Octopamine receptor

Overview
NameOctopamine receptor
Smed IDSMED30005928
Length (bp)1305
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Octopamine receptor (SMED30005928) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Octopamine receptor (SMED30005928) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005928

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005928SMESG000055001.1 SmedASXL_019802SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005928SMESG000055001.1 dd_Smed_v6_26479_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 207.994 bits (528), Expect = 1.368e-62
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 207.608 bits (527), Expect = 1.656e-62
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 207.994 bits (528), Expect = 2.391e-62
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 207.994 bits (528), Expect = 2.391e-62
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Human
Match: HTR4 (5-hydroxytryptamine receptor 4 [Source:HGNC Symbol;Acc:HGNC:5299])

HSP 1 Score: 207.608 bits (527), Expect = 2.605e-62
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: dop-1 (DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q86ME5])

HSP 1 Score: 171.4 bits (433), Expect = 9.810e-49
Identity = 115/336 (34.23%), Postives = 189/336 (56.25%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCW--TXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDI-YKMEKA----FRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
            S +II A+FGN+LV  +++  R +R    NLF++SLA++D+LV++ VM F     +  G+WPFG   C+ + S D+   TASI++LC IS+DR++ I  P+ Y     + R+  +++  W  ++ I  + +    G   T  NL  L     +C  ++   YAI SS VSF++P +VM+++Y ++Y  A KH R I  ++++A      + ++  I   + S +SK NF     P    ++   Q  +      +    + KA  TLG+IMG F++CW PFF   +I      E+  +    I  + W+GYANS+ NPLIY+ +NR+FR AF++I+
Sbjct:   13 SVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVNDIL-GYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGIGAAPLGFGFGSKVTINNLTGL----PVCEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREIRTSIFSKLNF---LCPTRFKNQRSPQDPHTPAAHNRSNISDQKARLTLGVIMGTFLVCWLPFFT-VNILRAWLPEI--FSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKII 337          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 171.4 bits (433), Expect = 1.022e-48
Identity = 126/409 (30.81%), Postives = 199/409 (48.66%), Query Frame = 1
Query:   94 NFSCKDFASPKKEISITEIIKAIGPSF-VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHER-----------------------DIYKMEKAFRRKS------------NRFIINT---QNSNYSKN----------NFDSTGSPGCESDRSLIQSQNNCVRQGQKLR-REHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAF-RQILKCQK 1167
            N +C +  +    +++ E +  I     V++  +FGN+LV+++V   RK+R    N  ++SLA+AD+LV L VMP  LT  +  G W  G+++CEI+ + DV   TASI+H+C IS+DR+F++  PLTY +  T  R+ + +   W  S+LI   PI+       E           C+   +  Y + SS  SF+IP V++++VY +IY   I+H R                       + Y ME      S            NR +IN    Q    S+           + +    P  +  R L + +  C ++ +KL+ +E +A   LGII+  FI+ W PFFL Y I     E     P L+    FW+GY NS +NP+IY  +NREF+    +Q+ K ++
Sbjct:    3 NLNCSESDTKVACLNLGEAVLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIV-GEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGE---------CSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKL-EEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEA----PPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFER 396          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: dop-1 (DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q86ME5])

HSP 1 Score: 171.4 bits (433), Expect = 1.060e-48
Identity = 115/336 (34.23%), Postives = 189/336 (56.25%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCW--TXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDI-YKMEKA----FRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
            S +II A+FGN+LV  +++  R +R    NLF++SLA++D+LV++ VM F     +  G+WPFG   C+ + S D+   TASI++LC IS+DR++ I  P+ Y     + R+  +++  W  ++ I  + +    G   T  NL  L     +C  ++   YAI SS VSF++P +VM+++Y ++Y  A KH R I  ++++A      + ++  I   + S +SK NF     P    ++   Q  +      +    + KA  TLG+IMG F++CW PFF   +I      E+  +    I  + W+GYANS+ NPLIY+ +NR+FR AF++I+
Sbjct:   13 SVLIILALFGNLLVCAAILWDRSLRKQPENLFLVSLAVSDLLVSVLVMLFAAVNDIL-GYWPFGQFYCQFWISFDITTCTASILNLCAISLDRYWHISRPMVYIRYCNRRRINYVIVLVWLISAGIGAAPLGFGFGSKVTINNLTGL----PVCEMRLPLPYAIGSSMVSFFLPAMVMVILYTKLYLYARKHVRSIKTQLQQATSFLIMQLASEKIREIRTSIFSKLNF---LCPTRFKNQRSPQDPHTPAAHNRSNISDQKARLTLGVIMGTFLVCWLPFFT-VNILRAWLPEI--FSSKTIMAVTWLGYANSSANPLIYSIFNRDFRRAFKKII 337          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 171.014 bits (432), Expect = 1.689e-48
Identity = 126/411 (30.66%), Postives = 199/411 (48.42%), Query Frame = 1
Query:   94 NFSCKDFASPKKEISITEIIKAIGPSF-VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHER-----------------------DIYKMEKAFRRKS------------NRFIINT---QNSNYSKN------------NFDSTGSPGCESDRSLIQSQNNCVRQGQKLR-REHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAF-RQILKCQK 1167
            N +C +  +    +++ E +  I     V++  +FGN+LV+++V   RK+R    N  ++SLA+AD+LV L VMP  LT  +  G W  G+++CEI+ + DV   TASI+H+C IS+DR+F++  PLTY +  T  R+ + +   W  S+LI   PI+       E           C+   +  Y + SS  SF+IP V++++VY +IY   I+H R                       + Y ME      S            NR +IN    Q    S+             + +    P  +  R L + +  C ++ +KL+ +E +A   LGII+  FI+ W PFFL Y I     E     P L+    FW+GY NS +NP+IY  +NREF+    +Q+ K ++
Sbjct:    3 NLNCSESDTKVACLNLGEAVLTISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIV-GEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPERAEGE---------CSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPASDLTRKL-EEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEA----PPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQLHKFER 398          
BLAST of Octopamine receptor vs. Ensembl Celegans
Match: ser-7 (SERotonin/octopamine receptor family [Source:UniProtKB/TrEMBL;Acc:Q8T3C1])

HSP 1 Score: 154.836 bits (390), Expect = 2.052e-42
Identity = 116/356 (32.58%), Postives = 184/356 (51.69%), Query Frame = 1
Query:  157 AIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIK---HER--------DIYKMEKAFRRKSNRFIINTQNSNYSKNN-FDSTGSPGCESDRSLIQ--------SQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
            AI    +II    GN LV L+V+L RK++    N  ++SLA+AD  V L VMP  L  ++ +  WP GS MC +Y ++D+ L TASI++LC IS+DR+  I  PL Y +  T  R+ +M + C      I  I  +      N+   +    +  C    + IY   ++ +SF+ P  +M+++ ++I++ A +    +R        D  +  +    ++  F+   +  +  K    +ST S   + +R  +         ++   +RQ +K   E KA KTLG+IM  FIICW PFF+  +I    G  +   P  L  +  W+GY+NS LNPLIY  YN+EFR  FR++L C+
Sbjct:   45 AIAILAMIIMTTVGNALVCLAVLLVRKLKH-PQNFLLVSLAVADFFVGLVVMPLALIDLLFDK-WPLGSTMCSVYTTSDLTLCTASIVNLCAISVDRYLVISSPLRYSAKRTTKRI-MMYIACVWIIAAIVSISSHIIANLLNDGTYVDD--TGTCQVIPHFIYQSYATIISFYAPTFIMVILNIKIWRAAKRLAAQDRLMSHCNSVDASERPRNGSAETKDFLNEKETIDVPKKERANSTNSRLFKLERKYLHRPSAFFSAAKGPLIRQTEK--SECKARKTLGVIMSVFIICWLPFFI-LAIFKSFGMWI---PDWLDLLALWLGYSNSTLNPLIYCKYNKEFRIPFREMLACR 389          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0301484)

HSP 1 Score: 297.745 bits (761), Expect = 7.546e-97
Identity = 169/337 (50.15%), Postives = 228/337 (67.66%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIR 1182
            F+I++A+ GN+LVI+SV+ +RK+R +  N FV+SLA+AD+LVAL  M FN   ++ +G W FGS+MC+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y  IMT+ RV +MLL  W S  L+S++PI SG YTT EN   L+    IC FKVN  YAIVSSS+SFWIP +VML +Y RIY+EA + ER +Y+ + A            Q S   K        P  + ++S I +          +RRE KAA+TLGIIM  F+ICW PFFLWY +++LC  + C  P LL+ +LFWIGY NSALNP+IYA++NR+FR AF++ LK    L I 
Sbjct:  116 FIILAAILGNMLVIVSVMRHRKLRIIT-NYFVVSLAVADMLVALCAMTFN-ASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHL----QISQIPKPR------PSIQVEQSTIST----------MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKVSCGLAIE 428          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0100322)

HSP 1 Score: 297.36 bits (760), Expect = 9.408e-97
Identity = 167/329 (50.76%), Postives = 226/329 (68.69%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 1158
            F+I++A+ GN+LVI+SV+ +RK+R +  N FV+SLA+AD+LVAL  M FN   ++ +G W FGS+MC+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y  IMT+ RV +MLL  W S  L+S++PI SG YTT EN   L+    IC FKVN  YAIVSSS+SFWIP +VML +Y RIY+EA + ER +Y+ + A            Q S   K        P  + ++S I +          +RRE KAA+TLGIIM  F+ICW PFFLWY +++LC  + C  P LL+ +LFWIGY NSALNP+IYA++NR+FR AF++ LK
Sbjct:  116 FIILAAILGNMLVIVSVMRHRKLRIIT-NYFVVSLAVADMLVALCAMTFN-ASVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHL----QISQIPKPR------PSIQVEQSTIST----------MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0331930)

HSP 1 Score: 296.59 bits (758), Expect = 1.727e-95
Identity = 167/329 (50.76%), Postives = 227/329 (69.00%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 1158
            F+I++A+ GN+LVI+SV+ +RK+R +  N FV+SLA+AD+LVAL  M FN + ++ +G W FGS+MC+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y  IMT+ RV +MLL  W S  L+S++PI SG YTT EN   L+    IC FKVN  YAIVSSS+SFWIP +VML +Y RIY+EA + ER +Y+ + A            Q S   K        P  + ++S I +          +RRE KAA+TLGIIM  F+ICW PFFLWY +++LC  + C  P LL+ +LFWIGY NSALNP+IYA++NR+FR AF++ LK
Sbjct:  116 FIILAAILGNMLVIVSVMRHRKLRIIT-NYFVVSLAVADMLVALCAMTFNAS-VMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHL----QISQIPKPR------PSIQVEQSTIST----------MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0084260)

