TNF receptor-associated factor 2

Overview
NameTNF receptor-associated factor 2
Smed IDSMED30005935
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor 2 (SMED30005935) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor 2 (SMED30005935) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 2 (SMED30005935) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 2 (SMED30005935) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005935

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005935SMESG000070131.1 SMESG000070129.1 dd_Smed_v4_5689_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30005935SMESG000070131.1 SMESG000070129.1 Contig51373newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30005935SMESG000070131.1 SMESG000070129.1 Contig51373uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005935SMESG000070131.1 SMESG000070129.1 dd_Smed_v4_5689_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 91.2781 bits (225), Expect = 5.776e-19
Identity = 84/350 (24.00%), Postives = 163/350 (46.57%), Query Frame = 1
Query:  310 IIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++V C  K C  +  L   +S H+  C   P  C F   GC   +  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:  200 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 91.2781 bits (225), Expect = 5.776e-19
Identity = 84/350 (24.00%), Postives = 163/350 (46.57%), Query Frame = 1
Query:  310 IIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++V C  K C  +  L   +S H+  C   P  C F   GC   +  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:  200 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 85.5001 bits (210), Expect = 3.425e-17
Identity = 98/447 (21.92%), Postives = 195/447 (43.62%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCA----KNELMNDEMKAH------FSEDNYYHNKLLIDLI----NNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            +FV      KE   +TV +     KC+ C+ +L +     CG RFC  C+   L  +   C      C++ ++             I   +I  +  ++ C  +  L  +  H++        C F E+ C     K +++  +++ H      + E    H K  + +I    +  +NE       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:   31 VFVPEQGGYKEKFVKTVED---KYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTA----CQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKN------DCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 446          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 81.2629 bits (199), Expect = 9.130e-16
Identity = 98/451 (21.73%), Postives = 182/451 (40.35%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICP--------FH-----EIGCAKNELMNDEMKAHFS-EDNYYHNK--LLIDLINNFRNEM---ESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFD-----ACYI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L  A   PCG RFC  CI   +      CP  ++      I   N +  DN     I  ++VKC  + C  K EL  + +H   C+   + CP        FH        C + ++  D   A  + ED   H++   L ++I  + N +   E M N          ++          F         Q+N          L++  +S++  + + +  +            +N+++  H+L   +  + D +   ++     +  +   +   I  ++ ++ EIE++  N  +    GNF   ++    +K   I+S  FY+ + GYK+C+ L ++       A YI  + H M+G +D+   WPF+ ++ + ++DQ    V Q+        P+   + +P   RN      + F  ++       +K+D +LVRC V
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHY--------DLDCPTAPIPCTFSTFGCHEKMQRNHLAR-----HLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLE-GRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 81.2629 bits (199), Expect = 9.130e-16
Identity = 98/451 (21.73%), Postives = 182/451 (40.35%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICP--------FH-----EIGCAKNELMNDEMKAHFS-EDNYYHNK--LLIDLINNFRNEM---ESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFD-----ACYI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L  A   PCG RFC  CI   +      CP  ++      I   N +  DN     I  ++VKC  + C  K EL  + +H   C+   + CP        FH        C + ++  D   A  + ED   H++   L ++I  + N +   E M N          ++          F         Q+N          L++  +S++  + + +  +            +N+++  H+L   +  + D +   ++     +  +   +   I  ++ ++ EIE++  N  +    GNF   ++    +K   I+S  FY+ + GYK+C+ L ++       A YI  + H M+G +D+   WPF+ ++ + ++DQ    V Q+        P+   + +P   RN      + F  ++       +K+D +LVRC V
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHY--------DLDCPTAPIPCTFSTFGCHEKMQRNHLAR-----HLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLE-GRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 60.4622 bits (145), Expect = 1.871e-9
Identity = 43/169 (25.44%), Postives = 74/169 (43.79%), Query Frame = 1
Query:  919 QMQMVEIE-SKFENKHFGNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRND-GIWFNDI---DIQLDSPAVKNDQVLVRCRVEKEK 1371
            Q+QM++   SK    + G   WKI + S +        G  + S PFY+ Q GYK+  S+ +  +         +Y  V+ G +D +  WPF HS+T  + +Q   +        +   P    + +P N+ +  G  F      ++    P +K D V +R +V+  K
Sbjct:  305 QIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 473          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 60.4622 bits (145), Expect = 1.902e-9
Identity = 43/169 (25.44%), Postives = 74/169 (43.79%), Query Frame = 1
Query:  919 QMQMVEIE-SKFENKHFGNFNWKIENLSRQ-------KGSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRND-GIWFNDI---DIQLDSPAVKNDQVLVRCRVEKEK 1371
            Q+QM++   SK    + G   WKI + S +        G  + S PFY+ Q GYK+  S+ +  +         +Y  V+ G +D +  WPF HS+T  + +Q   +        +   P    + +P N+ +  G  F      ++    P +K D V +R +V+  K
Sbjct:  314 QIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKVDPSK 482          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 89.3521 bits (220), Expect = 1.658e-18
Identity = 72/354 (20.34%), Postives = 155/354 (43.79%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELN-IEKSCKNDGKSTNVSKSENDE----EKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG---IWFNDIDIQLDSPAVKNDQVLVRCRVE 1362
            +S+H   C K  + C F   GC+   L N EM+ H S     H +++         ++E + +++      + ++     + ++Q++ +  ++   + K   M+  +S   E    VE   ++++ +    + E++ L+ + E ++  ++ ++ SC N    ++   S   +    +    + D ++  + +++  +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F VMRG +D +  WPFK  VT+ ++DQ     +     K    P  + + +P  + N       F    +  +   +K+D + ++  V+
Sbjct:  220 LSSHQHDCPKAQVTCSFIRYGCSYKGL-NQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMRE-EVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFN---GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDAFKPD--PSSSSFRRPTGEMNIASGCPLFVAQTVLENGTYIKDDTIFIKVTVD 566          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 77.0258 bits (188), Expect = 1.460e-14
Identity = 112/491 (22.81%), Postives = 192/491 (39.10%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTC-----------DKRPI-----------------------------------ICPFHEIGC--AKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS--------DLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L +A   PCG RFC  CI   +    + CP  ++      +     +  DN     I  + VKC+   C  K EL  +  H+  C           +  PI                                    CPF    C   + EL+ D++  H   D      L   +   F     + G + +  RNE+    +E  Q   ++    L+S    N  C M S        D         + +  Q+ + L ET  + E   ++Q+ +Q++ EL I     ND +   V++           +  K+ +++    E+E++   ++ G + W++EN S     ++ G  I  +S PFY+ + GYK+CL L ++  +         ++ H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        VK D +LVRC V
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDC-----LKAPVACTF----STFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNN--CTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQD-QQIR-ELCIH----NDTQKNQVTE-----------LRRKLVSLEESTRELEAQ---QYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ-HHIEVMETK--PDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 77.0258 bits (188), Expect = 1.460e-14
