Tudor domain-containing protein 1

Overview
NameTudor domain-containing protein 1
Smed IDSMED30005932
Length (bp)4287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tudor domain-containing protein 1 (SMED30005932) t-SNE clustered cells

Violin plots show distribution of expression levels for Tudor domain-containing protein 1 (SMED30005932) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tudor domain-containing protein 1 (SMED30005932) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tudor domain-containing protein 1 (SMED30005932) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005932

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005932SMESG000026637.1 SmedASXL_015284SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005932SMESG000026637.1 SmedASXL_015284SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005932SMESG000026637.1 Contig49406newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005932SMESG000026637.1 Contig49406uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30005932SMESG000026637.1 dd_Smed_v4_3564_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 65.0846 bits (157), Expect = 6.422e-10
Identity = 62/267 (23.22%), Postives = 114/267 (42.70%), Query Frame = 1
Query:  523 GTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLN-----CDRVVSLDYVDFTTVSYRS-----------YLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIR-PEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            GT+  + +S+DN  YR ++    +   V   ++DFGN E +    + PIS +L         C +  +K             +K      ++  EIL +     LV   DE+ +      + +V++ +    +V  +              + + + +++++ G +    +G K E  +VI+  +SLDEFY    +      L+ +S  +    E+ R P    +G+    +  FT D  WYR  ++E    G EG   V F+D+GN
Sbjct:  457 GTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPPLSQPVVEKLEWTGAELP-FDGQKVE--LVISTLKSLDEFYCYNYSKTDEHTLTEMSFELMKHCESERAPFTPIVGEPCCAL--FTGDARWYRAMVLE--VCG-EGKARVCFVDYGN 715          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 65.0846 bits (157), Expect = 6.422e-10
Identity = 62/267 (23.22%), Postives = 114/267 (42.70%), Query Frame = 1
Query:  523 GTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLN-----CDRVVSLDYVDFTTVSYRS-----------YLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIR-PEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            GT+  + +S+DN  YR ++    +   V   ++DFGN E +    + PIS +L         C +  +K             +K      ++  EIL +     LV   DE+ +      + +V++ +    +V  +              + + + +++++ G +    +G K E  +VI+  +SLDEFY    +      L+ +S  +    E+ R P    +G+    +  FT D  WYR  ++E    G EG   V F+D+GN
Sbjct:  457 GTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPPLSQPVVEKLEWTGAELP-FDGQKVE--LVISTLKSLDEFYCYNYSKTDEHTLTEMSFELMKHCESERAPFTPIVGEPCCAL--FTGDARWYRAMVLE--VCG-EGKARVCFVDYGN 715          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 65.0846 bits (157), Expect = 6.999e-10
Identity = 62/267 (23.22%), Postives = 114/267 (42.70%), Query Frame = 1
Query:  523 GTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLN-----CDRVVSLDYVDFTTVSYRS-----------YLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIR-PEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            GT+  + +S+DN  YR ++    +   V   ++DFGN E +    + PIS +L         C +  +K             +K      ++  EIL +     LV   DE+ +      + +V++ +    +V  +              + + + +++++ G +    +G K E  +VI+  +SLDEFY    +      L+ +S  +    E+ R P    +G+    +  FT D  WYR  ++E    G EG   V F+D+GN
Sbjct:  457 GTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPPLSQPVVEKLEWTGAELP-FDGQKVE--LVISTLKSLDEFYCYNYSKTDEHTLTEMSFELMKHCESERAPFTPIVGEPCCAL--FTGDARWYRAMVLE--VCG-EGKARVCFVDYGN 715          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:553522])

HSP 1 Score: 64.3142 bits (155), Expect = 1.285e-9
Identity = 62/267 (23.22%), Postives = 114/267 (42.70%), Query Frame = 1
Query:  523 GTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQE-------------YLAREILHRNYRAKLVKRRDETLN-----CDRVVSLDYVDFTTVSYRS-----------YLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIR-PEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            GT+  + +S+DN  YR ++    +   V   ++DFGN E +    + PIS +L         C +  +K  + T  +             ++  EIL +     LV   DE+ +      + +V++ +    +V  +              + + + +++++ G +    +G K E  +VI   +SLDEFY    +      L+ +S  +    E+ R P    +G+    +  FT D  WYR  ++E    G EG   V F+D+GN
Sbjct:  457 GTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPPLSQPVVEKLEWTGAELP-FDGQKVE--LVIGTLKSLDEFYCYNYSKTDEHTLTEMSFELMKHCESERAPFTPIVGEPCCAL--FTGDARWYRAMVLE--VCG-EGKARVCFVDYGN 715          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Match: si:ch211-189e2.3 (si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-6454])

HSP 1 Score: 59.6918 bits (143), Expect = 3.359e-8
Identity = 72/297 (24.24%), Postives = 129/297 (43.43%), Query Frame = 1
Query:  400 YYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPM-VHKCVITDVKIKSSTKQEYLAREIL----HRNYRAKLVKRRD-----ETLNCDRVV-----SLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEE--ASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVET--IRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            +YVQL  ++D NTL S  L +  N  +  +   M    ++ G+L    + +D+  YR  +     N  V  EF+DFGNE ++S+  I  +   L  +    +H     + + K   KQE L +E+L            +K+ D         C+          D +D   +S    ++ + + +   +   KP+   G   E  AS ++      D F+ Q +N+ I ++++ ++    +  ET  I  ++   G   L  ++F  D  WYR ++++   N V     V F+DFGN
Sbjct: 1264 FYVQL--KEDENTLFS--LTESLNSHQPSEKDEMHGLSVQQGSLVKAMFPEDDSWYRAVVKCAPENDMVFVEFIDFGNEAMVSSLKICRLDEHLLSYPRFSIHCSYSLNDQFKGMKKQEILFKEVLGGAGENTLSCSFIKKDDIAWEVTMTPCEGTSDSFSKKWDQLDLNALS----VVTKPVKETFNFLFKKPDVSLGQTIEAFASCIV----GPDYFWCQFSNSEILDHITQVAQECGNSSETQPILLDNLDSGSPCL--ARFCDDQMWYRAQVIKKCTNTVS----VLFVDFGN 1542          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 57.7658 bits (138), Expect = 1.426e-7
Identity = 80/358 (22.35%), Postives = 135/358 (37.71%), Query Frame = 1
Query:  268 IGDILMKPRIYVDQ-SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFK--CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIE-DIADE--IQYNGCKPECRNGLKEEASVVITHFE-------------SLDEFYVQPANTIINENLSFLSNAIADFVETIRPED--TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE 1239
            +G + ++ +I  D+ ++I K+    +N  D++  VV      + ++  QL S           L +L       CG V+P       +G +    +S+D+  YR  +    +   V   +VD+GN E++S + + PI  KL         CV+  VK             +K   +   +   ++       LV+  D+++      S   +D        + I E D+AD+    +    P    G  E        F              S  EFY         E L  L+ ++AD+     P      IG+       F+ D NWYR  + E   +   GN  V F+D+GN E
Sbjct:  462 VGRVTVESKIVTDRNALIPKVLT--LNVGDEFCGVVAHIQTPEDFFCQQLQS--------GHKLAELQESLSEYCGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLAGVKPSLGIWTPEAVCVMKEMVQNRMVTVRVVGMLGTRALVELIDKSVAPHVSASKALID------SGFAIKEKDVADKGSSMHTASVPLAIEGPAEALEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAF--FSGDGNWYRALVKEILPS---GNVKVHFVDYGNVE 798          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 57.7658 bits (138), Expect = 1.426e-7
Identity = 80/358 (22.35%), Postives = 135/358 (37.71%), Query Frame = 1
Query:  268 IGDILMKPRIYVDQ-SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFK--CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIE-DIADE--IQYNGCKPECRNGLKEEASVVITHFE-------------SLDEFYVQPANTIINENLSFLSNAIADFVETIRPED--TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE 1239
            +G + ++ +I  D+ ++I K+    +N  D++  VV      + ++  QL S           L +L       CG V+P       +G +    +S+D+  YR  +    +   V   +VD+GN E++S + + PI  KL         CV+  VK             +K   +   +   ++       LV+  D+++      S   +D        + I E D+AD+    +    P    G  E        F              S  EFY         E L  L+ ++AD+     P      IG+       F+ D NWYR  + E   +   GN  V F+D+GN E
Sbjct:  462 VGRVTVESKIVTDRNALIPKVLT--LNVGDEFCGVVAHIQTPEDFFCQQLQS--------GHKLAELQESLSEYCGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLAGVKPSLGIWTPEAVCVMKEMVQNRMVTVRVVGMLGTRALVELIDKSVAPHVSASKALID------SGFAIKEKDVADKGSSMHTASVPLAIEGPAEALEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAF--FSGDGNWYRALVKEILPS---GNVKVHFVDYGNVE 798          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 57.7658 bits (138), Expect = 1.426e-7
Identity = 80/358 (22.35%), Postives = 135/358 (37.71%), Query Frame = 1
Query:  268 IGDILMKPRIYVDQ-SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFK--CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIE-DIADE--IQYNGCKPECRNGLKEEASVVITHFE-------------SLDEFYVQPANTIINENLSFLSNAIADFVETIRPED--TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE 1239
            +G + ++ +I  D+ ++I K+    +N  D++  VV      + ++  QL S           L +L       CG V+P       +G +    +S+D+  YR  +    +   V   +VD+GN E++S + + PI  KL         CV+  VK             +K   +   +   ++       LV+  D+++      S   +D        + I E D+AD+    +    P    G  E        F              S  EFY         E L  L+ ++AD+     P      IG+       F+ D NWYR  + E   +   GN  V F+D+GN E
Sbjct:  462 VGRVTVESKIVTDRNALIPKVLT--LNVGDEFCGVVAHIQTPEDFFCQQLQS--------GHKLAELQESLSEYCGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLAGVKPSLGIWTPEAVCVMKEMVQNRMVTVRVVGMLGTRALVELIDKSVAPHVSASKALID------SGFAIKEKDVADKGSSMHTASVPLAIEGPAEALEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAF--FSGDGNWYRALVKEILPS---GNVKVHFVDYGNVE 798          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Mouse
Match: Tdrd1 (tudor domain containing 1 [Source:MGI Symbol;Acc:MGI:1933218])