HSP 1 Score: 296.59 bits (758), Expect = 1.727e-95
Identity = 167/329 (50.76%), Postives = 227/329 (69.00%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 1158
            F+I++A+ GN+LVI+SV+ +RK+R +  N FV+SLA+AD+LVAL  M FN + ++ +G W FGS+MC+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y  IMT+ RV +MLL  W S  L+S++PI SG YTT EN   L+    IC FKVN  YAIVSSS+SFWIP +VML +Y RIY+EA + ER +Y+ + A            Q S   K        P  + ++S I +          +RRE KAA+TLGIIM  F+ICW PFFLWY +++LC  + C  P LL+ +LFWIGY NSALNP+IYA++NR+FR AF++ LK
Sbjct:  116 FIILAAILGNMLVIVSVMRHRKLRIIT-NYFVVSLAVADMLVALCAMTFNAS-VMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHL----QISQIPKPR------PSIQVEQSTIST----------MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420          
BLAST of Octopamine receptor vs. Ensembl Fly
Match: Octbeta3R (gene:FBgn0250910 transcript:FBtr0301944)

HSP 1 Score: 282.722 bits (722), Expect = 7.037e-91
Identity = 163/340 (47.94%), Postives = 210/340 (61.76%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKN 1188
            S +I++AV GN LVI+SV   RK+R +  N FV+SLAMAD+LVAL  M FN +  ++ G W FG  MC +YNS DV+ STASI+HLCCIS+DR++AI+ PL Y   MT   V  ML   W    LIS+ PI+ G YTT E+L  +    + C+F VN  YA++SSSVSFWIP +VML++Y RI+KEAI+         KA  R S+  ++N+                                        EHKAA+TLGIIMG F++CW PFFLWY IT+LCG   CP P +L+ VLFWIGY NS LNPLIYA++NR+FR AFR  L+C    L ++N
Sbjct:  147 SSIILAAVLGNALVIISVQRNRKLRVIT-NYFVVSLAMADMLVALCAMTFNASVELSGGKWMFGPFMCNVYNSLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLGWYTTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRIFKEAIRQ-------RKALSRTSSNILLNSA---------------------------------------EHKAARTLGIIMGVFLLCWLPFFLWYVITSLCGPA-CPCPDVLVVVLFWIGYFNSTLNPLIYAYFNRDFREAFRNTLECVLPCLEKRN 438          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 212.231 bits (539), Expect = 4.567e-64
Identity = 141/377 (37.40%), Postives = 196/377 (51.99%), Query Frame = 1
Query:  115 ASPKKEISITEIIK--------AIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-----ENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKN 1188
            AS   E S+ E++         +I    +II    GN+LV++++   R++R    N F++SLA AD+LVAL VMP    ++ T G W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y++ MT  RV LML+GCW     IS++PI     T       E   L    +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  + +A          +   S Y  N  D  GS                     +++ E KAAKTL +IMGCF +CW PFF    +TN+      P+     P  +     W+GY NS LNP +YAF NR FR AF  IL C  +   R+ 
Sbjct:    4 ASDSAEDSVDEVVSKHTSRITLSIVLVTIIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIEL-TTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAG---------SAPTSTYPNN--DQHGS--------------------SRIKNETKAAKTLAVIMGCFCLCWAPFF----VTNVVD----PFINYSVPWQMWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLMILCCGDERYARQG 340          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: BX248308.2 (pep chromosome:GRCz11:CHR_ALT_CTG21_2_3:20217739:20230254:1 gene:ENSDARG00000116414.1 transcript:ENSDART00000182382.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX248308.2)

HSP 1 Score: 210.69 bits (535), Expect = 9.126e-64
Identity = 140/366 (38.25%), Postives = 192/366 (52.46%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-----ENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSI 1239
            +II    GN+LV++++   R++R    N F++SLA AD+LVAL VMP    ++ T G W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y++ MT  RV LML+GCW     IS++PI     T       E   L    +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  + +A          +   S Y  N  D  GS                     +++ E KAAKTL +IMGCF +CW PFF    +TN+      P+     P  +     W+GY NS LNP +YAF NR FR AF  IL C  +   R+      +  S S   TSI
Sbjct:   27 IIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIEL-TTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAG---------SAPTSTYPNN--DQHGS--------------------SRIKNETKAAKTLAVIMGCFCLCWAPFF----VTNVVD----PFINYSVPWQMWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLMILCCGDERYARQGGFSPSRQCSESVNGTSI 352          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: BX248308.1 (pep chromosome:GRCz11:CHR_ALT_CTG21_1_11:20224615:20237130:1 gene:ENSDARG00000113397.1 transcript:ENSDART00000193907.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX248308.1)

HSP 1 Score: 210.69 bits (535), Expect = 9.126e-64
Identity = 140/366 (38.25%), Postives = 192/366 (52.46%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-----ENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSI 1239
            +II    GN+LV++++   R++R    N F++SLA AD+LVAL VMP    ++ T G W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y++ MT  RV LML+GCW     IS++PI     T       E   L    +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  + +A          +   S Y  N  D  GS                     +++ E KAAKTL +IMGCF +CW PFF    +TN+      P+     P  +     W+GY NS LNP +YAF NR FR AF  IL C  +   R+      +  S S   TSI
Sbjct:   27 IIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIEL-TTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAG---------SAPTSTYPNN--DQHGS--------------------SRIKNETKAAKTLAVIMGCFCLCWAPFF----VTNVVD----PFINYSVPWQMWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLMILCCGDERYARQGGFSPSRQCSESVNGTSI 352          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: BX248308.2 (pep chromosome:GRCz11:CHR_ALT_CTG21_2_3:20213622:20230254:1 gene:ENSDARG00000116414.1 transcript:ENSDART00000192204.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX248308.2)

HSP 1 Score: 210.305 bits (534), Expect = 1.566e-63
Identity = 139/362 (38.40%), Postives = 191/362 (52.76%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-----ENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEM-CPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSI 1239
            +II    GN+LV++++   R++R    N F++SLA AD+LVAL VMP    ++ T G W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y++ MT  RV LML+GCW     IS++PI     T       E   L    +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  + +A          +   S Y  N  D  GS                     +++ E KAAKTL +IMGCF +CW PFF    +TN+    +    P  +     W+GY NS LNP +YAF NR FR AF  IL C  +   R+      +  S S   TSI
Sbjct:   34 IIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIEL-TTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAG---------SAPTSTYPNN--DQHGS--------------------SRIKNETKAAKTLAVIMGCFCLCWAPFF----VTNVVDPFINYSVPWQMWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLMILCCGDERYARQGGFSPSRQCSESVNGTSI 359          
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Match: BX248308.1 (pep chromosome:GRCz11:CHR_ALT_CTG21_1_11:20220498:20237130:1 gene:ENSDARG00000113397.1 transcript:ENSDART00000192824.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX248308.1)

HSP 1 Score: 210.305 bits (534), Expect = 1.566e-63
Identity = 139/362 (38.40%), Postives = 191/362 (52.76%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-----ENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEM-CPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSI 1239
            +II    GN+LV++++   R++R    N F++SLA AD+LVAL VMP    ++ T G W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y++ MT  RV LML+GCW     IS++PI     T       E   L    +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  + +A          +   S Y  N  D  GS                     +++ E KAAKTL +IMGCF +CW PFF    +TN+    +    P  +     W+GY NS LNP +YAF NR FR AF  IL C  +   R+      +  S S   TSI
Sbjct:   34 IIIMTALGNLLVMVALCKDRQLRKKKTNFFIVSLAFADLLVALVVMPLAAIEL-TTGKWNYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYNNKMTPVRVSLMLVGCWVIPFFISFLPIMQSWNTIGIESFIEQRKLNSSRNSTCVFMVNQPYALVCSAVAFYVPLVLMVLAYQRIYVTAMGHARRIGSLHRAG---------SAPTSTYPNN--DQHGS--------------------SRIKNETKAAKTLAVIMGCFCLCWAPFF----VTNVVDPFINYSVPWQMWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLMILCCGDERYARQGGFSPSRQCSESVNGTSI 359          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: DRD1 (dopamine receptor D1 [Source:NCBI gene;Acc:100485463])

HSP 1 Score: 199.519 bits (506), Expect = 1.226e-58
Identity = 134/346 (38.73%), Postives = 192/346 (55.49%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX---XXXTT---NENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLC-------GEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQK 1167
            S +I+S + GN LV  +VI +R +R+   N FV+SLA++D+LVA+ VMP+     +  GFWPFG+  C I+ + D+  STASI++LC IS+DR++AI  P  Y+  MT     +M+   WT SILIS+IP+        TT   + N+ L     + C+  +N  YAI SS +SF+IP  +M++ Y RIY+ A K  R I  +E+A          N QNS  ++N+ D      C+   S +++           +RE K  KTL +IMG F+ CW PFF+   I   C       G E         DV  W G+ANS+LNP+IYAF N +FR AF  +L C +
Sbjct:   21 SVLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIA-GFWPFGTF-CNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMISVAWTLSILISFIPVQLNWHKAKTTSFFDLNITLHGRTMDNCDSSLNRTYAISSSLISFYIPVAIMIVTYTRIYRIAAKQIRRISALERAAVHAK-----NCQNSTGNRNSLD------CQQPESSLKTS---------FKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPSLTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAF-NADFRKAFSNLLGCYR 343          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: rgs9bp (regulator of G-protein signaling 9 binding protein [Source:Xenbase;Acc:XB-GENE-1011615])

HSP 1 Score: 197.208 bits (500), Expect = 1.999e-58
Identity = 139/376 (36.97%), Postives = 197/376 (52.39%), Query Frame = 1
Query:   82 NPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTT-----------NENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEM-CPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            N N+N S + +    + + I+ I      S VI+  + GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V    W +G + C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI  G  +            N++ N     S  C F VN  YAI  S V+F+IP  +M+L Y RIY  A +H R I  +++A                            G  +D    + Q+       +++ E KAAKTL IIMGCF +CW PFF    ITN+    +    P  L     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    5 NKNVNKSNEGYGVAARIVLISFI------SAVILMTILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQEK-WIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRITLMLSGCWIIPTFISFLPIMQGWNSIGILDLIETRKYNKSSN-----STNCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIGVLQRA----------------------------GAPADH---RHQHPDQHTTHRMKTETKAAKTLCIIMGCFCLCWAPFF----ITNVVDPFINYSVPVELWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCGDE 333          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: rgs9bp (regulator of G-protein signaling 9 binding protein [Source:Xenbase;Acc:XB-GENE-1011615])