Identity = 112/491 (22.81%), Postives = 192/491 (39.10%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTC-----------DKRPI-----------------------------------ICPFHEIGC--AKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS--------DLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L +A   PCG RFC  CI   +    + CP  ++      +     +  DN     I  + VKC+   C  K EL  +  H+  C           +  PI                                    CPF    C   + EL+ D++  H   D      L   +   F     + G + +  RNE+    +E  Q   ++    L+S    N  C M S        D         + +  Q+ + L ET  + E   ++Q+ +Q++ EL I     ND +   V++           +  K+ +++    E+E++   ++ G + W++EN S     ++ G  I  +S PFY+ + GYK+CL L ++  +         ++ H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        VK D +LVRC V
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDC-----LKAPVACTF----STFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNN--CTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQD-QQIR-ELCIH----NDTQKNQVTE-----------LRRKLVSLEESTRELEAQ---QYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ-HHIEVMETK--PDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 77.0258 bits (188), Expect = 1.460e-14
Identity = 112/491 (22.81%), Postives = 192/491 (39.10%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTC-----------DKRPI-----------------------------------ICPFHEIGC--AKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS--------DLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L +A   PCG RFC  CI   +    + CP  ++      +     +  DN     I  + VKC+   C  K EL  +  H+  C           +  PI                                    CPF    C   + EL+ D++  H   D      L   +   F     + G + +  RNE+    +E  Q   ++    L+S    N  C M S        D         + +  Q+ + L ET  + E   ++Q+ +Q++ EL I     ND +   V++           +  K+ +++    E+E++   ++ G + W++EN S     ++ G  I  +S PFY+ + GYK+CL L ++  +         ++ H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        VK D +LVRC V
Sbjct:   70 ECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDC-----LKAPVACTF----STFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNN--CTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQD-QQIR-ELCIH----NDTQKNQVTE-----------LRRKLVSLEESTRELEAQ---QYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQ-HHIEVMETK--PDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 75.8702 bits (185), Expect = 3.345e-14
Identity = 65/293 (22.18%), Postives = 116/293 (39.59%), Query Frame = 1
Query:  373 HIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKS---QREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            H ++C K    C F EIGC +  + N + + H       H +L++ L+++ R   E  G   E +           +   +  ++      +   +                    +QKK+  +E       +E+++     E +  +  +++            K EN   K +Q+ +  +    +Q+ E E       F    G F WKI   SR++          ++S  FYS + GYKMCL L +  D         ++F VM+G +D +  WPF   VT+ ++DQ N
Sbjct:  229 HTKSCAKSKSACQFREIGC-RAVVDNCKQQEHEQTSIMEHLRLMLALLSSMRLRAEGAGEWQEDV----------GLGLYRGPEDAPPAGAHNVGRG---------------GGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQE-----------KIENLSNKVRQL-ERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNN 483          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 85.8853 bits (211), Expect = 3.086e-17
Identity = 76/327 (23.24%), Postives = 144/327 (44.04%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDL-------INNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQII---DGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++ H+  C   P  C F   GC      N ++KAH +     H  L+ +        ++  +NE       ++ L N++ + + E  + K+Q  N   + I  Q +  E ++D          ++ + K+I+ +  ++  E D +K NYE L++ L+  +    +  S N    E    +  Q++   D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  V++ ++DQ     +     K    P+ + + KP  + N
Sbjct:  213 LNAHLLECVNAPSTCSFKRYGCTFKG-TNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQ-RVIEGQAD---------KLKDLDKEIRNLR-QTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMN 522          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 83.1889 bits (204), Expect = 2.135e-16
Identity = 69/346 (19.94%), Postives = 141/346 (40.75%), Query Frame = 1
Query:  361 MISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQF--KQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            M +++   C   PI C ++E GC +    ND +  H  E    H +++   + +F + +    +               +I F    QF+          +     ++D +          ++++ I+ +E +  R+  Q+++   +++ +       K+  +S +    E + ++   I   +INN                   FN  ++N   ++   I+S  FY+ + GYK+CL L ++  +      YI  + H M+G +D++  WP + ++ + ++DQ  G   Q +       P+   + +P   RN      + F  +        VKND +LVRC V
Sbjct:  229 MPAHYSMDCTMAPIPCMYYEFGCTEKMQRND-LARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHM-------------PDISFCDPSQFEPAPPSVATVHSSHTPSQNDCT------QETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINN-------------------FNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 79.7221 bits (195), Expect = 3.192e-15
Identity = 101/479 (21.09%), Postives = 188/479 (39.25%), Query Frame = 1
Query:   85 VNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGN-----------------------------EKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHI-RTCDKR-----------PII---------CPFHEIGCA---------KNELMNDEMKAHFSEDNYYHNKLLIDL-------INNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQII---DGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            +  +    KC+ C  +L N     CG RFC  C+   L                                + FC   ++ CK+ +      I + +          + C   +C+ K     +S+HI +TC  R           P++         CP   I C          ++E  N ++KAH +     H  L+ +        ++  +NE       ++ L N++ + + E  + K+Q  N   + I  Q +  E ++D          ++ + K+I+ +  ++  E D +K NYE L++ L+  +    +  S N    E    +  Q++   D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  V++ ++DQ     +     K    P+ + + KP  + N
Sbjct:   39 LKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEE----LSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQ-RVIEGQAD---------KLKDLDKEIRNLR-QTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDAFKPD--PNSSSFKKPTGEMN 497          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 73.9442 bits (180), Expect = 1.678e-13
Identity = 83/366 (22.68%), Postives = 160/366 (43.72%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMG---------NKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQR-EIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFE----NKHFGNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN--DGIWFNDIDIQLDSPA----VKNDQVLVRCRVE 1362
            +  H+  C +  + C F   GC    +M    K    ED +  + +L  L  N + E + +G         ++++ L + +   ++E  QF Q F   +  S++         S  +L   I+ ++   ++ IQL+  +  R ++  +    E  K  L+  ++ K+        + +N + +FK+  D  ++N +MQM   E +F       + G   WKI +  R+K          I+S  FY+   GY++C    +  D         +YF VM+G FD+I  WPFK  VT+ ++DQ     + +   +    P+ + + +P ++ N   G        QL++P     +K+D + ++  V+
Sbjct:  140 LDKHLCECPEAELQCTFSNYGC---NVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQ-FTGSNGNSLS---------STKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKD--------RIDNLDGQFKKH-DVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 481          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 71.2478 bits (173), Expect = 1.349e-12
Identity = 82/366 (22.40%), Postives = 159/366 (43.44%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMG---------NKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQR-EIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFE----NKHFGNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN--DGIWFNDIDIQLDSPA----VKNDQVLVRCRVE 1362