HSP 1 Score: 57.7658 bits (138), Expect = 1.426e-7
Identity = 80/358 (22.35%), Postives = 135/358 (37.71%), Query Frame = 1
Query:  268 IGDILMKPRIYVDQ-SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFK--CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIE-DIADE--IQYNGCKPECRNGLKEEASVVITHFE-------------SLDEFYVQPANTIINENLSFLSNAIADFVETIRPED--TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE 1239
            +G + ++ +I  D+ ++I K+    +N  D++  VV      + ++  QL S           L +L       CG V+P       +G +    +S+D+  YR  +    +   V   +VD+GN E++S + + PI  KL         CV+  VK             +K   +   +   ++       LV+  D+++      S   +D        + I E D+AD+    +    P    G  E        F              S  EFY         E L  L+ ++AD+     P      IG+       F+ D NWYR  + E   +   GN  V F+D+GN E
Sbjct:  462 VGRVTVESKIVTDRNALIPKVLT--LNVGDEFCGVVAHIQTPEDFFCQQLQS--------GHKLAELQESLSEYCGHVIPRSDFYPTIGDVCCAQFSEDDQWYRASVLAYASEESVLVGYVDYGNFEILSLKRLCPIIPKLLDLPMQALNCVLAGVKPSLGIWTPEAVCVMKEMVQNRMVTVRVVGMLGTRALVELIDKSVAPHVSASKALID------SGFAIKEKDVADKGSSMHTASVPLAIEGPAEALEWTWVEFTVDETVDVVVCMMYSPGEFYCHFLKDDALEKLDDLNQSLADYCAQKPPNGFKAEIGRPCCAF--FSGDGNWYRALVKEILPS---GNVKVHFVDYGNVE 798          
BLAST of Tudor domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q58EK5|TDRD1_DANRE (Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 2.992e-9
Identity = 62/266 (23.31%), Postives = 114/266 (42.86%), Query Frame = 1
Query:  523 GTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-------------IKSSTKQEYLAREILHRNYRAKLVKRRDETLN-----CDRVVSLDYVDFTTVSYRS----------YLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIR-PEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGN 1233
            GT+  + +S+DN  YR ++    +   V   ++DFGN E +    + PIS +L         C +  +K             +K      ++  EIL +     LV   DE+ +      + +V++ +    +V  +             + + + +++++ G +    +G K E  +VI+  +SLDEFY    +      L+ +S  +    E+ R P    +G+    +  FT D  WYR  ++E    G EG   V F+D+GN
Sbjct:  457 GTVCCSLFSEDNQWYRAKVLAYSSEDRVCVGYIDFGNSEEVELNRLRPISKELLALATQAIPCSLAGIKSLTDTWSDEAVLMLKHLVCNRFIRVEILGKKDGRALVSMIDESSDPQASVTELLVNMGFAAIESVETKKNEPDPATSTEIPLSQPVVEKLEWTGAELP-FDGQKVE--LVISTLKSLDEFYCYNYSKTDEHTLTEMSFELMKHCESERAPFTPIVGEPCCAL--FTGDARWYRAMVLE--VCG-EGKARVCFVDYGN 714          
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Match: I1ZID4 (Tudor-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.159e-24
Identity = 139/596 (23.32%), Postives = 253/596 (42.45%), Query Frame = 1
Query:  511 DIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREI--------LHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEI--QYNGCKPECRNGLKE-------------------------EASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVE--TIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQ-SSKIWIVENIVMPNHEEIISIVMKQCENTEK-------------------TDI----YRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQW--------TKEQNFRDLQP-------VKQILLNQPYCAKMPN------GYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLAHPYRLGLNICT--DEHQIEEKIIQILGNSNVELVL--LDDKSIRDVIIKEKSLVKCL 2040
            D +VG +YA  Y  D   YRV+I   L+  +V   FVD+GN E+I    + P+ ++++   P+   C I  +K+    +   + +E+        +    R K++   +  L  + V++L    +     R YLI  +IA+E+   Y+       +   E                           +V+IT      + YV   +      L  L   I   +E    R  D    +  +Y++QF++DN WYRCRI+   F+   G  LVQ+IDFGN E K +  +L  L  +  S    L+     A++C+ S +++    K+   ++Y +++FV   K +S  Y  ++ SS IW+++N+    H+++  ++ KQC   E+                    DI    Y L     +Q  +FR+  S    +  H+  + Q+        T+E     L         V +++++  Y   M N         +RC +I   ++ + I  ID G    V +D IF L+  ++A+P     ++   N+    +E  + + +  +L    V ++   L    + D+I   +S+V+ L
Sbjct:    4 DYKVGDIYAAIYPQDKMFYRVKILQILDFEKVLVCFVDYGNTEIIPKAELAPLPHQISIIKPLALMCKIPSIKLIQEKQFMKIIQELCTDDVVITIENKTRMKIIN--EGGLMENLVINLISFPYNGYPIRDYLIRSNIAEELTESYDAFTAWPNDSDTEGIVQVTTSMDKVVSTHTVSSEHYDYSKTVIITSVSPECDIYVHEFSKNSKTRLESLQAYIGRIIEKYKCRISDNIFNKRNMYLAQFSEDNLWYRCRIIS--FDSACG-FLVQYIDFGNSEYKTSLSELILLTHEMGSDADFLMNEEPIAQQCQLSMEIVKTFPKSINIRKYLIKSFVEPVKKLSITYQINEDSSVIWLIKNMCY-RHQDLSELLEKQCVVKERHVNKDGEVSEASSHSIHDVADIKVAEYLLNGCPDIQDEFFRINDSNRQYLVTHIDGLNQFWIDIGDGQTQEMCDNLLSTIDNRQAGVTEVVIDYIY-GVMTNVSEDGKSVAVRCKIIDVCENFIKIHLIDKGPTRHVLLDEIFNLSAEIIALPQQVLKFQFPDNLIANINEEVLVKHLKSLLEGRYVRIIRESLTTNVLIDIIFNNRSIVQTL 592          
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Match: D5JG63 (Tudor domain-1 OS=Dugesia japonica OX=6161 GN=TDRD-1 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.921e-18
Identity = 108/408 (26.47%), Postives = 178/408 (43.63%), Query Frame = 1
Query:  379 THF-HDGYYYVQLLSEKDTNTL----MSSNLRDLHNDFK-----CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKI---KSSTK--QEYLAREI---LHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIA---DEI-----------------------QYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVET--IRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKI 1464
            TH+ ++GY Y    + KD N L    + + L +L+N +          L ++  D +VG +YA  Y  D   YRV+I   L+  +V   F+D+GN E+I+   +  + ++++   P+   C I ++K+   KS  K  QE    +I   +    + K+V       N +  V+L    +   S R YL+   IA   DEI                       Q N         L+   SV+IT   S    +V   +  +   L  L   I+  VE   I+  D    +  +Y++QF++D+ WYRC+I    F+   G  LVQ+IDFGN E K +  +L  L     S    LI     A++C+ S ++I     +   ++Y ++ FV   K ++  Y   +   I
Sbjct:   20 THYENNGYLY---FNSKDENDLERHCIFTCLANLNNSYSKENNYYRNYLYLQEIDYKVGDVYAAIYPQDKMFYRVKILQILDFEKVLVCFIDYGNTEIIAKAELATLPHQISHIKPLALLCKIPNIKLIFDKSFMKIIQELCVNDISITIESRTKMKIVNEGGLVENLE--VNLINFQYNGHSIRDYLLRNKIAENFDEIYEEISLWPNDDVDVESQIKLSTKQDNSSTCNISPSLEYSKSVIITSVSSECNIFVHDFSKSVKTKLESLQAHISKVVENFKIQISDNMFNKRSMYLAQFSEDSLWYRCKI--SNFDSTYG-FLVQYIDFGNSEYKTSLSELMLLSRDMGSDAIYLIDEDPIAQQCQLSSEVIMTFPSSINIRKYLIKKFVEPVKKLTITYHITEEPAI 419          
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Match: A7SJJ0 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g245679 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.435e-10
Identity = 129/561 (22.99%), Postives = 227/561 (40.46%), Query Frame = 1
Query:  310 SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYAD-IEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYN----------------GC----KPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPED---TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE-LKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIIS------IVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDL----QPVKQILLNQPYCAKMP--NGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLA 1881
            S++ K    L  +  DY+DV+ +       ++ QLL  K     + S +  LH    C    P    +   VGT     +S D   YR  +TG     +V+ +FVD+GN E++    +  +  +          C +           E+L     H ++  +L+++ DE      +V++    +  +++R  + + D AD    N                G     KP    G +E  +V +T    + +FY Q      +E L  +  A+ D   T+       T +   V   +++T+D++WYR RI+E   N V     VQ+ID+GN E L  NR  LK L  K         ++P     C  + D I  +++A+     F + F    K VS +  F+       V+ I M  H+ I         + K    T       +T++ S  K + +  +S + A+ E +  +     E ++R L    + +K+  + Q   A+    +G+  R  V   + +S+ +  +D GN E +P+     L P    +P  A
Sbjct:  654 SILAKEYTKLSLTLGDYEDVLVSYSESPAVFWCQLLKHK---AELDSIMNALHE--YCANSGPKDNINSPRVGTPCCAMFSVDEGWYRGLVTGVTRANQVEVQFVDYGNSEIMPPSQLRAMKPEFMSLSAQAISCEL-----------EHLGFNKSH-HFTKELIEKFDEVTAEKELVAM-IASYDKINHRYVVALHDTADGKNENILDLLTPLLSKKASGIGSVSIPKPNLAPGARE--NVCVTSVVGVTQFYCQVMKA--SEQLDRMMVALDDHYNTLADSQEVLTEVKPGVCCAARYTEDDSWYRARILEVSRNTV----TVQYIDYGNSETLPNNR--LKMLASK-------FAELPEQVVPCCLTGD-ISKVNEAQFSDLVFDKTFDMQVKAVSSEGTFE-------VDLISMETHKSIRDQLIQSVTIPKHTLQTGSKVPGLVTSITSSSKFYLQDSQSAS-ALDEVMDLL-----EGHYRALGEGEEALKKPQVGQFCVARFSEDDGW-YRAVVTKVHGNSIEVLYVDYGNAEVIPVSRAKILKPEFAKLPMQA 1164          
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Match: A0A3M6T7K9 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00008937 PE=4 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 2.447e-8
Identity = 117/556 (21.04%), Postives = 234/556 (42.09%), Query Frame = 1
Query:  334 PLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFK-CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVK-IKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTI-----INENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE-LKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISI---VMKQC--------------------ENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDLQPVKQIL------LNQPY-----CAKMPNGYPIRCTVIAKNK-SSVIIQSIDGGNYESVPIDSIFALNPSVVAVP 1872
            P+  S    ++V  +     G +YVQL       TL+ + +R++++      + + + + D    +L    YS+D+  YR  IT  +++ +V+  FVD+GN + +    I  +   L  F     KC +   K + +    E     IL R       ++ +ET  C  +  LD       S ++ L +++   +  +   K       +EEA  +    +S D F++QP  T      + E +S LSN +      +      +GQ  L   ++T+++ W+R  I++ + +    N  + ++D+GN E +  +R  L+P+ +         +K+PA    C  ++  +  +   ++  EY  +  +  EKVV  +         + V+   + N  E +S+   ++++C                    + TE+   + L +L+S  K+   LV +  PA  + + T     ++Q  R++  + Q L      L  P      C    + +  R  VI+ +   +  ++ +D G  E +PI ++  L    V +P
Sbjct: 2374 PMKLSPGQIEEVYVSHLTESGDFYVQLSKTLSDLTLIGNKMREIYDQLSPTAEAMEVCFVD----SLCCAQYSEDSQWYRACITKVVSDAKVEVHFVDYGNTDTLPVAAIKQLRPDLLNFPVQAIKCRLEGSKDVWTERDVEQFRANILERPLHVTFTRKEEETW-CVTIQELD-----VFSPKAKLALKERYTKETFGVDK-------REEAYFLFA--DSPDCFWLQPVRTGNALGELMEQISTLSNKV------LERSQLQVGQPCL--GKYTENDMWHRAEILQVQDD---ANITLSYVDYGNCEIIPLDR--LRPISETH-------LKLPAQGICCHLAE--VQGVDPDRI-TEYLNEQLL--EKVVEVEVQKQHPDNSYTVK---LFNPGESLSLNEQIVRECLGDTSLFEERMFEHSSPQKLDATEERKTFTLPDLQSGSKVPVSLVSAFLPAEMQLLLTERIDERDQMMREITSMYQALDENELTLENPVVGMLCCVPFSDKW-FRGEVISTSADDTATVKLVDCGTNEKIPISALKLLKDEFVKMP 2881          