HSP 1 Score: 196.438 bits (498), Expect = 3.111e-58
Identity = 138/374 (36.90%), Postives = 193/374 (51.60%), Query Frame = 1
Query:   88 NINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTT-----------NENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEM-CPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            NIN +  +       I +   I A     VI+  + GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V    W +G + C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI  G  +            N++ N     S  C F VN  YAI  S V+F+IP  +M+L Y RIY  A +H R I  +++A                            G  +D    + Q+       +++ E KAAKTL IIMGCF +CW PFF    ITN+    +    P  L     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    4 NINVTSNEGYGVAARIVLISFISA-----VILMTILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQEK-WIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYRNKMTPLRITLMLSGCWIIPTFISFLPIMQGWNSIGILDLIETRKYNKSSN-----STNCIFMVNKPYAITCSVVAFYIPFFLMVLAYYRIYITAREHARQIGVLQRA----------------------------GAPADH---RHQHPDQHTTHRMKTETKAAKTLCIIMGCFCLCWAPFF----ITNVVDPFINYSVPVELWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCGDE 331          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 192.971 bits (489), Expect = 1.121e-55
Identity = 126/375 (33.60%), Postives = 208/375 (55.47%), Query Frame = 1
Query:   67 NSIMENPNINFSCKDFASPKKEISITEIIKAIGPSFV----IISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLR-----REHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
            + +++N N + S + FA+  K I    + +A+   F     I  A+ GN++VI+SV+  +++R +  N  +++LA+AD+L++  V+PF+ T+ +  G+W FG ++C+++ + DV   TASI  LC IS+DR+  + H L Y +I+T+ R  L LLG W  S +IS  P+         +       + +C       YAI SS  SF+IP +V+L++Y R+Y  A +  +++       R  S    +     N   ++ +++            + QNN  R    L+     RE KAAKTLGI++G FI+CW PFF    +++L  E + P P  L  ++FW+GY NS +NP+IY   ++EF+ AF +ILKCQ
Sbjct:   16 DMLLDNDNSSDSNQTFAN--KTIPSVNLTRAMLLGFTLGAFISVAIIGNIMVIISVVTNKQLR-IPTNYLIVNLAIADLLLSSTVLPFSATKEIV-GYWVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVISIGPLLGWKEPAPPD-------TYVCEITTEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVMKERMDSKELTLRIHCRNKQDDSPNNS------------KVQNNQPRSALSLKLLKFSREKKAAKTLGIVVGMFILCWLPFFTVLPLSSL-SEHLTP-PVTLEKIIFWLGYFNSCINPIIYPCSSKEFKRAFIRILKCQ 365          
BLAST of Octopamine receptor vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 190.66 bits (483), Expect = 1.944e-55
Identity = 126/404 (31.19%), Postives = 199/404 (49.26%), Query Frame = 1
Query:  130 EISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHER------DIYKMEKAFRRKSNRFIINTQNSNYSKNNFDST------------GSP-----------------------------GCES---------------DRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
             I  T +I AI  +F+++  +FGNVLVI++V+  R ++    NLF++SLA AD+LVA  ++PF+L   +  G+W FG   CE+Y + DV   T+SI+HLC IS+DR++++   + Y+S  T  R+  ++L  WT + LIS  P+     + ++N          C       Y + SS  SF+ PC++M+LVYLRIY  A +  R       + KM      ++N+  +N+ ++        S             G P                             GCE                 +    S  +  ++   + RE +    L +++G F++CWFPFF  YS+  +C  E+C  P  +    FWIGY NS+LNP+IY  +N++FR AFR+IL
Sbjct:   13 SIQATAVIAAI-ITFLVLFTIFGNVLVIIAVLTSRSLKA-PQNLFLVSLAAADILVATLIIPFSLANELM-GYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISLPPLIYKGKSKDQN------AKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLNSSHTQTQCGIISSQEKTGLALDDLHCGVPVLSSTREERNGHSESFGLQPQGENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAIC-TELCYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFRRIL 406          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 201.445 bits (511), Expect = 3.063e-60
Identity = 131/354 (37.01%), Postives = 192/354 (54.24%), Query Frame = 1
Query:  136 SITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN--ENLNLLRFC----SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S+ +++     + VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW   + IS++PI  G       + +   +F     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H + I  +++A     +R     Q+S +                               ++R E KAAKTL +IMGCF  CW PFF    +TN+  +    Y  P  +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:   16 SVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTH-------------------------------RMRTETKAAKTLCVIMGCFCFCWAPFF----VTNIV-DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 201.445 bits (511), Expect = 3.989e-60
Identity = 131/354 (37.01%), Postives = 192/354 (54.24%), Query Frame = 1
Query:  136 SITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN--ENLNLLRFC----SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S+ +++     + VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW   + IS++PI  G       + +   +F     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H + I  +++A     +R     Q+S +                               ++R E KAAKTL +IMGCF  CW PFF    +TN+  +    Y  P  +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:   16 SVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTH-------------------------------RMRTETKAAKTLCVIMGCFCFCWAPFF----VTNIV-DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 201.83 bits (512), Expect = 4.074e-60
Identity = 131/354 (37.01%), Postives = 192/354 (54.24%), Query Frame = 1
Query:  136 SITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN--ENLNLLRFC----SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S+ +++     + VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW   + IS++PI  G       + +   +F     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H + I  +++A     +R     Q+S +                               ++R E KAAKTL +IMGCF  CW PFF    +TN+  +    Y  P  +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:   16 SVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTH-------------------------------RMRTETKAAKTLCVIMGCFCFCWAPFF----VTNIV-DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Htr4 (5 hydroxytryptamine (serotonin) receptor 4 [Source:MGI Symbol;Acc:MGI:109246])

HSP 1 Score: 201.06 bits (510), Expect = 7.185e-60
Identity = 131/354 (37.01%), Postives = 192/354 (54.24%), Query Frame = 1
Query:  136 SITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN--ENLNLLRFC----SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S+ +++     + VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW   + IS++PI  G       + +   +F     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H + I  +++A     +R     Q+S +                               ++R E KAAKTL +IMGCF  CW PFF    +TN+  +    Y  P  +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:   16 SVEKVVLLTFLAVVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWAYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVLPMFISFLPIMQGWNNIGIVDVIEKRKFSHNSNSTWCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAQQIQMLQRAGATSESRPQPADQHSTH-------------------------------RMRTETKAAKTLCVIMGCFCFCWAPFF----VTNIV-DPFIDYTVPEQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. Ensembl Mouse
Match: Adrb3 (adrenergic receptor, beta 3 [Source:MGI Symbol;Acc:MGI:87939])