            +  H+  C +  + C F   GC    +M    K    ED +  + +L  L  N + E + +          ++++ L + +   ++E  QF Q F   +  S++         S  +L   I+ ++   ++ IQL+  +  R ++  +    E  K  L+  ++ K+        + +N + +FK+  D  ++N +MQM   E +F       + G   WKI +  R+K          I+S  FY+   GY++C    +  D         +YF VM+G FD+I  WPFK  VT+ ++DQ     + +   +    P+ + + +P ++ N   G        QL++P     +K+D + ++  V+
Sbjct:  191 LDKHLCECPEAELQCTFSNYGC---NVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQ-FTGSNGNSLS---------STKTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKD--------RIDNLDGQFKKH-DVLLSNHKMQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVD 532          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 92.0485 bits (227), Expect = 2.549e-19
Identity = 84/350 (24.00%), Postives = 163/350 (46.57%), Query Frame = 1
Query:  310 IIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++V C  K C  +  L   +S H+  C   P  C F   GC   +  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:  199 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 82.4185 bits (202), Expect = 3.291e-16
Identity = 101/480 (21.04%), Postives = 201/480 (41.88%), Query Frame = 1
Query:   85 VNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKH-----------CKKKMXXXXXX---XXXXXXXXXXXSEIIVKCTTKNCEFKDELCM------------ISNHI-RTCDKR-----------PII---------CPFHEIGCA---------KNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            V  +    KC+ C  +L N     CG RFC  C+   L  +   C    +            CK++++             A  + +  ++V    + C+F++  C+            + +H+ + C  R           P+I         CP   + C          ++E  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:   43 VKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNE-CQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 82.4185 bits (202), Expect = 3.291e-16
Identity = 101/480 (21.04%), Postives = 201/480 (41.88%), Query Frame = 1
Query:   85 VNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKH-----------CKKKMXXXXXX---XXXXXXXXXXXSEIIVKCTTKNCEFKDELCM------------ISNHI-RTCDKR-----------PII---------CPFHEIGCA---------KNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            V  +    KC+ C  +L N     CG RFC  C+   L  +   C    +            CK++++             A  + +  ++V    + C+F++  C+            + +H+ + C  R           P+I         CP   + C          ++E  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:   43 VKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHLKNE-CQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 77.411 bits (189), Expect = 1.188e-14
Identity = 103/471 (21.87%), Postives = 190/471 (40.34%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCD---------KRP---------II--CPFHEIGCA--KNELMNDEMKAHFSEDNY------YHNKLLI--DLINNFRNEMES---------MGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFD-----ACYI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L  A   PCG RFC  CI   +      CP  ++      I   N +  DN     I  + VKC  K C  K EL  + +H   C+         +RP         II  CP  ++ C      +  +E + H            Y   +LI   + N++  +  +          G   +  RN +    +EN Q   +    ++ ++N   + C+  S     +  + N E   + I+ +E++  R+  Q++            E + K + +S  V +           +   I  ++ ++ E+E++  N  +    GNF   +++   ++   I+S  FY+ + GYK+C+ L ++       A YI  + H M+G +D+   WPF+ ++ + ++DQ    + Q+        P+   + +P   RN      + F  ++       +K+D +LVRC V
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYE---ETIKQLESRLVRQDHQIR------------ELTAKMETQSMYVGE-----------LKRTIRTLEDKVAEMEAQQCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 70.0922 bits (170), Expect = 1.987e-12
Identity = 63/291 (21.65%), Postives = 126/291 (43.30%), Query Frame = 1
Query:  400 IICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQN---YEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVE---IESKFEN-------KHF-GNFNWKIENLSRQ-------KGSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            I+CPF  +GC+        M+ H +     H  LL+ ++  +++   S             N+    +  ++    + LQ+      A E   DL +        ES Q+++ L     ++ + QL++    +  +   LN E    +   + ++ +S+ D E    + + ++  +Q  + +   +  K E+         F G F WKI N++++       +   ++S  FY+ + GYK+CL L +  D         ++  +MRG +D +  WPF++ VT  ++DQ N
Sbjct:   79 IMCPFAGVGCSFKG-SPQSMQEHEATSQSSHLYLLLAVLKEWKSSPGS-------------NLGSAPMALERNLSELQLQA------AVEATGDLEVDCYRAPCCES-QEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLALAASIHQSQLDREHILSL-EQRVVELQQTLAQKDQVLGKLEHSLRLMEEASFDGTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNN 347          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.783e-18
Identity = 84/350 (24.00%), Postives = 163/350 (46.57%), Query Frame = 1
Query:  310 IIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++V C  K C  +  L   +S H+  C   P  C F   GC   +  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:  199 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 2.774e-18
Identity = 84/350 (24.00%), Postives = 163/350 (46.57%), Query Frame = 1
Query:  310 IIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNK-------MESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQ--REIDQLKQNYEQLKHEL----NIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            ++V C  K C  +  L   +S H+  C   P  C F   GC   +  N ++KAH +     H  LL +  N+   ++  + N+       ++SL N+I + +   I+ ++Q + +     N ++K       L L++ I+S  E +++  + I    Q   E D +K + E L++ +    +++KS     ++T + +S+ +  ++   + D ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F +MRG +D +  WPFK  VT+ ++DQ +   +     K    P+ + + KP  + N
Sbjct:  200 VVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV-FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFE---IEIERQKEMLR----NNESKI------LHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN---GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 8.276e-17
Identity = 82/352 (23.30%), Postives = 146/352 (41.48%), Query Frame = 1
Query:  361 MISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQRE-IDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-------RQKGSRIYSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            M S++   C   PI C ++E GC +    ND +  H  +    H +++   + +F     S                           +IS    NQ          LS+     S++ S Q   Q  ET++ RE I+QL+    +  H++  E   K + + T V++           +   I +++ ++++++    N   G F WKI+  S        +K   I+S  FY+ + GYK+CL L ++  +      YI  + H M+G +D++  WP   ++ + ++DQ  G + Q +       PD   + +P   RN      + F  ++       VKND + VRC V
Sbjct:  229 MPSHYSMDCTMAPIPCMYYEFGCTEKMQRND-LARHLQDFTQAHMRMMFQTLRSFSTTPTS------------------------HISDISFCDPNQFEPV-----PLSVAPAHPSHMPSHQDCSQ--ETRNLRETIEQLEGRLVRQDHQIR-ELIAKMETQCTYVNE-----------LKHTIRSLEDKLLDVDGHHCN---GVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLNTLKQRQYVKNDTLFVRCAV 533          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.247e-15
Identity = 69/346 (19.94%), Postives = 141/346 (40.75%), Query Frame = 1
Query:  361 MISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQF--KQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            M +++   C   PI C ++E GC +    ND +  H  E    H +++   + +F + +    +               +I F    QF+          +     ++D +          ++++ I+ +E +  R+  Q+++   +++ +       K+  +S +    E + ++   I   +INN                   FN  ++N   ++   I+S  FY+ + GYK+CL L ++  +      YI  + H M+G +D++  WP + ++ + ++DQ  G   Q +       P+   + +P   RN      + F  +        VKND +LVRC V
Sbjct:  229 MPAHYSMDCTMAPIPCMYYEFGCTEKMQRND-LARHLQEFTQAHMRMMAQTLRSFSSSVTPTSHM-------------PDISFCDPSQFEPAPPSVATVHSTHTPSQNDCT------QETRNLRETIEQLEGRLVRQDHQIRELIAKMETQCTYVNELKHTIRSLDNRLGEMESQQCSGIFIWRINN-------------------FNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 4.385e-15
