Transient receptor potential cation channel subfamily M member 6

Overview
NameTransient receptor potential cation channel subfamily M member 6
Smed IDSMED30005926
Uniprot Best hitTransient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=2 SV=4 (E=3.58845e-85)
Length (bp)4027
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transient receptor potential cation channel subfamily M member 6 (SMED30005926) t-SNE clustered cells

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 6 (SMED30005926) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transient receptor potential cation channel subfamily M member 6 (SMED30005926) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transient receptor potential cation channel subfamily M member 6 (SMED30005926) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005926

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30005926SMESG000064642.1 SMESG000064637.1 dd_Smed_v4_13119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005926SMESG000064642.1 SMESG000064637.1 dd_Smed_v4_13119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ovarySMED30005926SMESG000064642.1 SMESG000064637.1 SMED30005926smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30005926SMESG000064642.1 SMESG000064637.1 SMED30005926smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 322.783 bits (826), Expect = 1.799e-90
Identity = 296/1066 (27.77%), Postives = 493/1066 (46.25%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA+++        +K    +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E           +G  ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKD------HASKSRGKICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSE-----------EG-GLINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1061          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 321.627 bits (823), Expect = 3.195e-89
Identity = 297/1066 (27.86%), Postives = 493/1066 (46.25%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1061          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 293.893 bits (751), Expect = 1.936e-80
Identity = 274/967 (28.34%), Postives = 451/967 (46.64%), Query Frame = 3
Query:  504 FVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 908          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 286.189 bits (731), Expect = 4.981e-78
Identity = 275/978 (28.12%), Postives = 450/978 (46.01%), Query Frame = 3
Query:  504 FVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNK----------------------------EPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCAMC------------------DEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +  N                             + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY       N   T++H         L  ++   L D+                     + L   +FG   D   +                   D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSN---TLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 923          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Match: TRPM3 (transient receptor potential cation channel subfamily M member 3 [Source:HGNC Symbol;Acc:HGNC:17992])

HSP 1 Score: 286.189 bits (731), Expect = 4.981e-78
Identity = 275/978 (28.12%), Postives = 450/978 (46.01%), Query Frame = 3
Query:  504 FVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNK----------------------------EPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCAMC------------------DEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +  N                             + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY       N   T++H         L  ++   L D+                     + L   +FG   D   +                   D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:    2 YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSN---TLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 923          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gtl-2 (Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:Q20766])

HSP 1 Score: 227.639 bits (579), Expect = 4.858e-60
Identity = 238/1004 (23.71%), Postives = 421/1004 (41.93%), Query Frame = 3
Query:  261 FIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKV---------NDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKIL----EHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHE--RFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRI--KENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV--KEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY--EDCPRSFNLKRTIFHF-------------LGRNFSNGLGDVKDL--LTKIF-GYY----------------------------EDQCAMCDEE---IIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENL------AIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTW------RAGFNINLFQCILC----IFLPF------------------LIYRRSFDNS-------YVIHESKKKDDTSNKGYFT----------NSGNWPL-------------------KLVQFYLAPQTKF---CIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWN--FNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCS--KTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
            +I+  F   +C  F    K+      +C CG   S H      ++ +           W+I +  +T  T++FG I F G    +    ++VRLS++    DVM LM   W +E   L I+V GG  NF+++++   +F +G++KA +TT A I+TSGL+ G+ R V  A+          A+  + +  +GIAPWG +K K+ L    EH    +    V+  + +     LN  H+++L  D     RF          R+ LE  ++    N   +PVV  L+EG           +  K ++P ++C G+GRA+D++  A R +          DG     + E  RN +K    + +        E    I E + ++ L+ +F    +E+ D++  IL +++++ +   D        QL+L L WNRVD+AK  +FS     S +     + +++   + +FVE  L+NG  M +FL+   LE LY  +D   + +++  + +F             +G+     +G+   L   ++ F G Y                            +DQ    +EE     +PF +L IW+VL   H  A   W   E+++   L+A ++YK   +++  +   +E     K  F+N       AI+LL++C+ AD +    ++  E   WG   CL +A  A  + F++   CQ  L   W      R+G N+ +   ++C    +F+ +                  L Y R    S       Y     ++K+    KG +T          NSG   +                   +   FY +P TKF   CI  L F  +      +       ++ + +E +  IY + +++E   ++   + +++ +++K ++   +N W    +L                L  +   +V +YR S  + + S     FY++    +SVH  LGP I M +K
Sbjct:   88 WIENTFEKRECIRFAALPKD----PERCGCGRPLSAHTPASTFFSTLPVHLLEKEQQTWTIANNTQTSTTDAFGTIVFQGG--AHAHKAQYVRLSYDSEPLDVMYLMEKVWGLEAPRLVITVHGGMSNFELEERLGRLFRKGMLKAAQTTGAWIITSGLDSGVVRHVAKALDEAGI----SARMRSQIVTIGIAPWGVIKRKERLIRQNEHVYYDVHSLSVNANVGI-----LNDRHSYFLLADNGTVGRF----GADLHLRQNLENHIATFGCNGRKVPVVCTLLEGGISSINAIHDYVTMKPDIPAIVCDGSGRAADIISFAARYINS--------DGTFAAEVGEKLRNLIKMVFPETD------QEEMFRKITECVIRDDLLRIFRYGQEEEEDVDFVILSTVLQKQNLPPD-------EQLALTLSWNRVDLAKSCLFSNGRKWSSDVLEKAMNDALYWDRVDFVECLLENGVSMKNFLSINRLENLYNMDDINSAHSVRNWMENFDSMDPHTYLTIPMIGQVVEKLMGNAFQLYYTSRSFKGKYDRYKRINQSSYFHRKRKIVQKELFKKKSDDQINDNEEEDFSFAYPFNDLLIWAVLTSRHGMAECMWVHGEDAMAKCLLAIRLYKATAKIAEDEYLDVEEA---KRLFDNAVKCREDAIELLDQCYRADHDRTLRLLRMELPHWGNNNCLSLAVLANTKTFLAHPCCQILLAELWHGSLKVRSGSNVRVLTALICPPAILFMAYKPKHSKTARLLSEETPEQLPYPRESITSTTSNRYRYSKGPEEQKETLLEKGSYTKKVTIISSRKNSGVASVYGSASSMMFKREPQLNKFERFRAFYSSPITKFWSWCIAFLIFLTTQTCILLLETS----LKPSKYEWITFIYTVTLSVEHIRKLMTSEGSRINEKVKVFYAKWYNIWTSAALL--------------FFLVGYGFRLVPMYRHSWGRVLLSFSNVLFYMKIFEYLSVHPLLGPYIQMAAK 1030          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 175.252 bits (443), Expect = 9.553e-44
Identity = 148/566 (26.15%), Postives = 258/566 (45.58%), Query Frame = 3
Query:  105 KMNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHK-------------------KDKIPYNKVND----------------WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTK---NKEPIPVVLLLIEGEYDVFFEASKRIK--ENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKE--DHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY 1676
            ++N+ VS T +S +Q  L     +Q RF        SN++ N ++       ++++ F   +C  F+  S++L     KC CG  +  H+                   + +   + VND                WS+     ++ T +FG++EF G    +    ++VR++ +     +M L    W I    L I+V GGT NF ++ K   +F +GL+KA  TT A I+TSG + G+ + V  A++  Q      +   N + C+GIAPWG +K ++       T+  Y  S++   T    LN  H+++L VD      Y        R+ LE  +SQ+ K       +PVV +++EG           +     VP+V+C G+GRA+DLL  A + + +        DG  +LP+  R  +   +      +    +  L+ +      + L+T+F + E  +HD++ AIL +L+K  + ++  +L            WNRVDIA+  +F+      +      + E++I+ + +FV L L+ G  M  FLT + L++LY
Sbjct:  145 RLNEDVSATANS-AQLVLPTPLFNQMRF------TESNMSLNRHN-------WVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ------SAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFT---GLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTE--------DG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKGQNLSAADQLALAL-------AWNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELY 662          