HSP 1 Score: 186.422 bits (472), Expect = 3.483e-54
Identity = 125/326 (38.34%), Postives = 185/326 (56.75%), Query Frame = 1
Query:  190 VFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCS--EICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKL--RREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
            V GN+LVI+++    +++T+  N+FV SLA AD++V L VMP   T  +T G WP G   CE++ S DV   TASI  LC +++DR+ A+ +PL Y +++TK R    ++  W  S  +S+ PI S  +    +       S    C+F  N  YA++SSSVSF++P +VML VY R++  A K +R +       RR+  RF       + S++   +TG      D         C R+  +L   REH+A +TLG+IMG F +CW PFFL   +  L G  + P  G+ I  L W+GYANSA NP+IY   + +FR+AFR++L
Sbjct:   49 VGGNLLVIIAIARTPRLQTIT-NVFVTSLAAADLVVGLLVMPPGATLALT-GHWPLGETGCELWTSVDVLCVTASIETLCALAVDRYLAVTNPLRYGTLVTKRRARAAVVLVWIVSAAVSFAPIMSQWWRVGADAEAQECHSNPRCCSFASNMPYALLSSSVSFYLPLLVMLFVYARVFVVA-KRQRHL------LRRELGRFSPEESPPSPSRSPSPATGGTPAAPD-----GVPPCGRRPARLLPLREHRALRTLGLIMGIFSLCWLPFFLANVLRALAGPSLVPS-GVFI-ALNWLGYANSAFNPVIYC-RSPDFRDAFRRLL 357          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q9VCZ3|OCTB1_DROME (Octopamine receptor beta-1R OS=Drosophila melanogaster OX=7227 GN=Octbeta1R PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.731e-94
Identity = 167/329 (50.76%), Postives = 227/329 (69.00%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 1158
            F+I++A+ GN+LVI+SV+ +RK+R +  N FV+SLA+AD+LVAL  M FN + ++ +G W FGS+MC+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y  IMT+ RV +MLL  W S  L+S++PI SG YTT EN   L+    IC FKVN  YAIVSSS+SFWIP +VML +Y RIY+EA + ER +Y+ + A            Q S   K        P  + ++S I +          +RRE KAA+TLGIIM  F+ICW PFFLWY +++LC  + C  P LL+ +LFWIGY NSALNP+IYA++NR+FR AF++ LK
Sbjct:  116 FIILAAILGNMLVIVSVMRHRKLRIIT-NYFVVSLAVADMLVALCAMTFNAS-VMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKSNPHICEFKVNKAYAIVSSSMSFWIPGIVMLSMYYRIYQEADRQERLVYRSKVAALLLEKHL----QISQIPKPR------PSIQVEQSTIST----------MRRERKAARTLGIIMSAFLICWLPFFLWYIVSSLC--DSCITPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLK 420          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q4LBB9|OCTB2_DROME (Octopamine receptor beta-2R OS=Drosophila melanogaster OX=7227 GN=Octbeta2R PE=2 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 1.878e-88
Identity = 156/343 (45.48%), Postives = 222/343 (64.72%), Query Frame = 1
Query:  136 SITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQ-KLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC 1161
            +I  + KA     +II+A+ GN+LVI+SV+  RK+R +  N FV+SLAMAD++VA+  M FN +  VT G W F   +C+++NS DV+ STASI+HLCCIS+DR++AI+ PL Y   MTK  VG+MLL  W S  L+S++PI+ G YTT ++   +      C+F VN  YA++SSS+SFWIPC +M+  YL I++EA + E+ +        R  N  +++  +   S      +GS    +   + Q       +   K++REHKAA+TLGIIMG FI+CW PFFLWY+++  C E  C  P +++ +LFWIGY NS LNPLIYA++NR+FR AFR  L C
Sbjct:  150 NIVWVFKAFVMLLIIIAAICGNLLVIISVMRVRKLRVIT-NYFVVSLAMADIMVAIMAMTFNFSVQVT-GRWNFSPFLCDLWNSLDVYFSTASILHLCCISVDRYYAIVKPLKYPISMTKRVVGIMLLNTWISPALLSFLPIFIGWYTTPQHQQFVIQNPTQCSFVVNKYYAVISSSISFWIPCTIMIFTYLAIFREANRQEKQL------MMRHGNAMLMHRPSMQPSGEALSGSGSSKTLTLHEVEQEHTPTKDKHLIKMKREHKAARTLGIIMGTFILCWLPFFLWYTLSMTCEE--CQVPDIVVSILFWIGYFNSTLNPLIYAYFNRDFREAFRNTLLC 482          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|G3M4F8|OCTB2_CHISP (Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 2.171e-87
Identity = 154/331 (46.53%), Postives = 217/331 (65.56%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYS-KNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC 1161
             ++I AV GN+LVI+SV+ +RK+R +  N FV+SLA AD+LVA+ VMPFN +     G W FG  +C+++NS+DV+ ++ SI+HLCCIS+DR++AI+ PL Y   MTK    +ML   W S I ISY+PI+ G YTT + L   R   + C FKVN  YA++SSS+SFWIPC +M+  YL I+KEA + E+ ++       R  N  +++  +   S KN      +     DR+L+           K++REHKAA+TLGIIMG FI+CW PFFL+Y  T+LC  + C  P ++  ++FW GY NSALNP+IYA++NR+FRNAF+  L C
Sbjct:   46 LIVIMAVLGNMLVIVSVMRHRKLRVIT-NYFVVSLAFADILVAMVVMPFNFSVQFNQG-WVFGETICDLWNSSDVYFTSTSILHLCCISVDRYYAIVKPLKYPIKMTKKMAFVMLAATWLSPITISYVPIFMGWYTTTDFLESRR--DDQCEFKVNKPYAVISSSISFWIPCTIMIFTYLAIFKEANRQEKALHA------RAGNAMLMHRHSREVSDKNGALHINATTPTKDRNLL-----------KMKREHKAARTLGIIMGAFILCWLPFFLYYVSTSLC--DSCNCPEVVTVIMFWTGYFNSALNPIIYAYFNRDFRNAFKNTLAC 353          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|O70528|5HT4R_CAVPO (5-hydroxytryptamine receptor 4 OS=Cavia porcellus OX=10141 GN=HTR4 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.942e-63
Identity = 143/380 (37.63%), Postives = 199/380 (52.37%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXX-----------XXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S K+ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW   + IS            I         N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H R I  +++A      R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG L     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSKEGFGSVEKVVLLTFL------SAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRPQPADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQLWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. UniProt/SwissProt
Match: sp|Q13639|5HT4R_HUMAN (5-hydroxytryptamine receptor 4 OS=Homo sapiens OX=9606 GN=HTR4 PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 1.148e-61
Identity = 141/380 (37.11%), Postives = 201/380 (52.89%), Query Frame = 1
Query:   76 MENPNINFSCKD-FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX-----------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            M+  + N S ++ F S +K + +T +      S VI+ A+ GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G + C +  S DV L+TASI HLCCIS+DR++AI   PL Y + MT  R+ LML GCW     IS++PI                  N+N N     S  C F VN  YAI  S V+F+IP ++M+L Y RIY  A +H   I  +++A     +R     Q+S +                               ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  PG +     W+GY NS LNP +YAF N+ FR AF  IL C  +
Sbjct:    1 MDKLDANVSSEEGFGSVEKVVLLTFL------STVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQD-IWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN-----STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTH-------------------------------RMRTETKAAKTLCIIMGCFCLCWAPFF----VTNIV-DPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDE 332          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A193KU78 (GCR034 OS=Schmidtea mediterranea OX=79327 GN=gcr034 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 8.133e-102
Identity = 177/333 (53.15%), Postives = 229/333 (68.77%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFII--NTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQK 1167
            VI +A FGN LVI+SV  Y ++R    N FV SLA AD LVA+ VMPFNL Q V NG W FG ++C I+NSNDVF STAS+IH+ CI +DR+ AII P  Y+ I+T +RV ++L   W +S+LIS+IPI+SG+YTT ENL LL+FC  +C+FKVN IYAIVSS++SFWIP  +M +VYL+I+KEA   E+ I       +   N   +  N Q+ N+ K              +SL  S N   R     +REHKAAKTLGIIMGCFI CW PFF+WY+++N+C +  C +P ++ D++FWIGY NS LNP+IYAFYNREFR AF+Q+LK  K
Sbjct:   34 VIFAASFGNGLVIISVWKYPRLRRQITNHFVFSLAFADFLVAILVMPFNLIQTVNNGRWLFGPVLCNIFNSNDVFFSTASLIHIGCIGLDRYIAIIKPFKYEIILTNSRVAIILTVSWITSLLISHIPIHSGIYTTEENLVLLKFCRLVCHFKVNMIYAIVSSTISFWIPSSIMCVVYLKIFKEAKNQEKKIILATPYPKENRNSLTVDMNIQSQNFIK--------------KSLSVSSNMSKRN---FKREHKAAKTLGIIMGCFIACWLPFFIWYTVSNVC-QSSCSFPEIIGDIVFWIGYVNSTLNPIIYAFYNREFRKAFKQVLKYNK 348          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A1S3HTF6 (octopamine receptor beta-2R OS=Lingula unguis OX=7574 GN=LOC106158035 PE=3 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.224e-99
Identity = 169/369 (45.80%), Postives = 242/369 (65.58%), Query Frame = 1
Query:   85 PNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGS-LMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKN 1188
            PN      +   P+++ ++  I K I  + ++++AV GN+LVI+SVI +R++R +  N F++SLA AD+LVA+ VMPFN  Q +  G W F   L+C+I+N+NDV  STASI+HLCCISMDR  AI+HPL Y+S MTKTRV +ML   W +S  ISYIPI+S  YTT EN   +    E C F V  +YA++SS VSFWIPC +M+  YL++Y+EA + E+ I+     + R S    I+T  SN S    + T S    S  +    +++  R  ++++REHKAAKTLGI+MG F++C+ PFF WY I+ +C    C  P L++  LFWIGY NS LNP+IYA++NREFRN+F+++L    +   R++
Sbjct:   36 PNATNETGNTTEPEEQSAVVLIFKGIAMAMIMLAAVCGNILVIVSVIRFRRLRVIT-NCFIVSLAFADLLVAILVMPFNAIQELA-GKWIFKDRLVCDIFNANDVLFSTASILHLCCISMDRFIAIMHPLHYESSMTKTRVAIMLTLTWGASATISYIPIHSQWYTTPENYKEMLRHPETCAFIVTKVYAVISSCVSFWIPCSIMVFTYLKVYREARRQEKQIHAQTTHYARGS----ISTDGSNSSGGQVNGTASEAWNSSFAR-HGESDSGRDRRRMKREHKAAKTLGIVMGAFVLCYLPFFSWYVISTMCD---CDTPPLVVATLFWIGYFNSCLNPIIYAYFNREFRNSFKKLLGLDTRCGKRRH 394          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A2P2I9Z5 (Octopamine receptor beta-2R-like (Fragment) OS=Hirondellea gigas OX=1518452 PE=2 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 4.667e-98
Identity = 172/359 (47.91%), Postives = 235/359 (65.46%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKA-----FRRKSNRFIINTQNSNYSKNNFDSTGS--------------PGCESDRSLI---------QSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC 1161
            + +I+ AV GN+LV++SVI +RK+R +  N FV+SLA+AD+LVAL  MPFNL+ +   G W F   MC ++NS DV+ ST SI+HLCCIS+DRHFAI+ PL Y  +MTK RV  ML+G W + I+IS++PIY   YTT+E++  L+    IC F+VN  YA+VSS++SFW+PC VML +Y RIY+EA + E+ +Y+  +          S   I    + + S ++ + TGS              P  E+ R L+         +S     R   KL+REHKAA+TLGIIMG FI CW PFFLWY I+ LCGEE+CP P +++ +LFWIGY NS LNP IYA++NR+FR AF++ L C
Sbjct:   73 AIIIVCAVLGNLLVVVSVIRHRKLRVIT-NFFVVSLAIADILVALMAMPFNLS-VELMGEWLFSYNMCNLWNSFDVYASTVSILHLCCISIDRHFAIVRPLEYPMVMTKRRVAFMLIGVWLAPIIISFLPIYMEWYTTSEHVQFLKDNPNICRFQVNTTYALVSSTISFWLPCSVMLYMYYRIYQEASRQEKMLYRHARPSCASQIPFASTDAIPPVGSPHNSSSSNNRTGSGSRTGSGNSRLLEPPSMETGRRLLIHRTSTDVQESSPARERNLIKLKREHKAARTLGIIMGAFITCWMPFFLWYVISTLCGEEICPVPDIVVSILFWIGYFNSMLNPAIYAYFNRDFREAFKRTLAC 429          
BLAST of Octopamine receptor vs. TrEMBL
Match: T1I5H6 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=3 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 6.577e-98
Identity = 176/372 (47.31%), Postives = 246/372 (66.13%), Query Frame = 1
Query:   94 NFSCKDFASPKKEISI--TEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKN-NFDSTGSPGCES-----DRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRK 1185
            N + +DF    +  ++  + +IK      +II+A+FGN+LVI+SV+ +RK+R +  N FV+SLA AD+LVAL VM FN +  +T G W FG  MC+ +NS DV+ STASI+HLCCIS+DR++AI+ PL Y   MTK  V +MLL  W +  +IS++PI  G YTTNEN        +IC+FKV  IYA+VSS +SFWIPC +M+  YL I++EAI+ E+ ++       R  N+ ++N    N S++ N D+ GS G  S     +   + S     R   K++REHKAA+TLGIIMG FI+CW PFFLWY I ++CGEE CP P +++  LFWIGY NS LNP+IYA++NR+FR AF+  ++C    L R+
Sbjct:   21 NVTMQDFEDVDQSWAVILSTLIKGTIMGAIIIAAIFGNLLVIVSVMRHRKLRIIT-NYFVVSLAFADMLVALAVMTFNASVQLT-GRWMFGPFMCDAWNSLDVYFSTASILHLCCISVDRYYAIVKPLRYPINMTKQVVAIMLLSTWIAPAVISFVPILCGWYTTNENQEFRNEHPDICHFKVTAIYAVVSSLISFWIPCTIMVFTYLAIFREAIRQEKQLHA------RMGNQMLLN----NSSRDCNGDTLGSSGGSSKALALNEVGLHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVIVSVCGEEACPTPEIVVSTLFWIGYFNSTLNPIIYAYFNRDFREAFKNTIQCAFCSLCRR 380          
BLAST of Octopamine receptor vs. TrEMBL
Match: A0A291L8J3 (Octopmaine beta-2 receptor OS=Rhodnius prolixus OX=13249 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 9.897e-98
Identity = 176/372 (47.31%), Postives = 246/372 (66.13%), Query Frame = 1
Query:   94 NFSCKDFASPKKEISI--TEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKN-NFDSTGSPGCES-----DRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRK 1185
            N + +DF    +  ++  + +IK      +II+A+FGN+LVI+SV+ +RK+R +  N FV+SLA AD+LVAL VM FN +  +T G W FG  MC+ +NS DV+ STASI+HLCCIS+DR++AI+ PL Y   MTK  V +MLL  W +  +IS++PI  G YTTNEN        +IC+FKV  IYA+VSS +SFWIPC +M+  YL I++EAI+ E+ ++       R  N+ ++N    N S++ N D+ GS G  S     +   + S     R   K++REHKAA+TLGIIMG FI+CW PFFLWY I ++CGEE CP P +++  LFWIGY NS LNP+IYA++NR+FR AF+  ++C    L R+
Sbjct:   43 NVTMQDFEDVDQSWAVILSTLIKGTIMGAIIIAAIFGNLLVIVSVMRHRKLRIIT-NYFVVSLAFADMLVALAVMTFNASVQLT-GRWMFGPFMCDAWNSLDVYFSTASILHLCCISVDRYYAIVKPLRYPINMTKQVVAIMLLSTWIAPAVISFVPILCGWYTTNENQEFRNEHPDICHFKVTAIYAVVSSLISFWIPCTIMVFTYLAIFREAIRQEKQLHA------RMGNQMLLN----NSSRDCNGDTLGSSGGSSKALALNEVGLHSTPTKDRNIIKMKREHKAARTLGIIMGTFILCWLPFFLWYVIVSVCGEEACPTPEIVVSTLFWIGYFNSTLNPIIYAYFNRDFREAFKNTIQCAFCSLCRR 402          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: ENSAMXT00000025724.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:420606:424043:-1 gene:ENSAMXG00000024998.2 transcript:ENSAMXT00000025724.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 1.218e-63
Identity = 132/351 (37.61%), Postives = 194/351 (55.27%), Query Frame = 1
Query:  112 FASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
            F SP   I++  I   IG    I   V GN LV+L++  ++++++ + N FV+SLA+AD LV L VMP+++ + V  G W FG+  C +++S DV L TASI HL CI+ DR++A+ +PL Y   M+++RV L+++ CW   +LIS+ PI  GL+    N++L      +C F VN +YA+++S V+F++P   ML  Y +IYK A +    I  ME                         +  + G   D S  Q   N       +RRE KAAKTLGIIMG F++ W PFF    +            G++ DV  W+GY NS+LNP +Y F+NR FR AF  I+ C+
Sbjct:   16 FMSPGSRIAL-YIFIIIG----IFCTVVGNFLVVLAIAYFKQLQS-HTNSFVMSLAVADFLVGLVVMPYSMVRTV-EGCWHFGATFCHLHSSLDVMLCTASIFHLSCIAFDRYYAVCNPLVYSFKMSRSRVALLIVVCWAVPLLISFGPILLGLHKLGVNVSL---PENVCVFLVNRVYAVIASLVAFYLPMATMLFAYWKIYKAAKRQAMQISAME-------------------------AQMAAGVGKDSSKKQKHRN------SMRRERKAAKTLGIIMGVFLLFWLPFFTVNIVDPFIDYSTA---GVIWDVFLWLGYVNSSLNPFLYGFFNRSFRRAFLMIMGCR 322          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 206.453 bits (524), Expect = 3.138e-62
Identity = 135/341 (39.59%), Postives = 191/341 (56.01%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNEN--LNLLRFC--SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S V++ +V GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   +++ +  W +G   C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  RV LM+ GCW    +IS++PI  G  +   N  +   +F   S +C F VN  YA+  S V+F+IP  +M+L Y RIY  A +H R I  +++A                         G  G  +  S    +N+      ++R E KAAKTL IIMGCF +CW PFF    ITN+  +    Y  P  L     W+GY NS LNP++YAF N+ FR AF  IL C  K
Sbjct:   34 SLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQISMLQRA-------------------------GGAGNATSDSADHQRNH------RMRTETKAAKTLCIIMGCFCLCWAPFF----ITNVV-DPFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGHK 337          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 206.068 bits (523), Expect = 6.477e-62
Identity = 135/341 (39.59%), Postives = 191/341 (56.01%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNEN--LNLLRFC--SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S V++ +V GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   +++ +  W +G   C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  RV LM+ GCW    +IS++PI  G  +   N  +   +F   S +C F VN  YA+  S V+F+IP  +M+L Y RIY  A +H R I  +++A                         G  G  +  S    +N+      ++R E KAAKTL IIMGCF +CW PFF    ITN+  +    Y  P  L     W+GY NS LNP++YAF N+ FR AF  IL C  K
Sbjct:   26 SLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQISMLQRA-------------------------GGAGNATSDSADHQRNH------RMRTETKAAKTLCIIMGCFCLCWAPFF----ITNVV-DPFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGHK 329          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 205.682 bits (522), Expect = 2.406e-61
Identity = 135/341 (39.59%), Postives = 191/341 (56.01%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNEN--LNLLRFC--SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S V++ +V GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   +++ +  W +G   C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  RV LM+ GCW    +IS++PI  G  +   N  +   +F   S +C F VN  YA+  S V+F+IP  +M+L Y RIY  A +H R I  +++A                         G  G  +  S    +N+      ++R E KAAKTL IIMGCF +CW PFF    ITN+  +    Y  P  L     W+GY NS LNP++YAF N+ FR AF  IL C  K
Sbjct:   67 SLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQISMLQRA-------------------------GGAGNATSDSADHQRNH------RMRTETKAAKTLCIIMGCFCLCWAPFF----ITNVV-DPFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGHK 370          
BLAST of Octopamine receptor vs. Ensembl Cavefish
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:103021509])