Identity = 98/451 (21.73%), Postives = 182/451 (40.35%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICP--------FH-----EIGCAKNELMNDEMKAHFS-EDNYYHNK--LLIDLINNFRNEM---ESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFD-----ACYI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L  A   PCG RFC  CI   +      CP  ++      I   N +  DN     I  ++VKC  + C  K EL  + +H   C+   + CP        FH        C + ++  D   A  + ED   H++   L ++I  + N +   E M N          ++          F         Q+N          L++  +S++  + + +  +            +N+++  H+L   +  + D +   ++     +  +   +   I  ++ ++ EIE++  N  +    GNF   ++    +K   I+S  FY+ + GYK+C+ L ++       A YI  + H M+G +D+   WPF+ ++ + ++DQ    V Q+        P+   + +P   RN      + F  ++       +K+D +LVRC V
Sbjct:   69 ECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHY--------DLDCPTAPIPCTFSTFGCHEKMQRNHLAR-----HLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLE-GRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.473e-38
Identity = 121/460 (26.30%), Postives = 217/460 (47.17%), Query Frame = 1
Query:   46 NVWNLMKENKFETVNE-INRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEM----ESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGN---------FNWKIENLS--RQKGSRIYSNPFYSEQSGYKMCLSLQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWP-DHAGWVKPLNDRNDGIWFNDIDIQL----DSPAV-KNDQVLVRCRV 1359
            NV  L+ +   + V+E +N DL C +CN+L+ +AC + CGC +C  CI  YL  N  +CPG    CK+  +N   D+  +  ++ RIS I+VKC    C +  EL  +  H+  C    + CP   IGC +  L+ DEM  H ++    H +L++   N  ++E+    E+    +  L+  +   K  N +   Q + +  +  N+ N    +  D          ++ ++ ++  + T  + E+ +LK + +  + E+      KND +    +  +N  +  K+ I G   NI     E E K  N    N         F W+IE  S  R+  + +YS+ F S    YK CL+L I  D   ++  +M+G  D+   WP + +VT+ +I+Q +   +++   +Y  +  +   + +P ++RND     D  ++     ++P +  ND ++V C V
Sbjct:    8 NVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVLRVQKALNDEKTAQMEFLIEELRNKDNMILVLSQD----------IQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEF---MKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRTVTDVYSDSFQSH--NYKFCLNLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 7.995e-24
Identity = 60/174 (34.48%), Postives = 98/174 (56.32%), Query Frame = 1
Query:   58 LMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEI 579
            L+    FE    +  +LKC +C  LL+NAC + CGCRFCS CI  Y+     +CPG +  CK++ +   ++I  D  +N +I+++ VKC  + C+   EL  I  H+R C  +   CPF  +GC + +++  ++  H     + H+KL+ID+I+N RN+   +  K   LR +I
Sbjct:    9 LLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDI 182          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: I3WEV1 (Tumor necrosis factor receptor-associated factor 3 OS=Pinctada fucata OX=50426 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 2.185e-21
Identity = 77/331 (23.26%), Postives = 153/331 (46.22%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNF-------RNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELN-IEKSCKNDGKSTNVSKSENDEEKFKQII--DGKINNIQMQMVEIESKFE----NKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN 1275
            +  H+ TC KRP  C +H +GC   E  ++E++ H  +D   H +L+     N        R E++ M  + ++ R  + ++ R+  + K+  D++ +Q  + + K       +     +E  VE + KK  +   +  R++  +++    +   +  +E    + G     +   N      Q+   + ++    +++ E++ +F+      + G   WKI++ SR+K   I       YS PFY+ ++GYKMC  + +  D         ++F +MRG +D + +WPFK  VT+ ++DQ  G  + S T +    P  + + KP  + N
Sbjct:  171 LEAHLITCPKRPQRCRYHSVGCT-FEGTSEEVQQHERDDTDRHLELITMYTANMDLQSLEVRRELQDMSLERDNSRRLLDDVSRQMAEIKRSMDDMKIQVRDVKLKIVSQTERII---HVERKVEDLAKKDSV--DRHARDLQVIRETQASMSERIRQLEGRAPSQGNPAVPAIEGNTGSVVPQVQQHERQLGLQDIRLAELDLRFQVLETASYDGTLIWKIKDYSRRKQDAITGRTLSLYSQPFYTSRTGYKMCARVYLNGDGMGRGTHLSLFFVIMRGEYDTLLSWPFKQKVTLMLLDQDTGTRHLSDTFRPD--PSSSSFRKPTTEMN 493          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: A0A1S3K6C1 (TNF receptor-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106179037 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.040e-19
Identity = 89/389 (22.88%), Postives = 173/389 (44.47%), Query Frame = 1
Query:   76 FETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDEL-CMISNHIRTCDKRPIICPFHEIGCAKNELMND-EMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKG-------SRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGN 1197
            F    EI    KC+ C  +L +A   PCG R C+ C+E    G  + CP     C +        I  D A+   +  ++V C    C++  +L     NH R+C  R +     +   A  +L  +  M A   E       L  ++ +  +  +E+M  ++  +    + ++   +Q +Q  + +    IN++  +   +S     +++  N+++++ K+  +E      +  + ++ E+    L  +++ +   +   +  SE+  +  +++I  +  ++  Q + I++     + G F WKI  +SR++        S +YS  FY+   GYKMC  L +  D         ++F VMRG +D +  WPFK  VT  ++DQ N N
Sbjct:  262 FTRPEEIKEHFKCRSCQLVLRDAVQTPCGHRHCAGCVERSRSGGGRLCP----DCPEIDEMDDRQIYPDMAVRREVHRLLVACRQTGCDWTGDLKTYQQNHERSCLSRRVTTSEDDSSDAICKLQTEAAMLAQMDEIRQRVEDLQKEVGHKQQTGVEAMTRRVGEME---VGLQECRVQVQQLEEKVV--EINRREPSTPGESSTVRVEQMRDNLKTLEHKLSTLEGM----VAAIARDIEKTSALLESQEATRRV-QEERLKSSEDKVKALERVIALRDISMAEQDLRIQALESASYNGVFLWKITEVSRKRHDAVSGRVSSLYSPAFYTSAHGYKMCCRLYLNGDGMGKGTHVSLFFVVMRGHYDALLRWPFKQKVTCILLDQNNLN 636          
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Match: A0A291RBW5 (TRAF3 OS=Sinanodonta woodiana OX=1069815 GN=TRAF3 PE=2 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.956e-19
Identity = 87/383 (22.72%), Postives = 173/383 (45.17%), Query Frame = 1
Query:  325 TTKNCEFKDELCM----ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYH-------------NKL-LIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEM--KSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSE-NDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFN----WKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN--DGIWFNDIDIQLDSPA-VKNDQVLVR 1350
             T  C+F     M    I  H+ +C ++P  C F  IGC       +E+  H   D  +H             N+L LI+ I     E + +  ++E  + E+ ++K +    K    +  ++ ++Q  +  ++  KS+ ++++++    E   +++Q+        I +L++    L+            G    V   E ND ++   + D + +N+ +++ E++ +F+     +++    WKI + +R+K   I       YS PFYS + GYKMC  + +  D         ++F VMRG +D +  WPF+  VT+ ++DQ++G  + S T K    P  + + +P  + N   G         L++P  +K+D + ++
Sbjct:  176 ATTTCKFCGAGPMKRREIQGHLESCPRKPKECRFKVIGCTYMA-TEEEVSNHEINDGVHHMEILSIFVTNSGLNRLQLINQIQEIAAERDGLKRRLEQHKEELASLKSQVEALKTASKDAKMRMVSQTERIIQLERKSEDTVKRDVMERCEQQTRELQVT-------IRELREKLTLLERRPATGVGSSEAG--VQVRPEELNDMKQQLTMHDRQFHNLDVRLAELDLRFQVLETASYDGILLWKIRDYTRRKQEAITGKTLSLYSQPFYSSRFGYKMCARVYLNGDGMGKNTHMSLFFVVMRGEYDALLPWPFQQKVTLMLLDQQSGQRHLSDTFKPD--PASSSFKRPTTEMNIASGCPLFVSHSVLETPTYIKDDIIFIK 546          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 85.1149 bits (209), Expect = 2.585e-17
Identity = 109/457 (23.85%), Postives = 194/457 (42.45%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNEL---MNDEMKAHF------SEDNYYHNKLLID------LINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQF--DNISLQSIN-----QQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +C IC   L +A   PCG RFC+ CI   +    + CP  ++      +   + +  DN     I  + V+C    C  K EL  + NHI  C    + CP  +    K+EL   +N E           +E+  Y  K L        L           G + + LRN++    +E  Q   ++  D +  Q+IN         A             E   +  Q+  Q+ ET  + E   ++Q+     H+L  E S +N+ +ST +++           +  K+ +++  M E++++   ++ G + W++E  S     ++ G  +  +S PFY+ + GYK+CL L ++         YI  + H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        V++D ++VRC V
Sbjct:   69 ECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQD-----HKLR-ELSIRNETQSTQMTE-----------LRKKLASLEESMRELQAQ---QYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ-HHVEVMETK--PDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 496          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 82.4185 bits (202), Expect = 2.386e-16
Identity = 81/351 (23.08%), Postives = 152/351 (43.30%), Query Frame = 1