HSP 2 Score: 75.485 bits (184), Expect = 2.944e-13
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 3
Query: 1806 AMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFEN---LAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF------NINLFQCILCIFLPFL 2264
            +  + +  +P+ EL IW+VL +  + A   W+  EE++  ALVA ++YK L   +  D   +E     K Y E    L+++LL+ C+  D      ++  E   W   TCL +A    ++ F++   CQ  L   W  G       NI +   ++C   PF+
Sbjct:  842 SQTEPDFRYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICP--PFI 1001          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 175.252 bits (443), Expect = 1.022e-43
Identity = 148/566 (26.15%), Postives = 259/566 (45.76%), Query Frame = 3
Query:  105 KMNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHK-------------------KDKIPYNKVND----------------WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTK---NKEPIPVVLLLIEGEYDVFFEASKRIK--ENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKE--DHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY 1676
            ++N+ VS T +S +Q  L     +Q RF        SN++ N ++       ++++ F   +C  F+  S++L     KC CG  +  H+                   + +   + VND                WS+     ++ T +FG++EF G    +    ++VR++ +     +M L    W I    L I+V GGT NF ++ K   +F +GL+KA  TT A I+TSG + G+ + V  A++  Q      +   N + C+GIAPWG +K ++       T+  Y  S++   T    LN  H+++L VD      Y        R+ LE  +SQ+ K       +PVV +++EG           +     VP+V+C G+GRA+DLL  A + + +        DG  +LP+  R  +   +      +    +  L+ +      + L+T+F + E  +HD++ AIL +L+K  + ++  +L    +       WNRVDIA+  +F+      +      + E++I+ + +FV L L+ G  M  FLT + L++LY
Sbjct:  246 RLNEDVSATANS-AQLVLPTPLFNQMRF------TESNMSLNRHN-------WVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ------SAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFT---GLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTE--------DG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKGQNLSAADQLALALA-------WNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELY 763          

HSP 2 Score: 75.485 bits (184), Expect = 3.074e-13
Identity = 45/154 (29.22%), Postives = 73/154 (47.40%), Query Frame = 3
Query: 1830 HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFEN---LAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF------NINLFQCILCIFLPFL 2264
            +P+ EL IW+VL +  + A   W+  EE++  ALVA ++YK L   +  D   +E     K Y E    L+++LL+ C+  D      ++  E   W   TCL +A    ++ F++   CQ  L   W  G       NI +   ++C   PF+
Sbjct:  951 YPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICP--PFI 1102          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gon-2 (Transient receptor potential channel [Source:UniProtKB/Swiss-Prot;Acc:Q93971])