HSP 2 Score: 64.3142 bits (155), Expect = 2.813e-6
Identity = 64/251 (25.50%), Postives = 124/251 (49.40%), Query Frame = 1
Query:  508 ADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPM--VHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVV-SLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYI---GQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFEL 1242
             D+ VG      +++D   YR  I    ++ +V+  ++D+GN +VI    +  +S++    +PM  +H C+  D+    S K+    +E+  +    +  K +    + + ++ S D   F   S   YL  +DI ++ ++   + +   GLK+  +V ++H  S DEFYVQ A  +  + L++LS  +  F  ++ P    +    + +   ++F+QD+ WYR  +     +GVE    V+F+D+GN E 
Sbjct: 2040 GDLVVGHPVCAQFAEDGGWYRAIIHSMPSDHKVEVHYIDYGNSDVIPLTDLRQLSSRFFS-LPMQAIHCCL--DLPRVESFKENVEEKELKVKFLSTERGKWKVNLYDDNGIIGSSDEALFAAAS--EYL--DDIFEKREF--LQSQITQGLKQ--NVYVSHIVSPDEFYVQFATGL--DELTYLSEEMNRFY-SLHPSKNELKKPSKGMSCCAKFSQDHGWYRGTVKGVALHGVE----VEFVDYGNCEF 2272          
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Match: A0A093QFX0 (Tudor domain-containing protein 1 (Fragment) OS=Manacus vitellinus OX=328815 GN=N305_10801 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.277e-8
Identity = 102/521 (19.58%), Postives = 205/521 (39.35%), Query Frame = 1
Query:  481 CGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIK----SSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIA----------------------DEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSD------------DLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVA-------TIEQWTKEQNFRDLQPVK-----------QILLNQPYCAKMP-NGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVP 1872
            CG+          VG++    +++DN  YR  +T   +   V  ++VD+GN + +    + P+   L        +C +  VK      +S    ++   +  + +  K+V +   T     VV L     T     S L+IE+                        D I    CK   +  LK+  +V +    S  EFY Q +NT     L+ L+ +++++ +   P+           + F+ D NWYR  +V++  +G  G   V F+D+GNFE        +  +DK        +K+P  A KC  S              + + +  + +E +  + +  R    V    +     K  ++ +I+   +  +  ++  +     K+   ++T+L   +     + +++   V E V+        +    +++ +R+L  +            Q  L +  CA+   NG   R  V+  ++S+V +   D GN E++P+  +  ++ S + +P
Sbjct:   99 CGRFPSSPSFHPAVGSVCCAQFTEDNLWYRAAVTAYASEDTVLVDYVDYGNSDSVPLMKLRPVIPALMDLPAQAIRCSLAGVKPPLGTWTSEGTSFMKNLVKDKVFTVKVVDKEGST----SVVELVDASVTPAINISSLLIEEGCAAEESRVALPAVTMSDVKQENEDTINKRTCK-WVKLTLKQTVNVTVCTVYSPGEFYCQISNTHELLALNSLNKSMSEYCQKTPPDVFKPENGEPCCAFFSGDGNWYR-AVVQNITSG--GTVEVSFVDYGNFE--------EVPLDKIRKISPSFLKLPFQAIKCWLSGIKPHNNKWNKEAAIRFHMCTSGLELQATVTSLSRDGAGVVLTDNSTVRPK--VINDILTSENLAVKEVLQDKNNFPNKSVDQKVTSLGHWKSFKLAVGETIRVFVTEIVSPDLFYAVPVLNEVQKKEYRELAALGTYCRSCKKEPFQPKLGEACCAQFSGNGRWYRALVLEASQSAVKVLYADYGNTETLPLSRVLPISDSFLKLP 601          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 55.4546 bits (132), Expect = 5.748e-7
Identity = 75/359 (20.89%), Postives = 146/359 (40.67%), Query Frame = 1
Query:  349 KDDYDDVVNTTHFHDGY---------YYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLP--MKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVP-MVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGL-----------------KEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCK 1338
            KD    ++N     +GY         ++VQL  E        S++  L +   C ++    ++Y+ +  G L    Y  D   YR  +  KL+N  +  EF+D+GNE ++S   +  +  +   F    +H C+       +  K+E+   ++    ++  +V   +  L C+ +   + V    +  +S L +E   +    N     C  G+                    +SVV  +F     F+ Q A++   + +S ++       +T R    ++ Q    ++ F  DN WYR +++    N    +  V F+D+GN E + ++  ++       S  A L++IP  A  C+
Sbjct:  520 KDLPSRIMNAGCVSEGYISHCNSPSSFFVQLACE-------DSDIFSLVDKLNCSQLCESQVEYSQLMPGHLVKAQYPSDGAWYRAVVKNKLDNCTILVEFIDYGNEAILSASKVRQLDMQFLKFPRYSIHCCINVG---NAERKKEWTEEQM--DIFKNVIVANGERKLRCNFIEEKESVWQVGIQDQSLLNLESTLELKSCNTSTTVCSRGVCPGVYKKPDVSLGQTIKAYASSVVDPNF-----FWCQFADSEKLDKISSIAQETGHSAQTNRVLLDHLSQGDSCLALFPDDNLWYRAQVI----NKSVSSVSVLFVDYGN-ESELDQTSVR-------SVPASLLEIPPQAFLCQ 849          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Cavefish
Match: si:ch211-189e2.3 (tudor domain-containing protein 6-like [Source:NCBI gene;Acc:103027511])