Query:  364 ISNHIRT-CDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +++H  T C K P+ C F   GC +  L ND +  H  E    H + + D+                 LRN+ IN    +          S  + ++   AC+   +L                 Q+ ET  + E   ++Q+     H+L  E S +N+ +ST +++           +  K+ +++  M E++++   ++ G + W++E  S     ++ G  +  +S PFY+ + GYK+CL L ++         YI  + H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        V++D ++VRC V
Sbjct:  227 LASHCDTDCLKAPVACTFSIFGCREKMLRND-LALHMQEFTQMHMRYMADV-----------------LRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQ----------------QMRETVLELESRLVRQD-----HKLR-ELSIRNETQSTQMTE-----------LRKKLASLEESMRELQAQ---QYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ-HHVEVMETK--PDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 82.4185 bits (202), Expect = 2.386e-16
Identity = 81/351 (23.08%), Postives = 152/351 (43.30%), Query Frame = 1
Query:  364 ISNHIRT-CDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS-----RQKGSRI--YSNPFYSEQSGYKMCLSLQIRFDAC-----YI--YFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            +++H  T C K P+ C F   GC +  L ND +  H  E    H + + D+                 LRN+ IN    +          S  + ++   AC+   +L                 Q+ ET  + E   ++Q+     H+L  E S +N+ +ST +++           +  K+ +++  M E++++   ++ G + W++E  S     ++ G  +  +S PFY+ + GYK+CL L ++         YI  + H M+G FD+  +WP + ++ + V+DQ  G  +  + M+    PD   + +P   RN      + F  +        V++D ++VRC V
Sbjct:  227 LASHCDTDCLKAPVACTFSIFGCREKMLRND-LALHMQEFTQMHMRYMADV-----------------LRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQ----------------QMRETVLELESRLVRQD-----HKLR-ELSIRNETQSTQMTE-----------LRKKLASLEESMRELQAQ---QYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQ-HHVEVMETK--PDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRGFVRDDVLMVRCEV 520          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 79.337 bits (194), Expect = 2.552e-15
Identity = 65/308 (21.10%), Postives = 136/308 (44.16%), Query Frame = 1
Query:  370 NHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESM-GNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSC-----KNDGKSTNVSKSENDEEKFKQ----IIDGKINNIQ-------MQMVEIESKFEN----KHFGNFNWKIENLSRQ-------KGSRIYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            +HI+ C K    C FH +GC  + +  +++  H    +Y H  LL+  I   +  +ES+    +E   ++I  + +   + + +   +S  +  Q   A       +L         ++   ++L     + ++ +L +  ++L+ ++   ++      +   +S    ++ N + +  Q    I++ K+  ++       + +VE+E K        + G F WKI + S++       +   ++S  FY+ + GYKMCL + +  D         ++F VMRG  D +  WPF   VT+ ++DQ N
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMS-VEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHKIQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPTTVGAALELQLHSEKTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN 510          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 76.6406 bits (187), Expect = 1.873e-14
Identity = 72/359 (20.06%), Postives = 158/359 (44.01%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCA-KNELMNDEMKAHFSEDNYYH-------NKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLS-LRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKND-GKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQK--GSRIYSNPFYSEQSGYKMCLSLQI------RFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAG--WVKPLNDRNDGIWF------NDIDIQLDSPAVKNDQVLVRCRVE 1362
            + +H   C ++   C + + GC  +N+    ++K H   +  +H       N  LI  ++  + +  +   +++     + N+KRE  +       +      Q+     +K +L  LR  +E+++             ++ E+  L+ + + L+ ++ + +S +   G      +S        +++D  +  +Q      +      + G   WK+ +  R+K  G+ + S PFY+  SGYK+   + +      R     +Y  +MRG FD++  WPF+ +VT+ V+DQ +GN      +  S  PD A   + +P ++ N  + F       D++   ++  V++D + ++ +V+
Sbjct:  210 LKDHADECPEQETDCIYKKYGCTVRNK--RGQVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADL-------------TKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHT------RLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQ-SGN---RNHVSLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 4.366e-19
Identity = 81/356 (22.75%), Postives = 154/356 (43.26%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRN-EMESMGNKMESLRNEIINMKRENIQFKQQFD-NISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREID--QLKQNYEQLKHELN-IEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSR-------IYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRVEK 1365
            +S H+  C     +C FH +GC   +  ++ ++ H       H  L+I      RN E+E    +++    +  NM     Q   Q + ++S  S    +    + S L +  +    ++S+     + +   QR+ D   L+++   L+  L  +E +  N G      +    E++   + DG ++  + ++  +E+     + G   WKI + +R+K          +YS PFY+   GYKMC    +  D         ++F VMRG +D +  WPF+  VT+ ++DQ     + S T  ++  P    + +P  D N      ++ + + ++  S  V +D V VR  V+ 
Sbjct:   77 LSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVIS-----RNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLH----VAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEE--RCHMHEQRLT-MHDGLLDTAERRLQVLETA---GYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLV-DDTVFVRVVVDP 414          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 3.569e-16
Identity = 80/367 (21.80%), Postives = 158/367 (43.05%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLL------IDL-INNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFD-NISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQR-EIDQLKQNYEQLKHELN-IEKSCKNDGKSTNVSK--------SENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRN--DGIWFNDIDIQLDSPA-VKNDQVLVRCRVE 1362
            + +H+  C  +   C F + GC     +   +K H S     H  L+      ++L ++  ++++    N  + L   +  +++E I   Q    N S+  + Q+  A + +  L L+       ES+Q   +  +  + R ++D       +L   +  IE+S  +   S+  ++        S +D + F    D ++  + ++   +E+   N   G   WKI + +R+K   +       YS PFY+   GY+MC    +  D         ++F VMRG +D +  WPF+  VT+ ++DQ       S T K    P  + + +P +D N   G       + L+S + +++D + ++  V+
Sbjct:  119 LVSHLGICPYKQAECFFSQFGCKYKGTLQG-LKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQ-------ESMQGTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAH--DTRLAEMDLRFQVLETASYN---GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPD--PASSSFRRPTSDMNIASGCPLFVSHVALESASYLQDDTIFIKVVVD 470          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 65.855 bits (159), Expect = 1.042e-11
Identity = 72/369 (19.51%), Postives = 140/369 (37.94%), Query Frame = 1
Query:  385 CDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEI----INMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSR-----------------QKGSRIYSNPFYSEQSGYKMCLSLQI-------------------RFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIW----FNDIDIQLDSPAVKNDQVLVRCRV 1359
            C +  + C F  +GC + +++   + AH  E    H +LL + +   R ++        +  +      ++          Q    S    ++   AC+   +L   +EI   +E             +R + QL Q  E          S K D +   ++++              + +++ ++ E ES+      G F W++E  SR                    + ++S+ FY+   GY++CL LQ+                   R     ++ H+++G +D+   WPFK  + I V+DQ   +      M  +D P  + + +P   RN   +    F DI+       +++D ++VRC V
Sbjct:  232 CQQAQVPCTFSPLGC-EAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLE-------------ERVVLQLHQIRE---------LSAKTDNQQGLLAEATR-----------LVRSLEARVAESESRLCA---GIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD-PQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 89.7373 bits (221), Expect = 3.147e-19
Identity = 78/351 (22.22%), Postives = 150/351 (42.74%), Query Frame = 1
Query:  331 KNCEFKDELCM----------ISNHIRTCDKRPIICPF-HEIGCAKNELMN--------------------------DEMKAHFSEDNYYHNKLLIDLINN---FRNEMESMGNKMESLR----------NEIINMKRENIQFKQQFDNISLQSINQQNK-ACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKI--NNIQMQMVEIESKFENKHFGNFNWKIENLSRQ-------KGSRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQ 1185