HSP 1 Score: 174.866 bits (442), Expect = 1.148e-43
Identity = 148/566 (26.15%), Postives = 259/566 (45.76%), Query Frame = 3
Query:  105 KMNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHK-------------------KDKIPYNKVND----------------WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTK---NKEPIPVVLLLIEGEYDVFFEASKRIK--ENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKE--DHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY 1676
            ++N+ VS T +S +Q  L     +Q RF        SN++ N ++       ++++ F   +C  F+  S++L     KC CG  +  H+                   + +   + VND                WS+     ++ T +FG++EF G    +    ++VR++ +     +M L    W I    L I+V GGT NF ++ K   +F +GL+KA  TT A I+TSG + G+ + V  A++  Q      +   N + C+GIAPWG +K ++       T+  Y  S++   T    LN  H+++L VD      Y        R+ LE  +SQ+ K       +PVV +++EG           +     VP+V+C G+GRA+DLL  A + + +        DG  +LP+  R  +   +      +    +  L+ +      + L+T+F + E  +HD++ AIL +L+K  + ++  +L    +       WNRVDIA+  +F+      +      + E++I+ + +FV L L+ G  M  FLT + L++LY
Sbjct:  185 RLNEDVSATANS-AQLVLPTPLFNQMRF------TESNMSLNRHN-------WVRETFTRRECSRFIASSRDLH----KCGCGRTRDAHRNIPELTSEFLRQKRSVAALEQQRSISNVNDDINTQNMYTKRGANEKWSLRKHTVSLATNAFGQVEFQGG--PHPYKAQYVRVNFDTEPAYIMSLFEHVWQISPPRLIITVHGGTSNFDLQPKLARVFRKGLLKAASTTGAWIITSGCDTGVVKHVAAALEGAQ------SAQRNKIVCIGIAPWGLLKKREDFIGQDKTVPYYPSSSKGRFT---GLNNRHSYFLLVDNGTVGRYGAEVI--LRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVTNVPRVPVVVCDGSGRAADLLAFAHQNVTE--------DG--LLPDDIRRQVLLLVETTFGCSEAAAHRLLHELTVCAQHKNLLTIFRLGEQGEHDVDHAILTALLKGQNLSAADQLALALA-------WNRVDIARSDVFAMGHEWPQAALHNAMMEALIHDRVDFVRLLLEQGINMQKFLTISRLDELY 702          

HSP 2 Score: 75.485 bits (184), Expect = 2.786e-13
Identity = 45/162 (27.78%), Postives = 76/162 (46.91%), Query Frame = 3
Query: 1806 AMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFEN---LAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF------NINLFQCILCIFLPFL 2264
            +  + +  +P+ EL IW+VL +  + A   W+  EE++  ALVA ++YK L   +  D   +E     K Y E    L+++LL+ C+  D      ++  E   W   TCL +A    ++ F++   CQ  L   W  G       NI +   ++C   PF+
Sbjct:  882 SQTEPDFRYPYSELMIWAVLTKRQDMAMCMWQHGEEAMAKALVACRLYKSLATEAAEDYLEVEICEELKKYAEEFRILSLELLDHCYHVDDAQTLQLLTYELSNWSNETCLALAVIVNNKHFLAHPCCQILLADLWHGGLRMRTHSNIKVVLGLICP--PFI 1041          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Match: gtl-1 (GTL-1; Gon-Two Like (TRP subfamily) [Source:UniProtKB/TrEMBL;Acc:G5ECM4])

HSP 1 Score: 172.17 bits (435), Expect = 8.758e-43
Identity = 141/523 (26.96%), Postives = 236/523 (45.12%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKD---------------KIP-------------YNKVN----DWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTII-KYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIK--ENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRT 1712
            K +I+ +     C +FV  S+  S +   C CG+ +S+H ++                +P              N+VN     WSI S  E VPT+++G I F G         ++ R+S + +  D++ LM   W ++   L I++ GG   F ++ K    F +G++K  K+T+A I+TSGL+ G+ + +  A+ +     +      N +  +GIA WG +K +        T+     V N   L E   LN NH+++LF D      Y        R+ LE  L+Q  K +  IP+V +++EG           +     +P+++C G+GRA+D+L  A + + +        +G   L +  RN L   +      +P    + +  I E    + L+T+F + E    DL+  I+  L+K  + +          QL L L WNR DIA+ +IF+     + ++    + E++ N + +FV L L+NG  M  FLT   LE LY       N  RT
Sbjct:  103 KNWIECRLKMRQCSYFV-PSQRFSER---CGCGKERSKHTEEVLERSQNKNHPLNHLTLPGIHEVDTTDADADDNEVNLTPGRWSIQSHTEIVPTDAYGNIVFEG----TAHHAQYARISFDSDPRDIVHLMMKVWKLKPPKLIITINGGLTKFDLQPKLARTFRKGIMKIAKSTDAWIITSGLDEGVVKHLDSALHD-----HGNHTSKNHVVAIGIASWGMLKQRSRFVGKDSTVTYATNVFNNTRLKE---LNDNHSYFLFSDNGTVNRYGAEII--MRKRLEAYLAQGDKKRSAIPLVCVVLEGGAFTIKMVHDYVTTIPRIPVIVCDGSGRAADILAFAHQAVSQ--------NG--FLSDNIRNQLVNIVRRIFGYDPKTAQKLIKQIVECSTNKSLMTIFRLGESSREDLDHVIMSCLLKGQNLSP-------PEQLQLALAWNRADIARTEIFANGTEWTTQDLHNAMIEALSNDRIDFVHLLLENGVSMQKFLTYGRLEHLYNTDKGPQNTLRT 590          

HSP 2 Score: 83.9593 bits (206), Expect = 7.685e-16
Identity = 50/173 (28.90%), Postives = 83/173 (47.98%), Query Frame = 3
Query: 1782 FGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRI---ETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF---NINLFQCILCIFLPFLIYRRSF 2282
            F   E++  M D    +P+ +L IW+VL +  + A   W   EE +  ALVA+++Y  L + + L T  I   +  + + D F  LA+++LE C    ++    ++  E   WG  TCL +A     +KF++   CQ  L   W+ G    N    + + C+  P LI+   F
Sbjct:  700 FSNLEEEANM-DFTFRYPYSDLMIWAVLTKRQKMAKLMWTHGEEGMAKALVASRLYVSLAKTASLATGEIGMSQDFTEFSDEFSELAVEVLEYCTKHGRDQTLRLLTCELANWGDETCLSLAANNGHRKFLAHPCCQMLLSDLWQGGLLMKNNQNSKVLTCLAAPPLIFLLGF 871          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339075)