HSP 1 Score: 55.4546 bits (132), Expect = 5.748e-7
Identity = 75/359 (20.89%), Postives = 146/359 (40.67%), Query Frame = 1
Query:  349 KDDYDDVVNTTHFHDGY---------YYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLP--MKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVP-MVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGL-----------------KEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCK 1338
            KD    ++N     +GY         ++VQL  E        S++  L +   C ++    ++Y+ +  G L    Y  D   YR  +  KL+N  +  EF+D+GNE ++S   +  +  +   F    +H C+       +  K+E+   ++    ++  +V   +  L C+ +   + V    +  +S L +E   +    N     C  G+                    +SVV  +F     F+ Q A++   + +S ++       +T R    ++ Q    ++ F  DN WYR +++    N    +  V F+D+GN E + ++  ++       S  A L++IP  A  C+
Sbjct:  520 KDLPSRIMNAGCVSEGYISHCNSPSSFFVQLACE-------DSDIFSLVDKLNCSQLCESQVEYSQLMPGHLVKAQYPSDGAWYRAVVKNKLDNCTILVEFIDYGNEAILSASKVRQLDMQFLKFPRYSIHCCINVG---NAERKKEWTEEQM--DIFKNVIVANGERKLRCNFIEEKESVWQVGIQDQSLLNLESTLELKSCNTSTTVCSRGVCPGVYKKPDVSLGQTIKAYASSVVDPNF-----FWCQFADSEKLDKISSIAQETGHSAQTNRVLLDHLSQGDSCLALFPDDNLWYRAQVI----NKSVSSVSVLFVDYGN-ESELDQTSVR-------SVPASLLEIPPQAFLCQ 849          
BLAST of Tudor domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO36108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ0])

HSP 1 Score: 76.2554 bits (186), Expect = 1.028e-13
Identity = 129/561 (22.99%), Postives = 227/561 (40.46%), Query Frame = 1
Query:  310 SMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYAD-IEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYN----------------GC----KPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPED---TYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE-LKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIIS------IVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDL----QPVKQILLNQPYCAKMP--NGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLA 1881
            S++ K    L  +  DY+DV+ +       ++ QLL  K     + S +  LH    C    P    +   VGT     +S D   YR  +TG     +V+ +FVD+GN E++    +  +  +          C +           E+L     H ++  +L+++ DE      +V++    +  +++R  + + D AD    N                G     KP    G +E  +V +T    + +FY Q      +E L  +  A+ D   T+       T +   V   +++T+D++WYR RI+E   N V     VQ+ID+GN E L  NR  LK L  K         ++P     C  + D I  +++A+     F + F    K VS +  F+       V+ I M  H+ I         + K    T       +T++ S  K + +  +S + A+ E +  +     E ++R L    + +K+  + Q   A+    +G+  R  V   + +S+ +  +D GN E +P+     L P    +P  A
Sbjct:  654 SILAKEYTKLSLTLGDYEDVLVSYSESPAVFWCQLLKHK---AELDSIMNALHE--YCANSGPKDNINSPRVGTPCCAMFSVDEGWYRGLVTGVTRANQVEVQFVDYGNSEIMPPSQLRAMKPEFMSLSAQAISCEL-----------EHLGFNKSH-HFTKELIEKFDEVTAEKELVAM-IASYDKINHRYVVALHDTADGKNENILDLLTPLLSKKASGIGSVSIPKPNLAPGARE--NVCVTSVVGVTQFYCQVMKA--SEQLDRMMVALDDHYNTLADSQEVLTEVKPGVCCAARYTEDDSWYRARILEVSRNTV----TVQYIDYGNSETLPNNR--LKMLASK-------FAELPEQVVPCCLTGD-ISKVNEAQFSDLVFDKTFDMQVKAVSSEGTFE-------VDLISMETHKSIRDQLIQSVTIPKHTLQTGSKVPGLVTSITSSSKFYLQDSQSAS-ALDEVMDLL-----EGHYRALGEGEEALKKPQVGQFCVARFSEDDGW-YRAVVTKVHGNSIEVLYVDYGNAEVIPVSRAKILKPEFAKLPMQA 1164          