            + CEFK   C           + +H++TC+K P++CP     G  ++EL++                          + ++ HF +    H  LL+    N    R+EM +  ++ME  R           E + +  +N++  Q   N+  +S+ +Q +   E+K  + L +E+E+ +    +++ +IE ++ R                       + G +  + + ++  E    + D ++  +++++QM+E  S     + G + WKI+  +R+       K   IYS PFY  + GYK C  +    D         ++F +MRG FD +  WPF+  VT  ++DQ
Sbjct:  133 ERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQL-QEVEAAIREQDRRLGMIENEASRGAAP--------------SSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATS-----YDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ 463          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 78.9518 bits (193), Expect = 8.691e-16
Identity = 95/449 (21.16%), Postives = 188/449 (41.87%), Query Frame = 1
Query:  109 KCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTK---NCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSED--------NYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELN-IEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSR-QKGS------RIYSNPFYSEQSGYKMCLSLQIRF------DACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNG-NVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRVEK 1365
            +C IC   L +    PCG RFC +CI   +      CP  +    ++      ++  DN     +   IV C  K    C +K  L  +  H++ C      CP +E G     +   E+  H +E         ++   K+ I  I         M     +    ++  K  +    +   N S+   + + K+ + ++    ++      E ++++        QRE+D L    ++ +  L  +E+  ++   S++   +E         +  K+  ++ + +E+E +  N   G F WK++N  + ++GS       I+S PFY+   GYKMCL + +        +   ++ H+M+G +D I  WPF   +T+ ++DQ +  +  +  +      P+   + +P + RN      + F  ID   +   +KN+ +LVR ++ +
Sbjct:   57 ECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSER------ELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHLKGCPCMDTNCP-NECGAV---MQRKEVDKHCAEACPNRSVPCDHCKMKVTISKIEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKSSKEQASHGPQEHTPHEAE-LRREALFQSANMQREVDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAE---------LTHKLMRLETREIELEGRVCN---GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEGQYIKNNSILVRIQISR 482          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 72.7886 bits (177), Expect = 8.571e-14
Identity = 71/300 (23.67%), Postives = 131/300 (43.67%), Query Frame = 1
Query:  364 ISNHIRTCDKRPIICPFHEIGC-------AKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLS---LRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQ-------KGSRIYSNPFYSEQSGYKMCLSL------QIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNG 1194
            +S H R C      C F  +GC       A  E  N  +  H         +   +L+    N++E    +  S + E+   K E  Q K++F++ + +    +      K D++   +R + E+ V  ++ + +L + K + + +  K+    L   L ++     D   TN +K      + +  I      +  + + I+ +    + G F WKI+  + +         + IYS+PFY+ + GYK+C  L        R +   I+  +MRG +D+I  WPF+ ++TI +IDQ NG
Sbjct:  177 LSAHTRECPNALTDCRFSPLGCTYKVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLE-LENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKAN--KECLLSLMKRLEVQ-----DDSQTNPNKLNRRLSQLESSITIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNG 468          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 64.3142 bits (155), Expect = 4.415e-11
Identity = 63/318 (19.81%), Postives = 127/318 (39.94%), Query Frame = 1
Query:  337 CEFKDELC-----------MISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDE-----EKFKQIIDGKINNIQMQMVEIESKFENKHFGNFN----WKIENLSRQKG-------SRIYSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            C++++E C           M  +H +TC   P+ CP     C+K  +  +     F+ +         +       + ES   K+E     I     ++++  +  DN ++  +              LR+   +NVE+     +++  ++   +D+L++   +L                 NV   E+D+     E+  ++ D       + + ++E +        F+    WKI N++ ++        +  YS  F++   GYKMC  + +  D         ++F +MRG FD +  WPF+  VT+ ++DQ N
Sbjct:  140 CQYREETCSYCEQPVVVARMKEHHEKTCPSYPVNCP----KCSKELIRVEVHSTPFTREPRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDV--------------LRRV--ANVEAKGADHEVLVVEAHSAVDELRREVGRL-----------------NVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDN 420          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 50.8322 bits (120), Expect = 3.210e-8
Identity = 29/87 (33.33%), Postives = 41/87 (47.13%), Query Frame = 1
Query:  967 GNFNWKIENLSRQKGSR--------IYSNPFYSEQSGYKMCLSLQI------RFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQ 1185
            G F WKI N   Q            I+S PFY+ Q GYK+ L   +      +     +Y  +M+G +D +  WPFK  +T  +IDQ
Sbjct:    2 GIFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQ 88          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 80.8777 bits (198), Expect = 6.977e-16
Identity = 70/309 (22.65%), Postives = 136/309 (44.01%), Query Frame = 1
Query:  370 NHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESM--------GNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS-DLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELN--IEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQ-------MQMVEIESKFEN----KHFGNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            +HI+ C K    C FH +GC    +  +++  H  + +Y H  LL+  I   +  +ES+          K+  L   + +++    Q  +      LQ +     A        ++   +E  ++S + K+  +  + Q E++     +E +   LN  +E+SC          + + D+    +I+  K+  ++       + +VE+E K ++     + G F WKI + ++++          ++S  FY+ + GYKMCL + +  D         ++F VMRG  D +  WPF   VT+ ++DQ N
Sbjct:  205 DHIKFCSKFKAPCRFHVVGC-DTSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDLELRMSQLGRS-GTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAELSRRCQ-ELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDK---IEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN 507          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 75.8702 bits (185), Expect = 3.079e-14
Identity = 72/372 (19.35%), Postives = 153/372 (41.13%), Query Frame = 1
Query:  331 KNCEFKDELCM----------ISNHIRT-CDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLS---RQKGSRI----YSNPFYSEQSGYKMCLSLQIRFDAC-------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG----IWFNDIDIQLDSPAVKNDQVLVRCRV 1359
            + C F   +C           + +H  T C K PI C F   GC K  +    +  H  E    H + + + +      +     K   L+   ++ + +         +++  +++  N +   +    +++  E +   +++  QL      RE+  LK                  D ++  +++           +  +++ ++  + E+E++   ++ G F W+++  S   R + + I    +S  FY+ + GYK+CL L ++            ++ H M+G+FD+  TWPF+ ++ + ++DQ     +  + M+    PD   + KP+N RN      + F    +      VK+D +L+RC V
Sbjct:  214 QQCPFASVMCQYCEMDLIRDQMESHCDTDCPKAPIACTFSIFGC-KERMQRHNLAQHMQEFTQMHMRYMAEFLRGL--ALNGTAPKPLHLQGGPVSCRDQGAAAPASNCSVAPGALSCSNSSASCQPSEEMQRIREMDARLVKQDHQL------RELIILK------------------DTQAGQLAE-----------LRRRVSVLEETVKELEAQ---QYHGIFIWRLKAFSTHLRSQEAGIPVVEHSPGFYTGRPGYKLCLRLHLQTPTAPRCSNFISLFVHTMQGVFDSQLTWPFQGTIRLAILDQGPEGQHHMEVMETK--PDLQAFQKPINQRNPKGFGYVTFMHRSLLSQRAYVKDDTLLIRCEV 542          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 75.485 bits (184), Expect = 3.732e-14
Identity = 63/294 (21.43%), Postives = 120/294 (40.82%), Query Frame = 1
Query:  370 NHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFD---NISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            +H ++C K    CPF E+GC K+ + N ++  H       H +LL+ ++                     ++M R  +      +   +  L      +  C   + +    +++  V +++  + ++     RE+++     E   H+  +++            K EN   K +Q+ +  +    +Q+ E E       +    G F WKI + S ++          ++S  FYS + GYKMCL L +  D         ++F VMR  +D +  WPF   VT+ ++DQ N