HSP 1 Score: 265.388 bits (677), Expect = 1.595e-72
Identity = 278/1057 (26.30%), Postives = 465/1057 (43.99%), Query Frame = 3
Query:  225 FNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK-DKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEM--YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED-----HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL--FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFN----LKRTIFHFLGRNFSNGLGDVKDLLTKIFG-----YYEDQ-------------CAMCDEEIIH-----------------------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP---LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF----NINLFQCILCIFLPFLIYRRSF----------------------DN----------------SYVIHESKKKD---------DTSNKGYFTNSGNW-------PLKL----VQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            F  N   +  + +I+  F   +C  F+   K+     TKC CG+ +  H+    I      D W         PT+++G IEF G    +    ++VRLS +   + +++L    WN+E+  L I+V GG  NF ++ K K    +GL+KA KTT A I T G N G+T+ VGDA+      L +  +    +  +GIAPWG V +N ++L H +  +  + +S+    ++   LN  H ++L VD   +  Y        R  LEK +S            PVV L+IEG  +      + + ++  VP+V+C G+GRA+DLL  AF       + +   DG   P+L  M  Y     +K  +  +   +K+ + L    +    + LIT+F ++E       +L+  IL +L K    +          QLSL L WNRVDIA+ +IF  V      N AL   + +++ + + +FV+L L+NG  M  FLT   LE+LY       N    + R +   + + +   L D+  ++ K+ G     YY  +                C +   +                             PF EL IW+VL +  + A   W   EE+L  +LV+ K+YK +   +    LDT   E L ++   FE+   KLL+  +  D E A  ++  E  +W   +CL +A  A  +  ++    Q  L   W  G     N N F+ IL + +PF I +  F                      DN                +Y + ++K  +         DT+    F N   +       PL+L     +FY AP TKF   S+A+   +  FS+ VL  M++M     E   I Y+  +  EK  E+   +   +  +    W +N WN  D   +IL  + +  RF    +    DI  +  C  +I      Y+YLR L ++ V+K LGP + M+ KM+  ++++++++ ++L+++G++ Q   +P +  + + +  +   PY+ ++GE+
Sbjct:    3 FETNWVFHQPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNR-EVPCHSISSP--RSKLAVLNNRHAYFLLVDNGTQAKYGAELI--LRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF-------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQEL---LQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSP-------PEQLSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSV-WAWNMWNPCDGAAIILFVIGLAFRF----RENTMDIGRVIYCVDSI------YWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEV 1008          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339082)

HSP 1 Score: 268.085 bits (684), Expect = 2.240e-72
Identity = 273/1029 (26.53%), Postives = 458/1029 (44.51%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK-DKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEM--YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED-----HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL--FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFN----LKRTIFHFLGRNFSNGLGDVKDLLTKIFG-----YYEDQ-------------CAMCDEEIIH-----------------------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP---LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF----NINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKD----------------------------DTSNKGYFTNSGNW-------PLKL----VQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYW-WNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            + +I+  F   +C  F+   K+     TKC CG+ +  H+    I      D W         PT+++G IEF G    +    ++VRLS +   + +++L    WN+E+  L I+V GG  NF ++ K K    +GL+KA KTT A I T G N G+T+ VGDA+      L +  +    +  +GIAPWG V +N ++L H +  +  + +S+    ++   LN  H ++L VD   +  Y        R  LEK +S            PVV L+IEG  +      + + ++  VP+V+C G+GRA+DLL  AF       + +   DG   P+L  M  Y     +K  +  +   +K+ + L    +    + LIT+F ++E       +L+  IL +L K    +          QLSL L WNRVDIA+ +IF  V      N AL   + +++ + + +FV+L L+NG  M  FLT   LE+LY       N    + R +   + + +   L D+  ++ K+ G     YY  +                C +   +                             PF EL IW+VL +  + A   W   EE+L  +LV+ K+YK +   +    LDT   E L ++   FE+   KLL+  +  D E A  ++  E  +W   +CL +A  A  +  ++    Q  L   W  G     N N F+ IL + +PF I +  F +   + +  + +                            DT+    F N   +       PL+L     +FY AP TKF   S+A+   +  FS+ VL  M++M     E   I Y+  +  EK  E+   +   +  +   W WN   WN  D   +IL  + +  RF    +    DI  +  C  +I      Y+YLR L ++ V+K LGP + M+ KM+  ++++++++ ++L+++G++ Q   +P +  + + +  +   PY+ ++GE+
Sbjct:   13 RSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNR-EVPCHSISSP--RSKLAVLNNRHAYFLLVDNGTQAKYGAELI--LRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF-------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQEL---LQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSP-------PEQLSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNM--WNPCDGAAIILFVIGLAFRF----RENTMDIGRVIYCVDSI------YWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEV 989          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339074)