HSP 2 Score: 61.2326 bits (147), Expect = 3.724e-9
Identity = 66/292 (22.60%), Postives = 123/292 (42.12%), Query Frame = 1
Query:  538 TYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYI-----GQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFL 1398
            + +++++  YR  +  ++        +VD+GN E +S   + PIS+ L        +C +  + I  + +   L  E+         V  +D +  C  V   +      +     +++E  A+    +  +       KE+A  +    +++D  ++QP  T      S L   +A   E    E         GQ  L  SQFT+D+ WYR  I+  + N       V+++D+GN       E++ P+ D+  +   E +++PA A KCK +D        A  + E+FL
Sbjct: 2491 SRFTENDVWYRAEVL-EVGEGTATVRYVDYGNTESLSTTRLSPISDSLLELPAQAVRCTLYSIPITKAEQVVALLNEVCADGTIEVEVVEQDPS-GCPSVRLYNSETKKPIIPEDPIVLEQAAELEPLSFTRSSFSASEKEQAYFL--SADAVDAIWLQPTKTA-----SLLEELMATIAEHHPSEPMQASLLVPGQPCL--SQFTEDDGWYRAEILTTKDNSAH----VRYVDYGN-------EEVLPM-DRLRAIKCEQLELPAQAVKCKLAD-------LAAGQAEHFL 2752          

HSP 3 Score: 58.151 bits (139), Expect = 3.576e-8
Identity = 102/470 (21.70%), Postives = 200/470 (42.55%), Query Frame = 1
Query:  544 YSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLA---REILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTI-----INENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE-LKWNREDLKPLVDKEDSSVAELIKIPACARKCKF----SDDL---IYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQ-----CENTEKTDIYRLTNLESLQKLWFRLVK--SVNPAVQEHVATIEQWTKEQNFRDLQPVKQILLNQPYCAKMP-NGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLA 1881
            ++DD+  YR  I  ++ +  V   ++D+GN E +    + PI +          +C +  V   + T ++ LA             ++V++  + L   R+ + D      +        ++ A +  +   K       KE+A  +I   E++D  ++QPA T      + EN++ L   +A     +  E     Q  L  SQFT D+++YR  I+E +    EGN  V+++D+GN E L   R  L   V         L+ +PA A +C      +D L   +  L++   E +  ++    S + +     ++  SK  I+ +   P+HE+ ++I  ++       ++ K   Y L   E++  +W + V+  S   AV E +       K  +   + P   +    P  ++   N    R  V+   + +  ++ +D GN ES+    +  ++ S++ +P+ A
Sbjct: 2111 FTDDDAWYRAEIQ-EVKDGGVDVRYMDYGNSEFLPLSRLSPIPSSFLELPAQAVRCGLYGVA--AGTDEQTLALLNESCAEATLEVEVVEQTADDLQLVRLYNAD-TKLPVIIEAKTQAQDEPATKRSFK--KASLSKTAKEQACFIIA--EAVDTVWLQPAKTADDLHNLMENIAALEPRVA-----LPTELQAASQPCL--SQFTGDDSFYRAEILEVK----EGNAHVRYVDYGNKEWLPVQRLSLISDV---------LLDLPAQAVRCMLQGVPTDTLERTLEHLNEVYPEVDVEVEVVEESPEGLPVIRMYNAESKQPIISHEEQPSHEKDVTITSRRFTKASLPSSGKGQAYFLY-AEAVDSVWVQPVEMASALEAVMESI-------KSTDSAVVIPPSLLAPGLPCLSRFTENDVWYRAEVLEVGEGTATVRYVDYGNTESLSTTRLSPISDSLLELPAQA 2544          

HSP 4 Score: 54.6842 bits (130), Expect = 3.895e-7
Identity = 66/291 (22.68%), Postives = 117/291 (40.21%), Query Frame = 1
Query:  544 YSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKI-KSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLY--VSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFE-LKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQN 1404
            +++DN  YR  IT  + +      +VDFGN E +    + PIS           +C +      KS      L  E+  +    +++++  E++    +V L   D          I E++    Q   C         +  S      +S+D  ++QP +T        L N +A   E+             +  ++QFT D+ WYR  I E +  GV+    V+++D+GN E L  +R  L P+        +  +++PA A +C      +Y ++    E+   L N
Sbjct: 1927 FTEDNAWYRAVITA-VEDPTFHVRYVDFGNTECLPVDRLVPISPSFLQLPTQAVRCSLHGFPADKSRQIVAQLNEELKDKTVEVEVLQQTSESI----LVKLYDADTKKA------IPEEVVAVPQEPTCFRRVAFSTSDRESAYYLSADSVDAVWLQPVSTA-----GKLENLMAAIAESPPCSPLPSSLSAGWPCLAQFTDDDAWYRAEIQEVKDGGVD----VRYMDYGNSEFLPLSR--LSPI-------PSSFLELPAQAVRCG-----LYGVAAGTDEQTLALLN 2183          
BLAST of Tudor domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000026637.1 (SMESG000026637.1)