Sbjct:  207 DHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMV---------------------LSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVP-SVDLDKKVSALENIVCVL----NREVERSSLTLEAFSHQHRLDQE-----------KIENLSNKIRQL-ERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN 461          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 75.0998 bits (183), Expect = 4.232e-14
Identity = 62/291 (21.31%), Postives = 118/291 (40.55%), Query Frame = 1
Query:  370 NHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHF----GNFNWKIENLSRQK-------GSRIYSNPFYSEQSGYKMCLSLQIRFDAC------YIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKN 1191
            +H ++C K    CPF E+GC K+ + N ++  H       H +LL+ ++ +            E   +  + + R                    +  C   + +    +++  V +++  + ++     RE+++     E   H+  +++            K EN   K +Q+ +  +    +Q+ E E       +    G F WKI + S ++          ++S  FYS + GYKMCL L +  D         ++F VMR  +D +  WPF   VT+ ++DQ N
Sbjct:  200 DHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYR------------------APDDGCGAAASVP-SVDLDKKVSALENIVCVL----NREVERSSLTLEAFSHQHRLDQE-----------KIENLSNKIRQL-ERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNN 454          
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 70.8626 bits (172), Expect = 9.580e-13
Identity = 50/220 (22.73%), Postives = 94/220 (42.73%), Query Frame = 1
Query:  760 REIDQLKQNYEQLKHELNIEK---SCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRI-------YSNPFYSEQSGYKMCLSLQIRFDA------CYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDG---IWFNDIDIQLDSPAVKNDQVLVRCRVE 1362
            R + QL+   E L+  L+  +   S    G   ++    N  +    + + ++ ++ ++   +E+   N   G   WKI +  R+K   +       YS PFY+   GYKMC  + +  D         ++F VMRG +D +  WPFK  VT+ ++DQ     +     K    P  + + +P+ + N       F    +      +K+D + ++  V+
Sbjct:  229 RSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNRHDDMLSVHEIRLADMDLRFQVLETASYN---GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMNIASGCPLFVSQSVLESGTYIKDDTIFIKVTVD 443          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000070131.1 (SMESG000070131.1)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 389/445 (87.42%), Postives = 404/445 (90.79%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAVKNDQVLVRCRVEKEK 1371
            M  +VW ++KENKF+  N++N DLKCK+C  L+  ACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMINYANDIAIDNAINIRISEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGC KNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNK CEMKSDLSLRKEIESNVES+ +                            IEKSCKNDGKSTNVSKSEND+EKFKQIIDGKINNIQMQ+VEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLS+QIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQK+GNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAV+NDQVLVRCRVEKEK
Sbjct:    1 MSESVWEILKENKFQIENDVNTDLKCKVCKHLMTKACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMINYANDIAIDNAINIRISEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCGKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKVCEMKSDLSLRKEIESNVESVNE----------------------------IEKSCKNDGKSTNVSKSENDDEKFKQIIDGKINNIQMQIVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSMQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKDGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAVRNDQVLVRCRVEKEK 417          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000070129.1 (SMESG000070129.1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 386/445 (86.74%), Postives = 402/445 (90.34%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAVKNDQVLVRCRVEKEK 1371
            M  +VW ++KEN F+  N++N DLKCK+C  L+  ACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMINYANDIAIDNAINIRISE+IVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGC KNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNK CEMKSDLSLRKEIESNVES+ +                            IEKSCKNDGKSTNVSKSEND+EKFKQIIDGKIN IQMQ+VEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLS+QIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQK+GNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAV+NDQVLVRCRVEKEK
Sbjct:    1 MSESVWEILKENIFQIENDVNTDLKCKVCKHLMTKACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMINYANDIAIDNAINIRISEMIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCGKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKVCEMKSDLSLRKEIESNVESVNE----------------------------IEKSCKNDGKSTNVSKSENDDEKFKQIIDGKINKIQMQIVEIESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSMQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKDGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAVRNDQVLVRCRVEKEK 417          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 450.669 bits (1158), Expect = 4.229e-155
Identity = 262/507 (51.68%), Postives = 344/507 (67.85%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS----------------------DLSLRKEIESNVES---IQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCK-------NDGKSTNVSKSENDE-EKFKQIIDGKINNIQMQMVEIESKFENKHF-GNFNWKIENLSRQ-KGSRIYSNPFYSEQSGYKMCLSLQIR-----------------------FDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGI----WFNDIDIQLDSPAVKNDQVLVRCRVEKEK 1371
            M  +++ +MKEN FE VNEI+++LKC ICNEL+I ACSAPCGC FCSDCIE YLDG++KFCPGTS+ C+ KMINYANDI ID   N++ISEIIVKC  KNCEF+DEL MI NH+RTCDKRPI  PF+ IGC  NE MNDEMKAH +EDNY+H+KLL DLINN   EMESM       +NE I +KREN QFKQ+ DNI LQS NQQ K CEM+S                      +  LR EIE+N +S   I+++I +IETKSQ +ID+LKQN++Q + ELN E           N+  +   S+ +N+  E FKQ+IDG+INN++++M+E+E++F N    G F WKIENLS+Q K   I+S PFYS  +GYKMCLS+ I                        +  C + F++MRG  D+   WPFK++VTIDVID  NG++++S+T+KYSD PD AGW+KP+ DRN+ I    W +   I L+SP ++N+++L++CR+E+EK
Sbjct:    1 MSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESM-------KNENIELKRENSQFKQKIDNIELQSANQQQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRIC-VGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPD--HIPLNSPPIRNNRLLIKCRLEREK 497          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 451.055 bits (1159), Expect = 4.836e-155
Identity = 262/507 (51.68%), Postives = 344/507 (67.85%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQNKACEMKS----------------------DLSLRKEIESNVES---IQKKIQLIETKSQREIDQLKQNYEQLKHELNIEKSCK-------NDGKSTNVSKSENDE-EKFKQIIDGKINNIQMQMVEIESKFENKHF-GNFNWKIENLSRQ-KGSRIYSNPFYSEQSGYKMCLSLQIR-----------------------FDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGI----WFNDIDIQLDSPAVKNDQVLVRCRVEKEK 1371
            M  +++ +MKEN FE VNEI+++LKC ICNEL+I ACSAPCGC FCSDCIE YLDG++KFCPGTS+ C+ KMINYANDI ID   N++ISEIIVKC  KNCEF+DEL MI NH+RTCDKRPI  PF+ IGC  NE MNDEMKAH +EDNY+H+KLL DLINN   EMESM       +NE I +KREN QFKQ+ DNI LQS NQQ K CEM+S                      +  LR EIE+N +S   I+++I +IETKSQ +ID+LKQN++Q + ELN E           N+  +   S+ +N+  E FKQ+IDG+INN++++M+E+E++F N    G F WKIENLS+Q K   I+S PFYS  +GYKMCLS+ I                        +  C + F++MRG  D+   WPFK++VTIDVID  NG++++S+T+KYSD PD AGW+KP+ DRN+ I    W +   I L+SP ++N+++L++CR+E+EK
Sbjct:    8 MSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESM-------KNENIELKRENSQFKQKIDNIELQSANQQQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRIC-VGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPD--HIPLNSPPIRNNRLLIKCRLEREK 504          
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Match: SMESG000070140.1 (SMESG000070140.1)

HSP 1 Score: 430.254 bits (1105), Expect = 2.267e-147
Identity = 256/479 (53.44%), Postives = 335/479 (69.94%), Query Frame = 1
Query:   37 MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCIEHYLDGNEKFCPGTSKHCKKKMXXXXXXXXXXXXXXXXXSEIIVKCTTKNCEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNYYHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISLQSINQQN----KACEMKSDLS-----------------LRKEIESNVE---SIQKKIQLIETKSQREIDQLKQNYEQLKHELN--------IEK-SCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVEIESKFEN-KHFGNFNWKIENLSRQKGSR-IYSNPFYSEQSGYKMCLSLQIRFDACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWPDHAGWVKPLNDRNDGIWFNDIDIQLDSPAVKNDQVLVRCRVEKE 1368