HSP 1 Score: 264.618 bits (675), Expect = 2.417e-71
Identity = 279/1052 (26.52%), Postives = 458/1052 (43.54%), Query Frame = 3
Query:  243 KNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK-DKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEM--YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED-----HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL--FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFN----LKRTIFHFLGRNFSNGLGDVKDLLTKIFG-----YYEDQ-------------CAMCDEEIIH-----------------------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP---LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF----NINLFQCILCIFLPFLIYRRSF----------------------DN----------------SYVIHESK---------KKDDTSNKGYFTNSGNW-------PLKL----VQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYW-WNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            K+  + +I+  F   +C  F+   K+     TKC CG+ +  H+    I      D W         PT+++G IEF G    +    ++VRLS +   + +++L    WN+E+  L I+V GG  NF ++ K K    +GL+KA KTT A I T G N G+T+ VGDA+      L +  +    +  +GIAPWG V +N ++L H +        S    L     LN  H ++L VD   +  Y        R  LEK +S            PVV L+IEG  +      + + ++  VP+V+C G+GRA+DLL  AF       + +   DG   P+L  M  Y     +K  +  +   +K+ + L    +    + LIT+F ++E       +L+  IL +L K    +          QLSL L WNRVDIA+ +IF  V      N AL   + +++ + + +FV+L L+NG  M  FLT   LE+LY       N    + R +   + + +   L D+  ++ K+ G     YY  +                C +   +                             PF EL IW+VL +  + A   W   EE+L  +LV+ K+YK +   +    LDT   E L ++   FE+   KLL+  +  D E A  ++  E  +W   +CL +A  A  +  ++    Q  L   W  G     N N F+ IL + +PF I +  F                      DN                +Y + ++K            DT+    F N   +       PL+L     +FY AP TKF   S+A+   +  FS+ VL  M++M     E   I Y+  +  EK  E+   +   +  +   W WN   WN  D   +IL  + +  RF    +    DI  +  C  +I      Y+YLR L ++ V+K LGP + M+ KM+  ++++++++ ++L+++G++ Q   +P +  + + +  +   PY+ ++GE+
Sbjct:   27 KHQPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKL---AVLNNRHAYFLLVDNGTQAKYGAELI--LRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF-------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQEL---LQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSP-------PEQLSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNM--WNPCDGAAIILFVIGLAFRF----RENTMDIGRVIYCVDSI------YWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEV 1026          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339079)

HSP 1 Score: 263.077 bits (671), Expect = 7.576e-71
Identity = 278/1048 (26.53%), Postives = 456/1048 (43.51%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK-DKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEM--YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED-----HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL--FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFN----LKRTIFHFLGRNFSNGLGDVKDLLTKIFG-----YYEDQ-------------CAMCDEEIIH-----------------------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP---LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF----NINLFQCILCIFLPFLIYRRSF----------------------DN----------------SYVIHESK---------KKDDTSNKGYFTNSGNW-------PLKL----VQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYW-WNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            + +I+  F   +C  F+   K+     TKC CG+ +  H+    I      D W         PT+++G IEF G    +    ++VRLS +   + +++L    WN+E+  L I+V GG  NF ++ K K    +GL+KA KTT A I T G N G+T+ VGDA+      L +  +    +  +GIAPWG V +N ++L H +        S    L     LN  H ++L VD   +  Y        R  LEK +S            PVV L+IEG  +      + + ++  VP+V+C G+GRA+DLL  AF       + +   DG   P+L  M  Y     +K  +  +   +K+ + L    +    + LIT+F ++E       +L+  IL +L K    +          QLSL L WNRVDIA+ +IF  V      N AL   + +++ + + +FV+L L+NG  M  FLT   LE+LY       N    + R +   + + +   L D+  ++ K+ G     YY  +                C +   +                             PF EL IW+VL +  + A   W   EE+L  +LV+ K+YK +   +    LDT   E L ++   FE+   KLL+  +  D E A  ++  E  +W   +CL +A  A  +  ++    Q  L   W  G     N N F+ IL + +PF I +  F                      DN                +Y + ++K            DT+    F N   +       PL+L     +FY AP TKF   S+A+   +  FS+ VL  M++M     E   I Y+  +  EK  E+   +   +  +   W WN   WN  D   +IL  + +  RF    +    DI  +  C  +I      Y+YLR L ++ V+K LGP + M+ KM+  ++++++++ ++L+++G++ Q   +P +  + + +  +   PY+ ++GE+
Sbjct:   20 RSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKL---AVLNNRHAYFLLVDNGTQAKYGAELI--LRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF-------VHKYASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQEL---LQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSP-------PEQLSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNM--WNPCDGAAIILFVIGLAFRF----RENTMDIGRVIYCVDSI------YWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEV 1015          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Match: Trpm (gene:FBgn0265194 transcript:FBtr0339077)

