjct:  288 KGWNFRHANYYYINETQYRDLIKAYGIRFVISVSSKAGKFSIIPLTMNLGSGLALLAIATIICDFIVLYILRNRSKYIEAKYHLID 373          
The following BLAST results are available for this feature:
BLAST of P2X purinoceptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX45.329e-1346.15purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX46.025e-1346.15purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX46.099e-1348.10purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX11.628e-1146.05purinergic receptor P2X 1 [Source:HGNC Symbol;Acc:... [more]
P2RX21.206e-1035.53purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx11.945e-1738.10purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx13.915e-1740.21purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx16.398e-1740.21purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx16.398e-1740.21purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx56.708e-1338.55purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX12.232e-1943.27purinergic receptor P2X, ligand gated ion channel,... [more]
P2RX12.871e-1942.59purinergic receptor P2X, ligand gated ion channel,... [more]
P2RX16.743e-1951.95purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx53.112e-1437.00purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx54.201e-1340.96purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx41.622e-1248.57purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx51.852e-1237.39purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx41.065e-1147.06purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx74.049e-1144.93purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx11.207e-1044.74purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51577|P2RX4_RAT1.938e-1250.00P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q99571|P2RX4_HUMAN2.893e-1246.15P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|P51578|P2RX5_RAT7.976e-1232.11P2X purinoceptor 5 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q9JJX6|P2RX4_MOUSE1.113e-1148.57P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2r... [more]
sp|Q5E9U1|P2RX4_BOVIN1.239e-1148.53P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
back to top
BLAST of P2X purinoceptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3L5TUM11.552e-1841.35p2x 4 purinoceptor (Fragment) OS=Mytilus galloprov... [more]
V9KU177.682e-1847.52P2X purinoceptor OS=Callorhinchus milii OX=7868 PE... [more]
A0A3P8VSC71.332e-1745.63P2X purinoceptor OS=Cynoglossus semilaevis OX=2444... [more]
A0A401NL771.439e-1751.32Uncharacterized protein (Fragment) OS=Scyliorhinus... [more]
A0A3P8VSB91.753e-1745.63P2X purinoceptor OS=Cynoglossus semilaevis OX=2444... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx15.660e-1943.88purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx11.021e-1847.19purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx83.344e-1340.26purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a1.048e-1243.59purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a1.118e-1243.59purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007719.11.101e-1341.18pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000008095.11.407e-739.47pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO413635.539e-1939.78P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO432334.340e-730.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of P2X purinoceptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx16.029e-1843.56purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx19.209e-1851.32purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx53.130e-1338.95P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx3a2.270e-1239.74P2X purinoceptor 3 [Source:NCBI gene;Acc:101165153... [more]
p2rx3b7.823e-1033.33purinergic receptor P2X 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046751.11.588e-3853.51SMESG000046751.1[more]
SMESG000046895.11.212e-2953.21SMESG000046895.1[more]
SMESG000046729.11.127e-2461.04SMESG000046729.1[more]
SMESG000046729.11.912e-2071.93SMESG000046729.1[more]
SMESG000028996.13.125e-1944.19SMESG000028996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005937 ID=SMED30005937|Name=P2X purinoceptor|organism=Schmidtea mediterranea sexual|type=transcript|length=380bp
AAAGGGAGGAATTTCAGATATGCAAATTATTATGAAAGAGATGATAAAGA
ATATAGAACACTTTATAAGGTTTTTGGTCTAAGAATACTTATTGAGGTTC
GTGGCAATGGTCACAAATTCAGCATATTTACATGCTCAATGAATATTGGT
TCTGGAATTGGTTTATTAGCTACAGCCACAGTTGTCTGTGATTTAATTAT
GACATGGTTTGTGCCGAAAAGAAAGCAATATTGCGATTTTATTTATGAGA
ATTACGACATCAAGGATTCTAAGACTGAGAATTTAAAAACCGAAAATCAG
ATTTCTGCTGACCACGAATTAATTCCATTAGAAGAAAAAATATAAATAGA
TTAAAAAGTACTTGTAAAATATATATGGAC
back to top

protein sequence of SMED30005937-orf-1

>SMED30005937-orf-1 ID=SMED30005937-orf-1|Name=SMED30005937-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
KGRNFRYANYYERDDKEYRTLYKVFGLRILIEVRGNGHKFSIFTCSMNIG
SGIGLLATATVVCDLIMTWFVPKRKQYCDFIYENYDIKDSKTENLKTENQ
ISADHELIPLEEKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004931extracellular ATP-gated cation channel activity
GO:0001614purinergic nucleotide receptor activity
GO:0005216ion channel activity
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027309P2X_extracellular_dom_sf
IPR001429P2X_purnocptor
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0033198response to ATP
GO:0006810transport
GO:0006811ion transport
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.940coord: 34..58
e-value: 4.3E-17
score: 64.2
NoneNo IPR availablePFAMPF00864P2X_receptorcoord: 1..80
e-value: 6.3E-22
score: 78.2
NoneNo IPR availablePANTHERPTHR10125P2X PURINOCEPTORcoord: 1..92
NoneNo IPR availableTMHMMTMhelixcoord: 43..65
IPR027309P2X purinoreceptor extracellular domain superfamilyGENE3DG3DSA:2.60.490.10coord: 1..33
e-value: 4.3E-17
score: 64.2