HSP 1 Score: 205.682 bits (522), Expect = 2.586e-61
Identity = 135/341 (39.59%), Postives = 191/341 (56.01%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNEN--LNLLRFC--SEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S V++ +V GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   +++ +  W +G   C +  S DV L+TASI+HLCCIS+DR++AI   PL Y + MT  RV LM+ GCW    +IS++PI  G  +   N  +   +F   S +C F VN  YA+  S V+F+IP  +M+L Y RIY  A +H R I  +++A                         G  G  +  S    +N+      ++R E KAAKTL IIMGCF +CW PFF    ITN+  +    Y  P  L     W+GY NS LNP++YAF N+ FR AF  IL C  K
Sbjct:   67 SLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELIHHN-WIYGETFCLVRTSLDVLLTTASILHLCCISLDRYYAICCQPLVYQNKMTPMRVALMIGGCWIIPTVISFLPIMQGWNSIGINHLIEARKFSGNSTVCVFMVNKPYALTCSVVAFYIPLGLMVLAYQRIYVTAREHARQISMLQRA-------------------------GGAGNATSDSADHQRNH------RMRTETKAAKTLCIIMGCFCLCWAPFF----ITNVV-DPFIDYTVPEQLWAACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGHK 370          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 218.394 bits (555), Expect = 1.094e-67
Identity = 143/348 (41.09%), Postives = 192/348 (55.17%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAII-HPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXX--XXTTNENLNL-LRFCSEI----CNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKN 1188
            S +I   + GN+LV+++V   R +R +  N F++SLA+AD+LVA+ VMPF   + V N  WP+G   C I  S DV  +TASI+HLCCI++DR +AI   PL Y + MT  RVGLML  CW    LIS+IPI +G  +    + L L L    E     C F VN +YA+  S V+F+IP  +M   Y RIY  A  H R I  +++A  +                   D+TG      + +++Q+Q+       + R E KAAKTL IIMGCF +CW PFF+   I      +    P  L D   W+GYANSALNPL+YAF NR FR AF  IL C      R++
Sbjct:   27 SIIIAVTILGNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQND-WPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVYQNKMTPLRVGLMLGACWVVPSLISFIPIANGWNIIGIEQQLELRLGQAKEANQTHCIFMVNKVYAVACSLVAFYIPLGLMAAAYQRIYVTARAHARQIGSLQRAVSK-------------------DTTGD-----EATMVQTQST------RFRHETKAAKTLAIIMGCFCLCWAPFFINNVIDPFVNYDT---PQQLWDAWLWLGYANSALNPLLYAFLNRSFRRAFLAILCCWDAARYRRS 340          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: TAAR1 (trace amine associated receptor 1 [Source:HGNC Symbol;Acc:HGNC:17734])

HSP 1 Score: 176.022 bits (445), Expect = 1.243e-51
Identity = 114/342 (33.33%), Postives = 177/342 (51.75%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGL 1197
            F IIS + GN+LVI S+I ++++++ + N   LSLA AD+LV L VMPF++ + V +  W +G L+C+++ S D   ST SI+HL C++ DR+ AI  PL Y S +T   V  ML+ CWT  ++     + S      E +   R C++ C    N  +A V +  +F  P  +M+  Y++IY+ A +  R +                             S  S   + +R   + QN    Q   ++REH A KTLGIIMG F+  W P F+   I  +   +  P   L+ +++ W+GY NS +NPL+YA +NR FR AF+ +   +   L  +N  L
Sbjct:   38 FFIISTILGNMLVIASIIYFKQLQS-HTNSLTLSLAAADLLVGLVVMPFSMMRTV-HSCWFYGKLLCKLHCSLDYIFSTVSILHLSCVAFDRYVAICDPLHYTSRVTNNTVAFMLILCWTCPLVYFAPFLLSWNIIGIEEMVQSRICADTCAIVKNVWFAYVDTCCAFITPMAIMITTYVKIYRVARRQARQV-----------------------------SAASVALQLNRD--ERQN----QWALMKREHNATKTLGIIMGGFLFFWLPNFVASLIDPVNDFQTDP---LVWNIVVWLGYINSTINPLLYASFNRPFRKAFKIMFSLEITHLSTRNKDL 339          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: TAAR1 (trace amine associated receptor 1 [Source:HGNC Symbol;Acc:HGNC:17734])

HSP 1 Score: 169.474 bits (428), Expect = 5.651e-49
Identity = 115/370 (31.08%), Postives = 188/370 (50.81%), Query Frame = 1
Query:   88 NINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGL 1197
            N++ S     +P++ +++  +I     SF   + V GN L++LS++ +R+++T   N F LSLA+AD+LV L VMP+++ + V +  W +GSL C+++   D   +++S+IHL CIS+DR+ A+  PL Y   +  ++V LML+ CW++++               E +     C + C    N  +A  ++  ++ IP  +M+  Y +I++ A              R + N+   N            S   PG E       S ++  +Q   +RREH A KTLGIIMG F+I W P+     I  + G +         DV  WI Y NSA+NP+++A +NR FR AFR I  C+      +N  L
Sbjct:   21 NLSCSSPRLPAPQRTLALVVLI-----SFSACTVV-GNSLIVLSILYFRQLQT-RTNAFTLSLALADMLVGLLVMPYSMMRAVYSC-WFYGSLFCKVHTWFDFTFTSSSVIHLSCISIDRYIAVSDPLRYPKRLGPSKVALMLVVCWSTTLAYGLPFFSGWTVLGIEQVIARGSCRDACPVVGNMAFAFTNAFFAYLIPLCIMVTSYAKIFRIA--------------REQVNKIRAN------------SAHVPGVEF------SSSSTRQQWAAMRREHNATKTLGIIMGVFLIFWLPYCSVAVIDPIIGYQTS---ATSWDVANWIAYVNSAINPVLFASFNRSFRGAFRLIFTCRVSSSTYRNADL 347          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.053e-45
Identity = 107/352 (30.40%), Postives = 178/352 (50.57%), Query Frame = 1
Query:  196 GNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVY---LRIYKEAI------------------------KHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGL--LIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
            GN+LVIL+V L +K++T   N F++SLA+AD+LV L VMP ++  I+ N  WP    MC ++   DV  STASI+HLC IS+DR+ AI  P+ +    ++++  L +   W  SI I+      GL           F +  C   + + + I  S VSF++P ++M+++Y   +R+ +  +                        +H+R I++ ++   R     +   + S           S G     +L ++Q    R  Q L  E +A+K LGI+   F++ W PFF+    + LC E +C    +  L+D+  W+GY +S +NPL+Y  +N+ +R AFR+ + C 
Sbjct:   21 GNLLVILAVWLEKKLQTAT-NYFLMSLAVADLLVGLTVMPISVINILYNMRWPLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQDQQHV-----FVNGACILNIQN-FIIYGSVVSFFLPLLIMVVIYVLTIRLLRGQVGLMEVSRGSSSVSAVTSASTRRGSEHQRVIFRHKETLERLPT-LLDGERLSAVGGAAAAVAASMG-----TLRRTQAAHSRSAQALSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFVWVGYVSSGVNPLVYTLFNQTYRQAFRRYVACD 359          
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.762 bits (395), Expect = 1.407e-44
Identity = 113/364 (31.04%), Postives = 187/364 (51.37%), Query Frame = 1
Query:   82 NPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGL-MLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCG--EEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
             P  N S   + S   +I++  ++  I      +  + GN++V +  +L +++RT+ + +F++SLA AD+LVA  VMPF++   VT G W FG + C+++ S DV   TASI+ LC IS+DR+ ++  P  Y       ++ + M    W  S LIS++P+  G    NE   L    S  C F  N  +A+V+S+++F+IP +VM  +Y  IY+              A R K+ R +  T + +Y   +                       R+   L+ EHKA +T+ II+  F++CW P+F +          E+      +   V+ W+GY NSA+NP++YAF NR+F++A R+I  C+
Sbjct:    2 GPGENTSSATWRSKAGDITVGSLLSVID-----LVTLLGNLVVFVCPVLEKRLRTVTY-MFIMSLATADLLVACLVMPFSIIYEVT-GRWMFGRIFCKVWISFDVMFCTASIVTLCFISLDRYCSVSAPHRYTLPKEPKKICVAMTAAIWVYSSLISFLPVMRGW---NEIPGLDFDSSRECVFVTNRTFAVVASALAFYIPFLVMCTMYFFIYR--------------ASRLKAARIMSQTLDIHYHPKS-----------------------RRPNNLQLEHKATRTMSIIISAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHALRKIFICR 318          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO44740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ8])