HSP 1 Score: 263.077 bits (671), Expect = 9.314e-71
Identity = 280/1053 (26.59%), Postives = 460/1053 (43.68%), Query Frame = 3
Query:  240 EKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK-DKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDG--VPMLPEM--YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED-----HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL--FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFN----LKRTIFHFLGRNFSNGLGDVKDLLTKIFG-----YYEDQ-------------CAMCDEEIIH-----------------------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP---LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF----NINLFQCILCIFLPFLIYRRSF----------------------DN----------------SYVIHESK---------KKDDTSNKGYFTNSGNW-------PLKL----VQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYW-WNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            +++  + +I+  F   +C  F+   K+     TKC CG+ +  H+    I      D W         PT+++G IEF G    +    ++VRLS +   + +++L    WN+E+  L I+V GG  NF ++ K K    +GL+KA KTT A I T G N G+T+ VGDA+      L +  +    +  +GIAPWG V +N ++L H +        S    L     LN  H ++L VD   +  Y        R  LEK +S            PVV L+IEG  +      + + ++  VP+V+C G+GRA+DLL  AF  + KY       DG   P+L  M  Y     +K  +  +   +K+ + L    +    + LIT+F ++E       +L+  IL +L K    +          QLSL L WNRVDIA+ +IF  V      N AL   + +++ + + +FV+L L+NG  M  FLT   LE+LY       N    + R +   + + +   L D+  ++ K+ G     YY  +                C +   +                             PF EL IW+VL +  + A   W   EE+L  +LV+ K+YK +   +    LDT   E L ++   FE+   KLL+  +  D E A  ++  E  +W   +CL +A  A  +  ++    Q  L   W  G     N N F+ IL + +PF I +  F                      DN                +Y + ++K            DT+    F N   +       PL+L     +FY AP TKF   S+A+   +  FS+ VL  M++M     E   I Y+  +  EK  E+   +   +  +   W WN   WN  D   +IL  + +  RF    +    DI  +  C  +I      Y+YLR L ++ V+K LGP + M+ KM+  ++++++++ ++L+++G++ Q   +P +  + + +  +   PY+ ++GE+
Sbjct:  110 KEHQPRSWIETNFQKRECIKFIPCPKD----DTKCCCGQAQITHQTIPGIESGSPGDLWLPTKHTRPQPTDAYGTIEFQGG--AHPTKAQYVRLSFDTRPELLVQLFTKEWNLELPKLLITVQGGKANFDLQAKLKKEIRKGLLKAAKTTGAWIFTGGTNTGVTKQVGDAL------LLEGQQRTGRVVSIGIAPWGIVERNHELLGHNREVPCHSISSPRSKL---AVLNNRHAYFLLVDNGTQAKYGAELI--LRRKLEKFISNLKLHPFTHSSTPVVCLVIEGGTNTIRAVLEYVTDSPPVPVVVCDGSGRAADLL--AF--VHKY-----ASDGEEQPVLESMRDYLIGTIQKTFEVGLDQSEKLYQEL---LQCTRNKNLITVFRIQEKPEGEAQELDQTILTALFKSQHLSP-------PEQLSLALTWNRVDIARSEIF--VYGQEWPNGALDEAMMQALEHDRIDFVKLLLENGVSMKKFLTIPRLEELYNTKHGPANTLGYILRDVRPHIPKGYIYTLHDIGLVINKLMGGAYRSYYTRRKFRPIYAKVMNSYANACRKSSTYQYQRYAGANSLSLVTGLLPFTSEMALFEFPFNELLIWAVLTKRQQMALLMWTHGEEALAKSLVSCKLYKAMAHEAAEDDLDTEIYEELRSYAKEFESKGNKLLDFSYRQDAEKAQRLLTCELHSWSNQSCLSLAVAANHRALLAHPCSQVILADLWMGGLRTRKNTN-FKVILGLAMPFYIRQLDFKSKEELQQMPQTEEEHLENQNLDNDDSDRSQPDAEALLADTYSVRDTKVHENGKVSLTDSDTAQFREFFNLSEYNEVKQHQPLRLKKKFYEFYTAPITKFWADSIAYMFFLIMFSFTVLVKMEQMP-RWQEWYSIAYITTLGFEKVREIISSEPVAITHKFSVWAWNM--WNPCDGAAIILFVIGLAFRF----RENTMDIGRVIYCVDSI------YWYLRILNILGVNKYLGPLVTMMGKMVKNMIYFVVLLAVVLMSFGVSRQAILYPNKQPTWSLIKEVTFQPYFMLYGEV 1110          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 280.411 bits (716), Expect = 1.924e-76
Identity = 262/1010 (25.94%), Postives = 460/1010 (45.54%), Query Frame = 3
Query:  219 VNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGN--NSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRT-KNKEP---IPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVN--EALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFL-TTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNG-----------LGDVKDLLTKIFGYYEDQCAM------------------------CDEE------IIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIET-LSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILC-IFLP-----FLIYRRSFD---------------NSYVIHESKKKDDTSNKGYFTNSGNWPL----KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDY-PYWAIFGEITLN 2999
            ++ + + ++  L  +IK+     +C F+VE  +E       C CG  K +H  + I P + + + W  H      PT++FG I F G      K  ++VR+S + + +++ +LM + W +    L ISV GG KNF +K   K  F +GLIK  +TT A ILT G + G+ + VG A+++     Y  + G+    +  +G+APWG + N+  L H +G    Y   +E        L+ NHTH+L VD+  +  Y      + R  LEK +S+ +  N+E    IPVV ++++G           +  + P V+  G+GR +D++      +   P+ ++    +        N L K+   +   N  ++   E    I++I+   +L+T+F + ED  +D+++AIL +L+K       +  +    QL L + WNRVDIA+ +IF+     +  +    +  +++  K EFV L L+NG  + +FL    TL +LY   P  F L++      G     G           L  V + +  + G +     +                        C  E      +  P ++LF+W+V+  N E A   WE+  + +  AL A+KI + L + S  D S   T +    +++E  AI +  ECH  D + A  ++ + + +WG  TCL +A +A D+ FI+    Q  L   W    +++   ++ +LC IF P     FL +RR  D                S    +S  K     +G+   S   PL    +L+ F  +PQ KF  +  ++   ++ F+ V++   +    +  E+L  ++L  +  E+  +++         R    +  + WN +D+L ++L    +I R          D V  +   K I  +    F LR + + S+ + LGPKI+++ +M+  L F++ ++ I ++AYG+  QG    + +  LN +     Y PY  IFG    N
Sbjct:   25 LSLSPSFQRCSLASWIKENIKKKECCFYVEDGRE-----GICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRD-----YTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVE--IELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIA----HVASVPVSKVTMALI--------NRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQ------ASDTV--FYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILI-ENEERLNWIIRGAVYEPYITIFGNFPTN 997          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 260.766 bits (665), Expect = 4.669e-70
Identity = 214/747 (28.65%), Postives = 354/747 (47.39%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH-------------KKDKIPYNKV--NDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYK-VSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-FLKESIING----KYEFVELFLQNGAVMNDFLTTTTLEK-----------LYE--------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED------------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTW 2204
            K +I++ F   +C   +  +K+      +C CG L  +H             K +++P N      WSI    +  PT++FG IEF G   +N  +  +VR+S++   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+ +SN   L++   LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L    +  ++  I          + E  R+ L   +      +  +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +  L++S+++     + +FV+L ++NG  M+ FLT + LE+           LY         + P  + +                          RT++H       N  G  +    K+ G  +D                     + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W
Sbjct:    3 KSWIERAFSKRECVHIIVSTKD----HHRCCCGRLIGQHVGLPPSISSNQNEKSERVPKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSYDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQTMSNP--LSKLTVLNSLHSHFILADNGTTGKYG--AEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGI----------INESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQSMLDALVLDRVDFVKLLIENGVSMHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNQNSRE-FGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMW 702          