HSP 1 Score: 2743.38 bits (7110), Expect = 0.000e+0
Identity = 1364/1374 (99.27%), Postives = 1368/1374 (99.56%), Query Frame = 1
Query:   70 MPVKIFIPKIPQNEDEFINFIKKLCNPSNIRIAKNKDGSFFCVISLNYSENDKCANDLIKEISGKVIGDILMKPRIYVDQSMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDLQPVKQILLNQPYCAKMPNGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLAHPYRLGLNICTDEHQIEEKIIQILGNSNVELVLLDDKSIRDVIIKEKSLVKCLALLDYIEPANRSNHMLDFKETNNEETDPDEGVDFTLPSVEKMAEVPLEIAIYNSHVRIMRKLFSIHTTNLFKDLFQVIDQCDKINNLLECCNEVDNLSNSIDALNLEFTSMTTDIRTKLKDLDPAIDKRKALCESICILYTNLTGLLESETMSNLELLRVFIGSNFVTVKNLLQIFKISIDKCNISDPAVADNIDIKTTQKSILEFQSSELHANLVKQFTEKAQVTDELVNKYKSMLESMYKDYELGQALPNAQSTGIPLIDSTYELHNALKSETQHFLGTFAQEEVVNNFDIIQIFITLYRYLERQKDSVEKIVGKIAKLQVLNEYGTAILIDDSEVFQRVEDNHKQVLCYRSSLKHCLADMEDAEEQDDKEKVDEICAKISSIRDPLHEMLKSSGEIIDAEVEKLMIRKPELQLKNQSIFFGNEGIPIFLWDSIFFEIPRSDSVSDFFTTKFAGETVAMRKLRLNSNNLQNVLCNITTYSKKIKQSNNTMISLLPVSFAFLSKSEKNSVYLIMPMFKSVNQLSKPFRNSVVAIVDLFKSLIDQLLDLWHSGFTYSEEDLANGLFVCNLSEDVDKMFLPLPLSSIMNRENMNHKCESVHVYFSKLGAILQESLSSCVEPVNIDSPVVKKLIDDLSNCNGVQEAERVFYELDQFIAENASLQDSSELINESLDNKESNTAEVLXXXXXXXXXXXXXXXXXXXXXXTEKVLEILSDVE 4191
            MPVKIFIPKIPQNEDEFINFIKKLCNPSNIRIAKNKDGSFFCVISLNYSENDKCANDLIKEISGKVIGDILMKPRIYVDQSMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDLQPVKQILLNQPYCAKMPNGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLAHPYRLGLNICTDEHQIEEKIIQILGNSNVELVLLDDKSIRDVIIKEKSLVKCLALLDYIEPANRSNHMLDFKETNNEETDPDEGVDFTLPSVEKMAEVPLEIAIYNSHVRIMRKLFSIHTTNLFKDLFQVIDQCDKINNLLECCNEVDNLSNSIDALNLEFT MTTDIRTKLKDLDPAIDKRKALCESIC LYTNLTGLLESETMSNLELLRVFIGSNFVTVKNLLQIFKISIDKC+ISDPA ADNIDIKTTQKSILEFQSSELHANLVKQFTEKAQVTDELVNKYKSMLESMYKDYELGQALPNAQSTGIPLIDSTYELHNALKSETQHFLGTFAQEEVVNNFDIIQIFITLYRYLERQKDSVEKIVGKIAKLQVLNEYGTAILIDDSEVFQRVEDNHKQVLCYRSSLKHCLADMEDAEEQDDKEKVDEIC KISSIRDPLHEMLKSSGEIIDAEVEKLMIRKPELQLKNQSIFFGNEGIPIFLWDSIFFEIPRSDSVSDFFTTKFAGETVAMRKLRLNSNNLQNVLCNITTYSKKIKQSNNTMISLLPVSFAFLSKSEKNSVYLIMPMFKSVNQLSKPFRNSVVAIVDLFKSLIDQLLDLWHSGFTYSEEDLANG+FVCNLSEDVDKMFLPLPLSSIMNRENMNHKCESVHVYFSKLGAILQESLSSCVEPVNIDSPVVKKLIDDLSNCNGVQEAERVFYELDQFIAENASLQDSSEL+NE LDNKES+TAEVLSNGINNIISSPSSKS SRDSSITEKVLEILSDVE
Sbjct:    1 MPVKIFIPKIPQNEDEFINFIKKLCNPSNIRIAKNKDGSFFCVISLNYSENDKCANDLIKEISGKVIGDILMKPRIYVDQSMICKLSNPLVNSKDDYDDVVNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQCENTEKTDIYRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDLQPVKQILLNQPYCAKMPNGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLAHPYRLGLNICTDEHQIEEKIIQILGNSNVELVLLDDKSIRDVIIKEKSLVKCLALLDYIEPANRSNHMLDFKETNNEETDPDEGVDFTLPSVEKMAEVPLEIAIYNSHVRIMRKLFSIHTTNLFKDLFQVIDQCDKINNLLECCNEVDNLSNSIDALNLEFTCMTTDIRTKLKDLDPAIDKRKALCESICRLYTNLTGLLESETMSNLELLRVFIGSNFVTVKNLLQIFKISIDKCSISDPAAADNIDIKTTQKSILEFQSSELHANLVKQFTEKAQVTDELVNKYKSMLESMYKDYELGQALPNAQSTGIPLIDSTYELHNALKSETQHFLGTFAQEEVVNNFDIIQIFITLYRYLERQKDSVEKIVGKIAKLQVLNEYGTAILIDDSEVFQRVEDNHKQVLCYRSSLKHCLADMEDAEEQDDKEKVDEICTKISSIRDPLHEMLKSSGEIIDAEVEKLMIRKPELQLKNQSIFFGNEGIPIFLWDSIFFEIPRSDSVSDFFTTKFAGETVAMRKLRLNSNNLQNVLCNITTYSKKIKQSNNTMISLLPVSFAFLSKSEKNSVYLIMPMFKSVNQLSKPFRNSVVAIVDLFKSLIDQLLDLWHSGFTYSEEDLANGMFVCNLSEDVDKMFLPLPLSSIMNRENMNHKCESVHVYFSKLGAILQESLSSCVEPVNIDSPVVKKLIDDLSNCNGVQEAERVFYELDQFIAENASLQDSSELLNELLDNKESDTAEVLSNGINNIISSPSSKSSSRDSSITEKVLEILSDVE 1374          
BLAST of Tudor domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000030853.1 (SMESG000030853.1)