HSP 1 Score: 155.221 bits (391), Expect = 1.393e-43
Identity = 93/329 (28.27%), Postives = 178/329 (54.10%), Query Frame = 1
Query:  172 FVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEE-MCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
             +II A+ GN+LV+ +   Y ++R    N +++SLA +D+L A  V+PF L Q + +G W  G + C+++ +  + +   SII+LC +++DR   +  PL Y +I+T  +  + ++  WT +++ + +P+       ++N + + F +  C F +   Y ++ +  +F +P + M + +  I+K A KH+R + K+E++         ++  N N ++N   S    G                + + +R+  K +K + II+G F ICW P+ L     ++CG +     P  + ++L  +GY NSALNP +Y+F++R+F+ AF+ IL
Sbjct:    5 LIIIFALLGNILVVYAFCNYHRLRANVTNYYIVSLAFSDILTAGLVVPFELDQTIRDGIWTHGRITCQLWTTLYLLVVPGSIINLCAVTLDRFIVLHMPLRYTTIITPRKAIVAIVCLWTYALVTACLPVLGW---KDQNYDYILFNA--CYFPLLQEYVMLINITNFLLPMIFMAVFWSLIFKIAKKHQRRVKKLERSMSMVETTMSLSI-NGNEAQNGRPSMSEGG----------------KKKTIRKHLKGSKYIAIIVGTFFICWLPYTLLSLGVSICGTKCFRGTPREVHNILLLMGYLNSALNPYMYSFHDRQFKEAFKNIL 311          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO49899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF54])

HSP 1 Score: 148.673 bits (374), Expect = 1.172e-41
Identity = 98/335 (29.25%), Postives = 164/335 (48.96%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCP-----YPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQ 1164
            VII+A+ GN+LV  +++++ ++R+   N F+ SLA++D++ A   MPF++ QI+    W  G  MC I+ ++ +  +  S+++L  +S+DR+ AI  PL Y +IMT   V   +   W  +IL + I + +         +        C+F ++  Y+++SS V+F +P +VM L+Y RIYK A  H R I                                                   +G  ++    AAKT+ II+  F++CW P    Y++ + C   +CP      P  L  V   + Y NSALNP +YAF+N +FR +FR++ + Q
Sbjct:    8 VIITALSGNILVCTAILVHERLRSSTTNYFIFSLAVSDIITASIAMPFDVDQILKKYTWEHGEAMCNIFVTSYLVAAPLSMLNLLAVSVDRYHAITQPLQYPNIMTPKVVLTSIFSLWVYAILFTVIAMLAWPLYEKSVFD------GACHFNISPWYSLISSVVNFVLPTIVMCLLYFRIYKVAHAHARRI---------------------------------------------------RGHDIK----AAKTIAIIVSAFLLCWMP----YTLVS-CASVICPPCFHRTPSELFTVTLLLAYINSALNPFLYAFHNTDFRESFRRLFRLQ 276          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO43118 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZL7])

HSP 1 Score: 144.821 bits (364), Expect = 4.478e-40
Identity = 115/356 (32.30%), Postives = 168/356 (47.19%), Query Frame = 1
Query:  100 SCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC 1161
            S     SP+  +S   I  +I   F+I+  + GN LVI S I Y +IRT   N FV+SLA  D+ VALF MP  L  I+T   W    ++  ++ + D+ + TASI +L  IS+DR   I  PL Y   +T  RV   +   W  S+L++               + L +   I NF        +SS V FW+P ++++  Y  +++ A++  R                 INT NS  ++            S  S +               E KAAKTL  ++G F +CW PF L   I ++C E  CPY  P +++ V+ W+ Y NS LNP IY   N++FR AF+ IL C
Sbjct:    4 SSSVLTSPQYSLSF-RIGTSIFTVFLILGTITGNALVIASFIAYSRIRTAT-NFFVVSLACTDLGVALFSMPLWLAYILTGTIWAENPVLFRVWTAMDILVGTASIGNLVAISLDRFLCITKPLMYYQYITSVRVNSTIACIWVYSVLMAVA-------------SYLLWQYRIFNF--------ISSIVYFWVPLLIIISAYSIVFRVALRQTRQ----------------INTSNSQKTR-----------ASRYSFVT--------------ELKAAKTLAAVVGAFALCWAPFVLINGIYSMCIE--CPYIKPEIIL-VVKWLHYGNSLLNPPIYGLLNKDFRVAFKHILCC 292          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO31709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX62])

HSP 1 Score: 145.591 bits (366), Expect = 4.735e-40
Identity = 108/367 (29.43%), Postives = 173/367 (47.14%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQ-KLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSIPAKRCRSKI 1266
            +I+  + GN LVI S I Y +IRT   N FV+SLA  D+ VALF MP  L  I+T   W    ++  ++ + D+ + TASI +L  IS+DR   I  PL Y   +T  RV   +   W  S+L++                 L +   I NF        +SS V FW+P ++++  Y  +++ A++  R                 INT N++                      SQ    R  +    +E KAAKTL +++G F +CW PF +  +I ++C    CP   P +++ V+ W+ Y NS +NP IY+F N++FR AF+ I+ C   +   +   L+F  +  S   ++    + R+ +
Sbjct:   28 LILGTIMGNTLVIASFIAYSRIRTAT-NFFVVSLACTDLGVALFSMPVWLAYILTGPIWVLNPVLFRVWTAMDILVGTASIGNLVAISLDRCLCITKPLMYYQYITSVRVNSTIACIWVYSVLMAVA-------------GYLLWQYRIFNF--------ISSIVYFWVPLLIIISAYSIVFRVALRQTRR----------------INTTNNS----------------------SQIRKTRASRYSFMKEMKAAKTLAVVVGAFFVCWAPFVVLNAIYSICTGADCPVLKPQIIL-VVKWMHYGNSLINPPIYSFLNKDFRVAFKHIICCNNLVATARRMDLMFARSDGSKGVSTQEIAQNRTTV 333          
BLAST of Octopamine receptor vs. Ensembl Nematostella
Match: EDO31702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX48])

HSP 1 Score: 141.739 bits (356), Expect = 3.280e-39
Identity = 98/345 (28.41%), Postives = 168/345 (48.70%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLC--GEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC-----QKKLLIRKN 1188
            +++  VFGNVLVI++  ++ ++R +  N FV SLA+ D+LVA+F MP  +  ++T   W    ++ +++   D+ +  ASI HL  +S+DR+  IIHP+ Y   MTK R  ++++  W                    ++ +    S + +++    Y +  + ++F IP V + + Y RI+  A +H+    +++   + K++RF                                         L +E KA KTL +++G F++CW PFF    + NLC     + P P +L+ +  W  Y NS LNPLIY   N++FR AF+++L       Q  LL+R N
Sbjct:    1 LLLLTVFGNVLVIMAFKVFHRMRQVT-NCFVASLAVTDILVAVFAMPVWVAYLITGPEWVMDMILQKLWTCTDIIVGVASIWHLTFVSIDRYLCIIHPMVYPLTMTKPRALVIIICIWV------------------YSIVVASLGSTLWHWRG---YTLFVTVMNFLIPAVAICIAYFRIFLTA-RHQAK--QIKLTIKGKTHRFF----------------------------------------LTKELKATKTLAVVIGAFLVCWSPFF----VINLCYYTSAVTPSP-VLVAIAKWAHYGNSCLNPLIYGVMNKDFRRAFKRLLAPYLPGKQTTLLLRSN 275          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: si:dkey-247m21.3 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:101158620])

HSP 1 Score: 204.912 bits (520), Expect = 2.196e-61
Identity = 137/336 (40.77%), Postives = 183/336 (54.46%), Query Frame = 1
Query:  190 VFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-ENLNLLR-FCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCES-DRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            VFGN+LV++++   R +R    N F++SLA AD+LVAL VMPF   ++ T G W +G L C +  S DV L+TASI+HLCCI++DR++AI   PL Y   MT  RV  ML GCW   + IS++PI         E++ L R F +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  +++A                          +P  +  D   I+S             E KAAKTL +IMGCF +CW PFF    ITN+      P+     PG L     W+GY NS LNP +YAF NR FR AF  IL C  +
Sbjct:   49 VFGNLLVMVALCTDRHLRKKKTNYFIVSLAFADLLVALVVMPFAAIEL-TTGQWHYGELFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRHKMTPVRVAAMLSGCWLIPMFISFLPIMQSWNEIGIEDIELNRGFNNTSCIFLVNWPYALVCSAVAFYVPLVLMVLAYQRIYVTAMTHVRQIETLQRA------------------------GSAPTTDPLDHYRIRSTT-----------ETKAAKTLAVIMGCFCLCWAPFF----ITNVVD----PFINYSVPGQLWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLVILCCGNE 340          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: htr4 (5-hydroxytryptamine receptor 4 [Source:ZFIN;Acc:ZDB-GENE-160114-31])

HSP 1 Score: 202.986 bits (515), Expect = 4.244e-61
Identity = 132/343 (38.48%), Postives = 188/343 (54.81%), Query Frame = 1
Query:  169 SFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXX------XXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY--PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            S V++ +V GN+LV+++V   R++R +  N F++SLA AD+LV++ VMPF   ++V +  W +G   C +  S DV L+TASI+HLCCI++DR++AI   PL Y + MT  RV LM+ GCW     IS++PI          +   E  +     +  C F VN  YA+  S V+F+IP V+M+L Y RIY  A  H   I  +++A                       + G+ G  +D +    Q N      ++R E KAAKTL IIMGCF +CW PFF    +TN+  +    Y  P  L     W+GY NS LNP++YAF N+ FR AF  IL C +K
Sbjct:   19 SLVMLMSVLGNLLVMVAVCKDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELV-HQHWIYGETFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRNKMTPMRVALMMGGCWVIPTFISFLPIMQGWNSIGIDHVIEERRHSGGSNTTSCVFMVNKPYALTCSLVAFYIPLVLMVLAYQRIYVTARAHALQISMLQRA-------------------GGAGAPGTSGVSADSA--DHQRN-----HRMRTETKAAKTLCIIMGCFCLCWAPFF----VTNVV-DPFIDYRVPDQLWTACLWLGYINSMLNPILYAFLNKSFRRAFLIILCCGRK 329          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: si:dkey-247m21.3 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:101158620])