HSP 2 Score: 73.9442 bits (180), Expect = 1.417e-12
Identity = 53/170 (31.18%), Postives = 93/170 (54.71%), Query Frame = 3
Query: 2496 HEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
             E + I Y+    IEK  E+   +  K+  ++K W     WN  D++ +++ ++ M+LR            +M Y   + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q    P  D S     NI   PYW I+GE+  +Q+
Sbjct:  913 QEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSIGMVLRL-------QDPPLMSY--GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQI 1072          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: hrc (histidine rich calcium binding protein [Source:ZFIN;Acc:ZDB-GENE-041008-189])

HSP 1 Score: 244.202 bits (622), Expect = 2.497e-65
Identity = 241/961 (25.08%), Postives = 424/961 (44.12%), Query Frame = 3
Query:  258 GFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK----DKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTI-IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASD--FREALEKKLS-QRTKNKE-PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQK--YPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRN--------FSNGLGDVKDLLTKIFG------YYED----------------------QCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMS--PLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF--NINLFQCILCIFLP------FLIYRR---------------------------SFDNSYVIHESKKKDDTS--------------NKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQ---FTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
             +I K F    C  FVE S     +   C CG ++ +H+     D      V+ W         PT+++G +EF G      + + F+RLS   +   V  LM ++W ++   L +SV+GG     +K   + +  QGL+KA ++T A I+T GL  GI+R VG+A+++    +   +   N +  +GIAPWG V+N++ L + +G+   +Y V N  +  +  SL+ NH  +L VD+      S  K  +  FR  LE  +S QR  N    IPV+ +LI G+  +       +K + P ++  G+G  ++L+ +    +Q    P      D  P++    R  L  K + K     +  ++ ++ +  I   + +I++++ K++   D E+ +L  L++          N+ + +L L + WNRVDIAK ++F+G +    E     + +++ N K +FV L + +G  +  +LT   LEKLY     +   K  + H L           +S  L +V  LLT + G      Y+ +                       C   DE   HP+  LFIW+VL    E A + WE  +ES+  AL   K+   L+E+S   ++T    ++      FE +A  +   C+ +    +  ++ +++  WG  TCLE+A  A+ Q F S    Q+ L   W         L++ +L I  P      F+ YR+                           SF+++   +E++ KD  +               K  F  S     +  QF+ AP T F  + L + + +F ++YV+L   K        + E +   ++  +  ++  E F    NK   +  + +  + WNK D+L + L    +  R    + +W+      +   + I  +    F LR + + ++HK LGPKI+++ K
Sbjct:   21 SWIPKFFKKRLCTTFVEDSFSYGGR---CQCGAMRDDHRSMALGDNFSTAVVSQWLSSQHTSEQPTDAYGDLEFDG---IGRRHSYFLRLSSTTDPARVFDLMKEHWKLQQPNLVVSVVGGEGRSVVKSWVRDVLRQGLVKAAQSTGAWIITGGLRQGISRCVGEAVKDNAAAV--SSITLNKVLPIGIAPWGLVENRQQLVNLEGSFPARYMVRN--ISPDSCSLDNNHKAFLLVDD----GTSGRKGGELAFRACLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMSLKNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEEEDASPIME--LREQLAAK-VKKYFPAENDTDKLVDKVLSIYQNKDIISIYNAKQEGAEDFEIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGNIDWKYEELVDSMTDALENNKPQFVRLLIDSGLNILSYLTYGRLEKLYNSISDTCLAKTLLLHHLDERMHESNVQIYSISLYEVSQLLTDLLGEVCHPFYWTELKLEASSTRRKSMKKACRILMGSCKYRDEMCKHPWFCLFIWAVLQNRSEMAIFCWEMCDESVLTALAGCKL---LLELSKQEIETEAKLSMKELALKFERMAHDVFGTCYLSKASHSYKLLIRKSKLWGDATCLEMAIAADAQIFFSHDGVQSLLSQIWWGDIERGTPLWRILLVIICPPVCYSNFIEYRKTDQAEKEKSVMAPPCSEIDRQYEETVFSFNDNKHQNEAEHKDSENIRRTAKGAPAFIKPKKSSFVVS-----RWKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDGPAVSEYVLYFWVFTLVCQEIQEAF-IAGNKKFPQTLFLYAQDVWNKFDVLAISLFITGLCCR----MFSWS------FNMGRGILCVDYMVFTLRLIYIFAIHKELGPKIIILGK 945          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm4b.2 (transient receptor potential cation channel, subfamily M, member 4b, transient receptor potential cation channel, subfamily M, member 4b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-061214-2])