HSP 1 Score: 122.479 bits (306), Expect = 5.292e-28
Identity = 140/602 (23.26%), Postives = 256/602 (42.52%), Query Frame = 1
Query:  493 LPMKYADIEVGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPISNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREI--------LHRNYRAKLVKRRDETLNCDRVVSLDYVDFTTVSYRSYLIIEDIADEI--QYNGCKPECRNGLKE-------------------------EASVVITHFESLDEFYVQPANTIINENLSFLSNAIADFVE--TIRPEDTYIGQDVLYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKPLVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSEKVVSFQYDFDQ-SSKIWIVENIVMPNHEEIISIVMKQCENTEK-------------------TDI----YRLTNLESLQKLWFRLVKSVNPAVQEHVATIEQW--------TKEQNFRDLQP-------VKQILLNQPYCAKMPN------GYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAVPSLAHPYRLGLNICT--DEHQIEEKIIQILGNSNVELVL--LDDKSIRDVIIKEKSLVKCL 2040
            L ++  D +VG +YA  Y  D   YRV+I   L+  +V   FVD+GN E+I    + P+ ++++   P+   C I  +K+    +   + +E+        +    R K++   +  L  + V++L    +     R YLI  +IA+E+   Y+       +   E                           +V+IT      + YV   +      L  L   I   +E    R  D    +  +Y++QF++DN WYRCRI+   F+   G  LVQ+IDFGN E K +  +L  L  +  S    L+     A++C+ S +++    K+   ++Y +++FV   K +S  Y  ++ SS IW+++N+    H+++  ++ KQC   E+                    DI    Y L     +Q  +FR+  S    +  H+  + Q+        T+E     L         V +++++  Y   M N         +RC +I   ++ + I  ID G    V +D IF L+  ++A+P     ++   N+    +E  + + +  +L    V ++   L    + D+I   +S+V+ L
Sbjct:   59 LYLQEIDYKVGDIYAAIYPQDKMFYRVKILQILDFEKVLVCFVDYGNTEIIPKAELAPLPHQISIIKPLALMCKIPSIKLIQEKQFMKIIQELCTDDVVITIENKTRMKIIN--EGGLMENLVINLISFPYNGYPIRDYLIRSNIAEELTESYDAFTAWPNDSDTEGIVQVTTSMDKVVSTHTVSSEHYDYSKTVIITSVSPECDIYVHEFSKNSKTRLESLQAYIGRIIEKYKCRISDNIFNKRNMYLAQFSEDNLWYRCRIIS--FDSACG-FLVQYIDFGNSEYKTSLSELILLTHEMGSDADFLMNEEPIAQQCQLSMEIVKTFPKSINIRKYLIKSFVEPVKKLSITYQINEDSSVIWLIKNMCY-RHQDLSELLEKQCVVKERHVNKDGEVSEASSHSIHDVADIKVAEYLLNGCPDIQDEFFRINDSNRQYLVTHIDGLNQFWIDIGDGQTQEMCDNLLSTIDNRQAGVTEVVIDYIY-GVMTNVSEDGKSVAVRCKIIDVCENFIKIHLIDKGPTRHVLLDEIFNLSAEIIALPQQVLKFQFPDNLIANINEEVLVKHLKSLLEGRYVRIIRESLTTNVLIDIIFNNRSIVQTL 653          
The following BLAST results are available for this feature:
BLAST of Tudor domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tdrd16.422e-1023.22tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
tdrd16.422e-1023.22tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
tdrd16.999e-1023.22tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
tdrd11.285e-923.22tudor domain containing 1 [Source:NCBI gene;Acc:55... [more]
si:ch211-189e2.33.359e-824.24si:ch211-189e2.3 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tdrd11.426e-722.35tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Tdrd11.426e-722.35tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Tdrd11.426e-722.35tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
Tdrd11.426e-722.35tudor domain containing 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q58EK5|TDRD1_DANRE2.992e-923.31Tudor domain-containing protein 1 OS=Danio rerio O... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID44.159e-2423.32Tudor-1 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
D5JG633.921e-1826.47Tudor domain-1 OS=Dugesia japonica OX=6161 GN=TDRD... [more]
A7SJJ07.435e-1022.99Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A3M6T7K92.447e-821.04Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A093QFX04.277e-819.58Tudor domain-containing protein 1 (Fragment) OS=Ma... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-189e2.35.748e-720.89tudor domain-containing protein 6-like [Source:NCB... [more]
si:ch211-189e2.35.748e-720.89tudor domain-containing protein 6-like [Source:NCB... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO361081.028e-1322.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tudor domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026637.10.000e+099.27SMESG000026637.1[more]
SMESG000030853.15.292e-2823.26SMESG000030853.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005932 ID=SMED30005932|Name=Tudor domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4287bp
CAAGTTTCAAACAAAACTTAAACAATTTGTTTTATCAAACAAAAGGATCA
TTAGTATTTGAAATTTGGAATGCCCGTTAAAATATTCATCCCAAAAATTC
CTCAGAATGAAGATGAGTTTATTAATTTTATCAAAAAATTATGCAATCCA
TCAAATATTCGAATTGCTAAAAACAAAGATGGTTCATTTTTTTGTGTTAT
CTCACTGAATTATAGTGAAAACGATAAATGCGCTAATGATCTAATAAAGG
AGATTAGTGGTAAAGTAATAGGAGATATACTCATGAAGCCTAGAATTTAT
GTAGATCAATCAATGATTTGTAAATTAAGTAATCCTTTAGTAAATTCAAA
AGATGATTATGATGATGTTGTTAACACTACACATTTTCATGATGGTTATT
ATTATGTTCAATTACTAAGCGAAAAGGACACTAATACGTTAATGTCATCC
AATTTAAGAGATTTACATAATGATTTTAAATGTGGTAAAGTATTACCCAT
GAAATACGCAGATATTGAAGTTGGAACTCTTTATGCGACGTATTATAGTG
ATGACAATCATCTTTATCGCGTTCGAATAACTGGAAAGTTAAATAATACA
GAGGTTAAAGCTGAATTTGTTGATTTTGGCAATGAAGAAGTGATATCCAA
CCAATATATCTTTCCAATTAGTAATAAATTAGCAGGATTTGTTCCAATGG
TGCACAAATGCGTCATAACGGATGTTAAAATCAAAAGTAGCACTAAGCAG
GAATACCTTGCCAGAGAGATTCTCCATCGGAATTATCGCGCTAAATTAGT
CAAGCGAAGGGATGAAACCTTGAATTGTGACCGAGTGGTTTCGTTGGACT
ATGTGGATTTCACTACCGTTTCTTACCGCAGTTATTTGATTATCGAAGAT
ATCGCCGACGAGATTCAATATAACGGTTGCAAGCCAGAATGTCGCAATGG
ATTGAAAGAAGAAGCATCGGTCGTTATCACTCATTTCGAGTCTCTCGATG
AGTTCTATGTGCAACCGGCAAACACAATTATAAATGAGAATCTGAGTTTT
TTGTCGAACGCAATTGCCGATTTCGTAGAAACTATTCGCCCCGAGGACAC
ATATATCGGACAAGATGTTCTCTATGTCAGTCAATTCACTCAAGATAACA
ATTGGTATCGGTGTCGAATTGTCGAAGATCGATTTAATGGGGTAGAAGGG
AATTGCCTGGTACAGTTTATCGATTTTGGTAATTTTGAACTGAAATGGAA
CCGGGAAGATTTGAAACCATTGGTCGACAAGGAGGACAGTAGCGTTGCCG
AGCTCATAAAGATTCCCGCGTGTGCCAGGAAGTGCAAATTCAGTGACGAT
CTCATTTATGCGCTCAGCAAAGCAAAAATGGAAAAGGAATATTTCCTCCA
GAATTTCGTCCGGTCAGAAAAGGTCGTCTCGTTCCAGTATGATTTCGACC
AATCGAGCAAGATCTGGATCGTTGAGAACATTGTCATGCCAAATCACGAG
GAAATAATCTCGATTGTCATGAAGCAGTGCGAGAACACAGAGAAAACCGA
CATTTATCGATTGACCAATTTGGAATCTCTGCAGAAGCTCTGGTTCAGGC
TGGTGAAATCTGTCAATCCCGCTGTCCAGGAGCATGTCGCAACGATCGAG
CAGTGGACCAAGGAGCAGAATTTCCGGGATTTGCAGCCTGTCAAGCAGAT
TCTGTTGAATCAGCCCTACTGTGCCAAGATGCCGAACGGATACCCGATTC
GGTGCACTGTCATCGCCAAGAATAAATCCAGCGTTATTATCCAGTCAATC
GATGGTGGTAACTACGAATCGGTACCGATTGATAGCATTTTCGCTCTAAA
TCCGAGCGTTGTGGCGGTTCCCTCGTTGGCTCATCCGTATCGACTGGGAC
TGAATATCTGCACCGATGAACACCAGATCGAGGAGAAAATCATACAGATC
CTCGGCAATTCCAATGTGGAGCTCGTGCTGCTCGATGACAAGTCTATCCG
GGATGTCATTATCAAGGAGAAAAGCCTCGTCAAATGCTTGGCTCTACTAG
ACTACATTGAGCCGGCAAACCGATCGAATCATATGCTAGATTTCAAGGAA
ACCAATAACGAGGAAACAGACCCAGACGAGGGAGTAGATTTCACTTTACC
AAGTGTCGAGAAAATGGCAGAGGTGCCGTTGGAAATTGCGATCTATAATT
CCCACGTGCGCATTATGCGGAAATTGTTCAGTATTCACACTACAAATCTG
TTCAAGGATCTATTCCAAGTGATCGATCAATGTGACAAAATCAATAATCT
GTTGGAGTGTTGCAACGAGGTTGACAATTTATCAAATTCTATTGATGCGT
TGAACCTAGAATTCACGAGTATGACAACCGACATTAGAACAAAACTCAAA
GATCTTGATCCGGCGATTGATAAGCGGAAAGCGCTATGTGAAAGCATCTG
TATATTGTATACGAATCTCACGGGGCTGCTGGAATCAGAAACTATGTCAA
ATCTGGAGCTGCTCCGAGTGTTTATCGGCAGCAATTTCGTTACCGTCAAA
AATCTCCTGCAGATATTCAAAATATCGATCGATAAGTGTAACATATCGGA
TCCGGCAGTTGCGGATAATATCGACATCAAAACCACCCAGAAATCAATCC
TGGAATTCCAATCAAGCGAACTGCATGCCAATCTCGTGAAGCAATTTACC
GAGAAGGCCCAAGTGACCGATGAGCTCGTCAACAAGTACAAATCGATGCT
GGAATCTATGTACAAGGATTATGAGCTGGGTCAGGCACTGCCCAATGCCC
AGTCAACTGGAATCCCGCTTATCGACAGCACATACGAGCTGCACAACGCC
CTGAAATCGGAAACCCAACATTTCCTCGGAACATTTGCCCAGGAAGAGGT
CGTCAACAATTTCGACATAATCCAAATATTTATCACTCTGTACCGTTACC
TGGAGCGCCAGAAAGATTCCGTGGAGAAAATTGTCGGGAAAATCGCTAAA
TTGCAAGTATTGAACGAATATGGAACCGCGATACTGATCGATGATTCCGA
GGTGTTCCAGCGGGTCGAGGACAATCACAAGCAGGTTCTCTGTTACCGCT
CATCGTTGAAGCATTGTTTGGCTGATATGGAAGATGCCGAAGAGCAAGAC
GACAAGGAGAAGGTCGACGAGATCTGCGCGAAGATCAGCAGCATTAGAGA
TCCTCTTCACGAGATGCTGAAATCTTCTGGGGAGATTATTGATGCTGAGG
TCGAGAAATTGATGATCCGGAAGCCGGAGCTCCAATTAAAGAATCAATCG
ATATTTTTCGGCAATGAAGGAATCCCGATATTCCTCTGGGATTCGATTTT
CTTTGAGATCCCCCGCTCGGACTCAGTTTCGGATTTTTTCACTACAAAAT
TCGCAGGAGAGACCGTTGCTATGAGGAAATTGCGTCTGAATTCCAACAAC
CTCCAGAATGTTCTCTGCAACATCACTACATATTCAAAGAAAATCAAACA
GTCGAACAACACTATGATTTCTCTGTTGCCGGTTTCGTTTGCGTTCCTCT
CGAAATCCGAAAAGAATTCCGTCTACCTTATCATGCCGATGTTCAAATCC
GTCAATCAGCTGTCGAAACCGTTTAGGAATTCTGTTGTAGCAATTGTCGA
CTTGTTTAAATCGCTGATTGATCAGCTGTTGGATTTGTGGCATTCCGGAT
TCACTTACAGCGAGGAGGACCTTGCAAACGGTCTGTTTGTGTGCAATCTA
TCTGAAGATGTCGACAAAATGTTCTTGCCGCTCCCGTTGTCATCCATTAT
GAACCGAGAAAATATGAATCACAAATGTGAATCAGTTCATGTCTATTTTT
CAAAACTTGGAGCAATTTTACAAGAATCACTGAGCAGTTGTGTGGAACCG
GTTAATATTGATAGCCCAGTTGTCAAGAAATTGATCGATGATTTAAGCAA
CTGCAATGGAGTTCAAGAAGCTGAGCGAGTTTTTTATGAATTGGACCAAT
TCATTGCGGAAAATGCCAGTTTGCAGGATTCTAGTGAACTTATCAATGAA
TCATTGGACAATAAAGAATCTAATACTGCCGAGGTGCTCAGCAATGGTAT
TAATAACATTATTTCATCGCCATCCAGCAAATCTTTATCTAGAGATTCAT
CCATAACTGAAAAAGTTCTAGAAATATTATCTGATGTTGAATGATATTAA
ACGATTCTGCAAATGTGTCACTGTACATTAATAATTGCATTTAGTGTTCA
ATGTTGTTTTAGAATAAATATGAATTTTATTGCATAA
back to top