HSP 1 Score: 204.912 bits (520), Expect = 5.763e-61
Identity = 139/344 (40.41%), Postives = 189/344 (54.94%), Query Frame = 1
Query:  190 VFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-ENLNLLR------FCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDR----SLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKK 1170
            VFGN+LV++++   R +R    N F++SLA AD+LVAL VMPF   ++ T G W +G L C +  S DV L+TASI+HLCCI++DR++AI   PL Y   MT  RV  ML GCW   + IS++PI         E++   R      F +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  +++A           T  ++       ST S   +  R    +   S  +      ++R E KAAKTL +IMGCF +CW PFF    ITN+      P+     PG L     W+GY NS LNP +YAF NR FR AF  IL C  +
Sbjct:   49 VFGNLLVMVALCTDRHLRKKKTNYFIVSLAFADLLVALVVMPFAAIEL-TTGQWHYGELFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRHKMTPVRVAAMLSGCWLIPMFISFLPIMQSWNEIGIEDIIKERISQTGGFNNTSCIFLVNWPYALVCSAVAFYVPLVLMVLAYQRIYVTAMTHVRQIETLQRAGSAP-------TTGTDPVVTVRTSTSSDPLDHYRIRSTTGSSSSESASVGNSRMRIETKAAKTLAVIMGCFCLCWAPFF----ITNVVD----PFINYSVPGQLWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLVILCCGNE 376          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: si:dkey-247m21.3 (5-hydroxytryptamine receptor 4 [Source:NCBI gene;Acc:101158620])

HSP 1 Score: 204.527 bits (519), Expect = 7.920e-61
Identity = 139/341 (40.76%), Postives = 188/341 (55.13%), Query Frame = 1
Query:  190 VFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAI-IHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTN-ENLNLLR------FCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDR----SLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPY-----PGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKC 1161
            VFGN+LV++++   R +R    N F++SLA AD+LVAL VMPF   ++ T G W +G L C +  S DV L+TASI+HLCCI++DR++AI   PL Y   MT  RV  ML GCW   + IS++PI         E++   R      F +  C F VN  YA+V S+V+F++P V+M+L Y RIY  A+ H R I  +++A           T  ++       ST S   +  R    +   S  +      ++R E KAAKTL +IMGCF +CW PFF    ITN+      P+     PG L     W+GY NS LNP +YAF NR FR AF  IL C
Sbjct:   46 VFGNLLVMVALCTDRHLRKKKTNYFIVSLAFADLLVALVVMPFAAIEL-TTGQWHYGELFCLVRTSLDVLLTTASILHLCCIALDRYYAICCQPLVYRHKMTPVRVAAMLSGCWLIPMFISFLPIMQSWNEIGIEDIIKERISQTGGFNNTSCIFLVNWPYALVCSAVAFYVPLVLMVLAYQRIYVTAMTHVRQIETLQRAGSAP-------TTGTDPVVTVRTSTSSDPLDHYRIRSTTGSSSSESASVGNSRMRIETKAAKTLAVIMGCFCLCWAPFF----ITNVVD----PFINYSVPGQLWTAWLWLGYINSGLNPFLYAFLNRAFRRAFLVILCC 370          
BLAST of Octopamine receptor vs. Ensembl Medaka
Match: ENSORLT00000024603.2 (pep primary_assembly:ASM223467v1:1:14259106:14266610:1 gene:ENSORLG00000019804.2 transcript:ENSORLT00000024603.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.897 bits (494), Expect = 2.837e-58
Identity = 122/322 (37.89%), Postives = 182/322 (56.52%), Query Frame = 1
Query:  178 IISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAF 1143
            I+S V GN LV+LS+  ++++++   N FV+SLA+AD  V L VMP+++ + V  G W FGSL C++++S DV L TASI HL CI+ DR +A+ +PL Y   M+++RV L++  CW   +LIS+ PI   L+    ++ +     ++C F V+ IYA+++S V+F++P  +ML+ Y +I+K A +    I  ME                         S  + G   D S  +      R    +RRE KAAKTLGIIMG F+I W PFF    +    G        ++ D+  W+GY NS+LNP +Y F+NR FR AF
Sbjct:   26 IVSTVVGNFLVVLSIAYFKQLQSPT-NCFVMSLAVADCFVGLVVMPYSMIRTV-EGCWYFGSLFCKLHSSLDVMLCTASIFHLSCIAFDRFYAVCNPLIYSLKMSQSRVALLITICWAVPMLISFGPIMLDLHIAGVDILIPE---DLCVFLVSRIYAVMASLVAFYLPMAIMLVAYWKIFKAAKRQALQISAME-------------------------SQMAAGVGKDSSKKR------RHRITMRRERKAAKTLGIIMGVFLIFWMPFFTLNIVDPFIGYTT---EVVVWDIFLWLGYINSSLNPFLYGFFNRSFRRAF 308          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000055001.1 (SMESG000055001.1)

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 400/400 (100.00%), Postives = 400/400 (100.00%), Query Frame = 1
Query:   76 MENPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSIPAKRCRSKITYA 1275
            MENPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTSSILISYIPIYSGLYTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSIPAKRCRSKITYA
Sbjct:    1 MENPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTSSILISYIPIYSGLYTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSIPAKRCRSKITYA 400          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000011585.1 (SMESG000011585.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.148e-104
Identity = 178/336 (52.98%), Postives = 232/336 (69.05%), Query Frame = 1
Query:  175 VIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDI-----YKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQK 1167
            VI +A FGN LVI+SV  Y ++R    N FV SLA AD LVA+ VMPFNL Q V NG W FG ++C I+NSNDVF STAS+IH+ CI +DR+ AII P  Y+ I+T +RV ++L   W +S+LIS+IPI+SG+YTT ENL LL+FC  +C+FKVN IYAIVSS++SFWIP  +M +VYL+I+KEA   E+ I     Y  E    R S    +N Q+ N+ K +         +S  S +  +N         +REHKAAKTLGIIMGCFI CW PFF+WY+++N+C +  C +P ++ D++FWIGY NS LNP+IYAFYNREFR AF+Q+LK  K
Sbjct:   34 VIFAASFGNGLVIISVWKYPRLRRQITNHFVFSLAFADFLVAILVMPFNLIQTVNNGRWLFGPVLCNIFNSNDVFFSTASLIHIGCIGLDRYIAIIKPFKYEIILTNSRVAIILTVSWITSLLISHIPIHSGIYTTEENLVLLKFCRLVCHFKVNMIYAIVSSTISFWIPSSIMCVVYLKIFKEAKNQEKKIILATPYPKEN---RNSLTLDMNIQSQNFIKKS---------QSVSSNMSKRN--------FKREHKAAKTLGIIMGCFIACWLPFFIWYTVSNVC-QSSCSFPEIIGDIVFWIGYVNSTLNPIIYAFYNREFRKAFKQVLKYNK 348          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000022932.1 (SMESG000022932.1)

HSP 1 Score: 269.626 bits (688), Expect = 1.756e-86
Identity = 154/342 (45.03%), Postives = 220/342 (64.33%), Query Frame = 1
Query:  139 ITEIIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSKNNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCP--YPGLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILK 1158
            I + IK +  S +I  A+FGN LVI+SV+ + K+R +  N FV+SLA+AD+LV+  VM F+ + + ++G W FG  +C+++N+NDV  STASI HL  ISMDR+ +I  P  Y+ IMT  +  LML+GCW  ++++SYIPI++GLY++ EN    +     C F+VN  + I SS +SFWIPC+VM +VY  IYK+A K E  I++M+K      +R   ++   +++  N +       + +R ++Q             +EHKAAKTLGIIMG FI+CW PFFLW +I N C    CP  +P +L+D LFWIGY NS LNP IYAFY ++FR AF+  LK
Sbjct:   24 IAKCIKTLLLSTIIAIAIFGNGLVIVSVLRFHKLRRIITNRFVVSLALADLLVSCCVMTFSASMVASDGLWLFGPFLCDLFNANDVLFSTASIAHLASISMDRYISIKMPFQYNQIMTSRKSILMLIGCWIYALVVSYIPIFTGLYSSAENFQWQKSNPTKCEFRVNPFFGIGSSIISFWIPCIVMTIVYGLIYKDARKQENQIFQMQKRTFSHGHR---SSVKCDHNSINLNDKKKTLYKEERIMLQ-------------KEHKAAKTLGIIMGVFIVCWLPFFLWMTIKNACLR--CPELHP-ILVDTLFWIGYFNSTLNPAIYAFYQQDFRRAFKIQLK 346          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000056795.1 (SMESG000056795.1)

HSP 1 Score: 192.2 bits (487), Expect = 5.642e-57
Identity = 132/358 (36.87%), Postives = 196/358 (54.75%), Query Frame = 1
Query:  148 IIKAIGPSFVIISAVFGNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQN---------SNYSKNNFDSTGSPGCES----DRSLIQSQNNC--------VRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEEMCPYPGLLIDV-LFWIGYANSALNPLIYAFYNREFRNAFRQIL 1155
            ++ +I    +I   + GN+LVILSVI +R +R +  N  ++SLA AD+ VA  VMPF L   +  G W FGS++C+ + ++DVF  TASI++LC I++DR++AI +PL Y +  T   +  ++ G +  S LIS  P+        E  NL      +C+   N IY + S+  SF IP VV+  VY+RIY    K  RD  K    F  +++R ++  +           N S  N     +P C +    + +   S NN          RQ   L +E K+A+T+GIIMG F+ICW PFFL Y I   C   +C      ++V L W+GY NSALNP+IY  +N++FR+AF ++L
Sbjct:   16 VLGSISAILIIFITIVGNILVILSVIYHRPLRKV-QNFLIISLAAADLSVASLVMPFALINYIL-GRWIFGSVLCDFWLTSDVFCCTASILNLCAIALDRYWAINYPLDYVNKRTIRTILSVICGAYILSGLISIPPLLGW---KEEMKNLY-----VCSLSDNRIYVLFSAFGSFIIPTVVIFFVYIRIYFAIRKRLRDKIK----FINQNDRLLMKKETVKNKRKDSKENSSLENETCKITPTCSNKVNNENTNFSSVNNSDKLNQFWNERQKISLSKERKSARTMGIIMGVFVICWSPFFLMYVIVPFCSASVCQNRNQRVEVFLVWLGYVNSALNPIIYTIFNKDFRDAFHKLL 359          
BLAST of Octopamine receptor vs. Planmine SMEST
Match: SMESG000025945.1 (SMESG000025945.1)