            M   V  +MKENKFE VNEI+R+LKC ICNEL+I ACSAPCGCRFCSDCIEHYLD N+KFCPG S++C+KK+INYANDIAIDNAINIRISEIIVKC  +NCEF+DEL +I+NH+RTC+KRPI CPF+ IGC  NE+MNDEMKAH +EDNY H+K+LI LINN  ++MESM       ++EI+N+K+EN QFKQ+FD + LQS NQQ        EM +D                   LR E+E   E    ++++I +IETK Q++ D+LKQN++QL+ +LN        I+K S +N   ++ V    NDE+ FKQ ID K++++++ M E+E++  N +H   F WKIENLS+ K  + IYS PFYS  SGYK+CLS+ I  D   IYFH+MRG FD+   WPFK++VTIDVID  +G  Y SK  K++D     GW KP  ++N GI      ++++SPA +N+QVL++CRVE E
Sbjct:    1 MSKRVNEIMKENKFEIVNEISRELKCNICNELMIKACSAPCGCRFCSDCIEHYLDENDKFCPGKSRYCQKKIINYANDIAIDNAINIRISEIIVKCPIQNCEFEDELQIIANHMRTCNKRPISCPFNMIGCKVNEVMNDEMKAHLNEDNYCHSKILISLINNLLSDMESM-------KSEIVNLKKENSQFKQRFDTLKLQSTNQQKMIEIDKKEMTNDEEIEELNEEMVVLKNENRKLRSEMEKFTELFNKMRQQIGMIETKFQQQFDELKQNHQQLQKQLNKKLEMLREIDKLSEENANCASRVDN--NDEKIFKQSIDEKMSDLELGMTEMETRLINARHCEEFEWKIENLSQLKRDKCIYSKPFYSGPSGYKLCLSVTIS-DVIRIYFHLMRGKFDDKLAWPFKYAVTIDVIDSLDGKTYCSKIRKFTDCSGDTGWNKPSTEKNKGICVYFSSVKINSPAARNNQVLMKCRVESE 469          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF35.776e-1924.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF35.776e-1924.00TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF33.425e-1721.92TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF69.130e-1621.73TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF69.130e-1621.73TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf41.871e-925.44gene:FBgn0026319 transcript:FBtr0334401[more]
Traf41.902e-925.44gene:FBgn0026319 transcript:FBtr0077429[more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.658e-1820.34TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf61.460e-1422.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.460e-1422.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.460e-1422.81TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf2b3.345e-1422.18Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh23.086e-1723.24slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf2.135e-1619.94epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
ssh23.192e-1521.09slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
slc12a11.678e-1322.68solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a11.349e-1222.40solute carrier family 12 member 1 [Source:Xenbase;... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf32.549e-1924.00TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.291e-1621.04TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf33.291e-1621.04TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf61.188e-1421.87TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf11.987e-1221.65TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE1.783e-1824.00TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN2.774e-1824.00TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA8.276e-1723.30TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q28DL4|TRAF6_XENTR1.247e-1519.94TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q9Y4K3|TRAF6_HUMAN4.385e-1521.73TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1011.473e-3826.30TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID87.995e-2434.48TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
I3WEV12.185e-2123.26Tumor necrosis factor receptor-associated factor 3... [more]
A0A1S3K6C12.040e-1922.88TNF receptor-associated factor 2 OS=Lingula unguis... [more]
A0A291RBW52.956e-1922.72TRAF3 OS=Sinanodonta woodiana OX=1069815 GN=TRAF3 ... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf62.585e-1723.85TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf62.386e-1623.08TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf62.386e-1623.08TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2a2.552e-1521.10TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf51.873e-1420.06TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.14.366e-1922.75pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.13.569e-1621.80pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf61.042e-1119.51TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494643.147e-1922.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.691e-1621.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352378.571e-1423.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388734.415e-1119.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291453.210e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.26.977e-1622.65TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf63.079e-1419.35TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2b3.732e-1421.43TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b4.232e-1421.31TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf39.580e-1322.73TNF receptor associated factor 3 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070131.10.000e+087.42SMESG000070131.1[more]
SMESG000070129.10.000e+086.74SMESG000070129.1[more]
SMESG000070162.14.229e-15551.68SMESG000070162.1[more]
SMESG000070162.14.836e-15551.68SMESG000070162.1[more]
SMESG000070140.12.267e-14753.44SMESG000070140.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005935 ID=SMED30005935|Name=TNF receptor-associated factor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
GATTGTTTAAGGAAATTAGATTTTCTCAAATAAATAATGTTTGTAAACGT
TTGGAATTTAATGAAAGAAAACAAATTTGAAACTGTAAATGAAATCAACA
GAGACCTGAAATGCAAAATATGTAATGAATTGCTGATAAATGCTTGCAGT
GCGCCTTGCGGTTGCCGATTTTGTTCCGATTGCATTGAGCACTATTTGGA
TGGAAATGAGAAATTCTGTCCAGGAACATCAAAACACTGTAAAAAGAAAA
TGATAAACTATGCAAATGATATTGCAATAGACAATGCTATTAACATTCGA
ATATCAGAGATTATTGTAAAATGTACAACAAAAAATTGTGAATTTAAAGA
CGAGTTGTGCATGATATCAAACCACATTAGGACATGCGACAAGCGTCCAA
TCATTTGTCCATTCCATGAAATTGGATGTGCAAAAAATGAACTTATGAAT
GACGAAATGAAAGCTCATTTCAGTGAGGACAATTATTACCATAACAAGTT
ATTAATTGATCTTATCAATAATTTTCGCAATGAAATGGAATCAATGGGTA
ACAAAATGGAATCACTGAGAAATGAAATAATCAATATGAAAAGAGAAAAT
ATCCAATTCAAACAACAATTTGATAATATCAGTTTACAATCAATAAATCA
ACAAAATAAAGCATGTGAAATGAAAAGTGATCTATCTTTAAGAAAGGAAA
TTGAATCCAATGTCGAATCAATACAAAAAAAGATTCAACTGATTGAAACA
AAATCACAGCGGGAAATCGATCAATTAAAACAAAATTATGAGCAACTAAA
GCACGAACTGAACATTGAAAAATCGTGCAAAAATGACGGCAAAAGCACAA
ACGTGTCAAAGTCAGAAAATGACGAGGAAAAATTCAAACAAATAATTGAT
GGGAAAATTAATAACATACAAATGCAAATGGTAGAGATTGAGTCAAAATT
TGAAAATAAACACTTTGGAAATTTTAATTGGAAAATTGAAAATTTATCGC
GTCAAAAAGGTTCTCGAATTTATAGCAACCCGTTTTATTCAGAGCAATCC
GGATACAAAATGTGTTTGAGTTTGCAAATTAGGTTTGATGCTTGTTACAT
TTATTTTCATGTGATGCGTGGACTGTTTGATAATATTTTTACTTGGCCAT
TTAAACATTCTGTGACAATTGATGTGATCGATCAAAAAAACGGAAATGTC
TATCAAAGTAAAACAATGAAATATTCTGATTGGCCAGATCATGCTGGATG
GGTAAAGCCGTTGAATGACAGAAATGATGGCATTTGGTTCAATGATATCG
ATATACAACTCGATTCACCGGCTGTCAAAAATGATCAAGTTCTTGTCAGG
TGTAGAGTTGAGAAAGAAAAATAACATTTACTTTTACTTTTTATAAAACT
GTAATTATAAATATTTTTATTAGGTAATAATATCAGTTGATTATTGCTTT
GAGTAACAGTCTGA
back to top

protein sequence of SMED30005935-orf-1

>SMED30005935-orf-1 ID=SMED30005935-orf-1|Name=SMED30005935-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=446bp
MFVNVWNLMKENKFETVNEINRDLKCKICNELLINACSAPCGCRFCSDCI
EHYLDGNEKFCPGTSKHCKKKMINYANDIAIDNAINIRISEIIVKCTTKN
CEFKDELCMISNHIRTCDKRPIICPFHEIGCAKNELMNDEMKAHFSEDNY
YHNKLLIDLINNFRNEMESMGNKMESLRNEIINMKRENIQFKQQFDNISL
QSINQQNKACEMKSDLSLRKEIESNVESIQKKIQLIETKSQREIDQLKQN
YEQLKHELNIEKSCKNDGKSTNVSKSENDEEKFKQIIDGKINNIQMQMVE
IESKFENKHFGNFNWKIENLSRQKGSRIYSNPFYSEQSGYKMCLSLQIRF
DACYIYFHVMRGLFDNIFTWPFKHSVTIDVIDQKNGNVYQSKTMKYSDWP
DHAGWVKPLNDRNDGIWFNDIDIQLDSPAVKNDQVLVRCRVEKEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR001841Znf_RING