protein sequence of SMED30005932-orf-1

>SMED30005932-orf-1 ID=SMED30005932-orf-1|Name=SMED30005932-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1375bp
MPVKIFIPKIPQNEDEFINFIKKLCNPSNIRIAKNKDGSFFCVISLNYSE
NDKCANDLIKEISGKVIGDILMKPRIYVDQSMICKLSNPLVNSKDDYDDV
VNTTHFHDGYYYVQLLSEKDTNTLMSSNLRDLHNDFKCGKVLPMKYADIE
VGTLYATYYSDDNHLYRVRITGKLNNTEVKAEFVDFGNEEVISNQYIFPI
SNKLAGFVPMVHKCVITDVKIKSSTKQEYLAREILHRNYRAKLVKRRDET
LNCDRVVSLDYVDFTTVSYRSYLIIEDIADEIQYNGCKPECRNGLKEEAS
VVITHFESLDEFYVQPANTIINENLSFLSNAIADFVETIRPEDTYIGQDV
LYVSQFTQDNNWYRCRIVEDRFNGVEGNCLVQFIDFGNFELKWNREDLKP
LVDKEDSSVAELIKIPACARKCKFSDDLIYALSKAKMEKEYFLQNFVRSE
KVVSFQYDFDQSSKIWIVENIVMPNHEEIISIVMKQCENTEKTDIYRLTN
LESLQKLWFRLVKSVNPAVQEHVATIEQWTKEQNFRDLQPVKQILLNQPY
CAKMPNGYPIRCTVIAKNKSSVIIQSIDGGNYESVPIDSIFALNPSVVAV
PSLAHPYRLGLNICTDEHQIEEKIIQILGNSNVELVLLDDKSIRDVIIKE
KSLVKCLALLDYIEPANRSNHMLDFKETNNEETDPDEGVDFTLPSVEKMA
EVPLEIAIYNSHVRIMRKLFSIHTTNLFKDLFQVIDQCDKINNLLECCNE
VDNLSNSIDALNLEFTSMTTDIRTKLKDLDPAIDKRKALCESICILYTNL
TGLLESETMSNLELLRVFIGSNFVTVKNLLQIFKISIDKCNISDPAVADN
IDIKTTQKSILEFQSSELHANLVKQFTEKAQVTDELVNKYKSMLESMYKD
YELGQALPNAQSTGIPLIDSTYELHNALKSETQHFLGTFAQEEVVNNFDI
IQIFITLYRYLERQKDSVEKIVGKIAKLQVLNEYGTAILIDDSEVFQRVE
DNHKQVLCYRSSLKHCLADMEDAEEQDDKEKVDEICAKISSIRDPLHEML
KSSGEIIDAEVEKLMIRKPELQLKNQSIFFGNEGIPIFLWDSIFFEIPRS
DSVSDFFTTKFAGETVAMRKLRLNSNNLQNVLCNITTYSKKIKQSNNTMI
SLLPVSFAFLSKSEKNSVYLIMPMFKSVNQLSKPFRNSVVAIVDLFKSLI
DQLLDLWHSGFTYSEEDLANGLFVCNLSEDVDKMFLPLPLSSIMNRENMN
HKCESVHVYFSKLGAILQESLSSCVEPVNIDSPVVKKLIDDLSNCNGVQE
AERVFYELDQFIAENASLQDSSELINESLDNKESNTAEVLSNGINNIISS
PSSKSLSRDSSITEKVLEILSDVE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0005515protein binding
GO:0034584piRNA binding
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002999Tudor
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0043186P granule
GO:0071546pi-body
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0007281germ cell development
GO:0007283spermatogenesis
GO:0030154cell differentiation
GO:0030719P granule organization
GO:0031047gene silencing by RNA
GO:0034587piRNA metabolic process
GO:0043046DNA methylation involved in gamete generation
GO:0051321meiotic cell cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 542..598
e-value: 0.46
score: 19.5
coord: 147..205
e-value: 8.4E-7
score: 38.6
coord: 342..406
e-value: 0.25
score: 20.4
IPR002999Tudor domainPFAMPF00567TUDORcoord: 94..216
e-value: 5.5E-11
score: 42.5
coord: 296..424
e-value: 8.6E-13
score: 48.4
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 148..207
score: 11.711
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 343..407
score: 8.891
NoneNo IPR availableGENE3DG3DSA:2.40.50.790coord: 111..249
e-value: 1.9E-15
score: 59.3
NoneNo IPR availableGENE3DG3DSA:2.40.50.790coord: 306..456
e-value: 3.4E-14
score: 55.1
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 322..415
e-value: 3.4E-14
score: 55.1
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 119..207
e-value: 1.9E-15
score: 59.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 513..610
e-value: 5.3E-7
score: 31.4
NoneNo IPR availablePANTHERPTHR22948TUDOR DOMAIN CONTAINING PROTEINcoord: 109..219
coord: 297..426
NoneNo IPR availableCDDcd04508TUDORcoord: 351..400
e-value: 3.03357E-9
score: 51.8299
NoneNo IPR availableCDDcd04508TUDORcoord: 152..199
e-value: 7.11242E-9
score: 50.6743
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 536..605
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 126..219
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 323..425