HSP 1 Score: 182.57 bits (462), Expect = 4.759e-53
Identity = 126/385 (32.73%), Postives = 195/385 (50.65%), Query Frame = 1
Query:  196 GNVLVILSVILYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCEIYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGCWTXXXXXXXXXXXXXXXTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSFWIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRR--------------KSNRFIINTQNSNYSKNNFDSTGSP-----------------------------------------GCESDRS-LIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFIICWFPFFLWYSITNLCGEE-MCPYP--GLLIDVLFWIGYANSALNPLIYAFYNREFRNAFRQILKCQKKL 1173
            GN L++++V+  R ++T+  N +V+SLA+AD+LV+  V+P  + + + +G W  G  +C+ + S D+ L TASI++LCCIS+DR+ AI  PL Y +  +    G M+L  W  S++IS  P+      ++ N     F +  C   ++  + I SS  SF+IP ++M+ VYLRI+  AI + R I        R              KS  F  +  +S   +   D   +P                                         GC    S L QSQ    ++     REHK AK + +++GCF++CW PFF  Y + +LC +  +CPYP   LL+  + W+GY NSALNP +YAFYN+E+   F++IL C+K L
Sbjct:   23 GNSLILIAVLTTRHLQTVT-NFYVVSLAIADLLVSGTVLPLTIAKEL-HGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGW---SDHN-----FTNTTCEISIHLGFRIYSSLGSFFIPLILMIFVYLRIF--AIANYRKILLNSHQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDLESNPKHAQALKLNSYLCQRPIHRSCALQNLIYKSGNLQNFTNLSTGCAVLSSGLSQSQKG--KETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTFKKILSCKKCL 393          
The following BLAST results are available for this feature:
BLAST of Octopamine receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR41.368e-6237.115-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR41.656e-6237.115-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.391e-6237.115-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.391e-6237.115-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
HTR42.605e-6237.115-hydroxytryptamine receptor 4 [Source:HGNC Symbol... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dop-19.810e-4934.23DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
octr-11.022e-4830.81OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
dop-11.060e-4834.23DOPamine receptor [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
octr-11.689e-4830.66OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
ser-72.052e-4232.58SERotonin/octopamine receptor family [Source:UniP... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Octbeta1R7.546e-9750.15gene:FBgn0038980 transcript:FBtr0301484[more]
Octbeta1R9.408e-9750.76gene:FBgn0038980 transcript:FBtr0100322[more]
Octbeta1R1.727e-9550.76gene:FBgn0038980 transcript:FBtr0331930[more]
Octbeta1R1.727e-9550.76gene:FBgn0038980 transcript:FBtr0084260[more]
Octbeta3R7.037e-9147.94gene:FBgn0250910 transcript:FBtr0301944[more]
back to top
BLAST of Octopamine receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-247m21.34.567e-6437.40si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
BX248308.29.126e-6438.25pep chromosome:GRCz11:CHR_ALT_CTG21_2_3:20217739:2... [more]
BX248308.19.126e-6438.25pep chromosome:GRCz11:CHR_ALT_CTG21_1_11:20224615:... [more]
BX248308.21.566e-6338.40pep chromosome:GRCz11:CHR_ALT_CTG21_2_3:20213622:2... [more]
BX248308.11.566e-6338.40pep chromosome:GRCz11:CHR_ALT_CTG21_1_11:20220498:... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD11.226e-5838.73dopamine receptor D1 [Source:NCBI gene;Acc:1004854... [more]
rgs9bp1.999e-5836.97regulator of G-protein signaling 9 binding protein... [more]
rgs9bp3.111e-5836.90regulator of G-protein signaling 9 binding protein... [more]
ENSXETT00000011711.11.121e-5533.60adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
ADRA2B1.944e-5531.19adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Htr43.063e-6037.015 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr43.989e-6037.015 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr44.074e-6037.015 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Htr47.185e-6037.015 hydroxytryptamine (serotonin) receptor 4 [Source... [more]
Adrb33.483e-5438.34adrenergic receptor, beta 3 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Octopamine receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VCZ3|OCTB1_DROME1.731e-9450.76Octopamine receptor beta-1R OS=Drosophila melanoga... [more]
sp|Q4LBB9|OCTB2_DROME1.878e-8845.48Octopamine receptor beta-2R OS=Drosophila melanoga... [more]
sp|G3M4F8|OCTB2_CHISP2.171e-8746.53Octopamine receptor beta-2R OS=Chilo suppressalis ... [more]
sp|O70528|5HT4R_CAVPO1.942e-6337.635-hydroxytryptamine receptor 4 OS=Cavia porcellus ... [more]
sp|Q13639|5HT4R_HUMAN1.148e-6137.115-hydroxytryptamine receptor 4 OS=Homo sapiens OX=... [more]
back to top
BLAST of Octopamine receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU788.133e-10253.15GCR034 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A1S3HTF61.224e-9945.80octopamine receptor beta-2R OS=Lingula unguis OX=7... [more]
A0A2P2I9Z54.667e-9847.91Octopamine receptor beta-2R-like (Fragment) OS=Hir... [more]
T1I5H66.577e-9847.31G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
A0A291L8J39.897e-9847.31Octopmaine beta-2 receptor OS=Rhodnius prolixus OX... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000025724.21.218e-6337.61pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
htr43.138e-6239.595-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
htr46.477e-6239.595-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
htr42.406e-6139.595-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
htr42.586e-6139.595-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-247m21.31.094e-6741.09si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
TAAR11.243e-5133.33trace amine associated receptor 1 [Source:HGNC Sym... [more]
TAAR15.651e-4931.08trace amine associated receptor 1 [Source:HGNC Sym... [more]
ENSPMAT00000004593.11.053e-4530.40pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
ENSPMAT00000006872.11.407e-4431.04pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Octopamine receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447401.393e-4328.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498991.172e-4129.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431184.478e-4032.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317094.735e-4029.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317023.280e-3928.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Octopamine receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-247m21.32.196e-6140.775-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
htr44.244e-6138.485-hydroxytryptamine receptor 4 [Source:ZFIN;Acc:ZD... [more]
si:dkey-247m21.35.763e-6140.415-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
si:dkey-247m21.37.920e-6140.765-hydroxytryptamine receptor 4 [Source:NCBI gene;A... [more]
ENSORLT00000024603.22.837e-5837.89pep primary_assembly:ASM223467v1:1:14259106:142666... [more]
back to top
BLAST of Octopamine receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055001.10.000e+0100.00SMESG000055001.1[more]
SMESG000011585.11.148e-10452.98SMESG000011585.1[more]
SMESG000022932.11.756e-8645.03SMESG000022932.1[more]
SMESG000056795.15.642e-5736.87SMESG000056795.1[more]
SMESG000025945.14.759e-5332.73SMESG000025945.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005928 ID=SMED30005928|Name=Octopamine receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=1305bp
ATCAGTTTCTATTGCTGGCAGGATCCTATGCACGCGTCATATTCAAAAAA
TGAAAAGATCTAAGTTAATTCTATCATGGAAAATCCAAATATCAATTTCA
GTTGCAAAGATTTTGCCTCGCCAAAGAAAGAAATCTCTATTACTGAAATA
ATAAAGGCTATAGGGCCCTCTTTTGTGATAATCAGTGCGGTATTCGGTAA
TGTTCTAGTAATCCTTAGTGTAATTCTCTATCGAAAAATCAGGACGCTCA
ATCATAACCTATTCGTTCTTAGTCTTGCTATGGCCGATGTACTCGTGGCC
TTGTTTGTTATGCCTTTCAATCTTACTCAAATTGTAACCAACGGATTTTG
GCCGTTTGGTTCTCTTATGTGCGAAATCTACAATTCCAATGATGTATTTC
TGAGTACTGCAAGCATAATTCATCTATGCTGTATCAGTATGGACCGTCAT
TTTGCCATCATTCATCCTCTCACATACGACAGCATTATGACGAAAACTCG
AGTGGGTTTGATGCTTCTCGGTTGTTGGACCTCTTCGATTCTTATATCAT
ACATTCCAATTTATTCTGGTCTGTATACGACAAATGAAAATTTAAATTTG
TTACGATTCTGTAGCGAAATCTGCAACTTCAAAGTCAACCATATCTATGC
TATTGTTTCCTCTTCGGTGTCCTTCTGGATTCCTTGTGTTGTCATGTTGT
TGGTTTACTTAAGAATATACAAAGAAGCTATTAAACATGAAAGGGATATT
TATAAAATGGAAAAAGCTTTTCGCCGTAAATCAAATCGTTTCATAATAAA
TACTCAGAACTCAAATTATTCGAAAAACAATTTCGATTCTACAGGATCTC
CCGGTTGTGAATCAGATAGGTCTTTAATCCAATCTCAGAACAACTGCGTA
AGACAAGGTCAGAAGTTGAGACGAGAACATAAAGCTGCCAAAACTCTAGG
AATAATCATGGGTTGCTTCATTATTTGTTGGTTTCCCTTTTTTCTGTGGT
ATAGTATAACTAATCTCTGTGGTGAGGAGATGTGTCCCTATCCCGGATTG
TTGATTGACGTTCTATTTTGGATCGGCTATGCCAATTCAGCTTTGAATCC
ATTGATATATGCTTTCTATAACCGGGAGTTTCGAAATGCATTTCGACAAA
TCCTAAAATGTCAAAAGAAGTTGCTTATAAGAAAGAATTATGGTTTGGTG
TTTAAAAATAACAGTTTCAGTGATGAGAAAACTTCCATTCCAGCAAAACG
ATGTAGGAGCAAAATTACATATGCTTAATTCGATGTGAAGATAGATTTGA
TGGGC
back to top

protein sequence of SMED30005928-orf-1

>SMED30005928-orf-1 ID=SMED30005928-orf-1|Name=SMED30005928-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=401bp
MENPNINFSCKDFASPKKEISITEIIKAIGPSFVIISAVFGNVLVILSVI
LYRKIRTLNHNLFVLSLAMADVLVALFVMPFNLTQIVTNGFWPFGSLMCE
IYNSNDVFLSTASIIHLCCISMDRHFAIIHPLTYDSIMTKTRVGLMLLGC
WTSSILISYIPIYSGLYTTNENLNLLRFCSEICNFKVNHIYAIVSSSVSF
WIPCVVMLLVYLRIYKEAIKHERDIYKMEKAFRRKSNRFIINTQNSNYSK
NNFDSTGSPGCESDRSLIQSQNNCVRQGQKLRREHKAAKTLGIIMGCFII
CWFPFFLWYSITNLCGEEMCPYPGLLIDVLFWIGYANSALNPLIYAFYNR
EFRNAFRQILKCQKKLLIRKNYGLVFKNNSFSDEKTSIPAKRCRSKITYA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 327..353
score: 37.41
coord: 192..215
score: 27.4
coord: 60..81
score: 35.54
coord: 142..163
score: 20.05
coord: 287..311
score: 32.11
coord: 26..50
score: 26.41
coord: 106..128
score: 33.21
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 34..360
e-value: 7.4E-4
score: -52.7
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 41..345
e-value: 4.2E-69
score: 232.8
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 112..128
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 246..275
e-value: 6.7E-34
score: 119.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 24..241
e-value: 8.4E-57
score: 194.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 276..359
e-value: 6.7E-34
score: 119.6
NoneNo IPR availablePANTHERPTHR24248ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 21..373
NoneNo IPR availablePANTHERPTHR24248:SF167OCTOPAMINE RECEPTOR BETA-2Rcoord: 21..373
NoneNo IPR availableCDDcd150667tmA_DmOct-betaAR-likecoord: 26..356
e-value: 3.59017E-132
score: 377.872
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 29..367
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 327..349
NoneNo IPR availableTMHMMTMhelixcoord: 143..165
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 41..345
score: 41.255