HSP 1 Score: 238.81 bits (608), Expect = 1.314e-63
Identity = 247/1011 (24.43%), Postives = 448/1011 (44.31%), Query Frame = 3
Query:  261 FIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK----DKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTKNKE-PIPVVLLLIEGEYDV--FFEASKRIKENVPIVICVGTGRASDLLGEAFREMQK--YPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSN--------GLGDVKDLLTKIFG-----YYEDQ----------------------CAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMS--PLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF--NINLFQCILCIFLPFLIYRRSF----------------------DNSY---------VIHESKKKDDTSNKGYFTNSGNWPL-----------KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQ---FTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            F KK+     C  FVE S   SN    C CG  +  H      D      V+ W         PT+++G+++F   + +  + + F+RLS   +   V  LM ++W ++   L +SV+GG    ++K     I  QGL+K  ++T A I+T GL  GI+R +G+A+++    +   +   N +  +GIAPWG V+N++ L +++G+    KV+ +    +  +L+ NH  +L VD+          A  FR  LE  +S QR  N    IPV+ +LI G+  +  F E S  +K + P ++  G+G  ++L+ +    +Q    P    + D  P++    R  L  K + K      K ++ ++ +  I   + +I++++ +++   D ++ +L  L++          N+ + +L L + WNRVDIAK ++F+G +    E     + +++ N K +FV L + NG  ++ +LT   LE LY     +   K  + H L               L +V  LLT +FG     +Y+ +                      C   DE+  HP+  LFIW+VL    E A +FWE   ES+  AL   K+   L+E+S   ++T    ++      FE +A  +   C+      +  ++ +++  WG  TCL++A  A+ + F S    Q+ L   W          ++ +L +  P L Y                          D+ Y         + H+++ +++ SN       G               +  QF+ AP T F  + L + + +F ++YV+L   K        + E +   ++  +  E+  E      NK   ++ + +  + WNK D+L + L    +  R    + +W+      +   + I  +    F LR + + ++H+ LGPKI+++ KM+    F++  +L+ L AYG+  Q   +        T   ++  PY  IFG+I + ++
Sbjct:   24 FFKKRL----CTTFVEDS--FSNGGL-CQCGAARDHHPSVALGDNFSTAVVSQWFSTQHSSEQPTDAYGELDF---NNSRKRDSYFLRLSSTTDPAKVFDLMKEHWKLQQPNLVVSVVGGEGRSEVKSWVLDILRQGLVKTAQSTGAWIITGGLRQGISRCIGEAVKDNATAV--SSITLNKVLPIGIAPWGLVENRQHLVNSEGSF-PAKVTTQ----DSCNLDNNHKAFLLVDDGTTGRKGGELA--FRARLEDYISRQRPGNASIDIPVLNMLIAGDTSMLEFLEMS--LKNSTPCLVLAGSGGLANLVSDIVENVQSAAMPGASEKEDASPIME--LREQLAAK-VKKYFPAEKKTDKLVDKVLSIYQNKDIISIYNAEQEGAEDFDIVMLKVLVQASKRNVSENTNSYADELRLAVTWNRVDIAKSELFNGHIDWKYEELKDSMTDALENNKPQFVRLLIDNGLNISTYLTYNRLEILYNSISDTCLAKTLLLHHLNERIHQSIKQIYKISLYEVSQLLTDLFGEVCLPFYKAELKLEATTKRKALKNACDVLNGSCTYRDEKCKHPWLCLFIWAVLQNRREMAIFFWEMCGESVLTALAGCKL---LLELSKQEIETEAKLSMKELALKFEQMAHDVFGTCYQTKASHSYKLLIRKSKLWGDATCLKMAIAADARIFFSHDGVQSLLSQIWWGDIERGTAFWRLLLVMICPPLCYTNCIEFRKTDPAKEEKSMTAPPSSPTDSHYEKTVYSFKDIKHQNEGENEDSNHIRQNTKGEPAFIESMKSSFVVSRWKQFWYAPVTSFIGNLLMYFLFLFLYAYVLLVDFKPPPPDGPAVSEYVLYFWVFTLVCEEIREA-SIAGNKKFPQMLFVYAQDMWNKFDVLAISLFITGLCCR----MFSWS------FNMGRGILCVDYMVFTLRLIHIFAIHRQLGPKIIILGKMIKDAFFFLFFLLVWLSAYGVANQALLYQYDPSPARTFRRVLYRPYLHIFGQIPVEEI 996          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Match: trpm5 (transient receptor potential cation channel, subfamily M, member 5 [Source:ZFIN;Acc:ZDB-GENE-060503-736])

HSP 1 Score: 228.794 bits (582), Expect = 1.444e-60
Identity = 182/654 (27.83%), Postives = 304/654 (46.48%), Query Frame = 3
Query:  450 FGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRT----KNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAF-REMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSF-NLKRTIF-------------HFLGRNFSNGLGD-------------VKDLLTKIF-GYYEDQCAMC-----------DEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF--NINLFQCILCIFLPFLIY 2270
             G I+F G   T  K   FVR++   +  ++ +++   W +    L ++++GG +  ++K   +    +GL+KA ++T A ILTSGL  GIT+ +G A+++              +  +GIAPW  ++N+ +L  AK        + ++      SL+ NH+H++ VDE  +         + R  + K +S QRT         IPV+ LL+ GE  +  +  K I+ ++P +I  G+G  +D+L     R      I Q          E+  N+    L    +++  K+      I+ I+   +L+T+ D ++D +L+  IL +L+K     S    + L  +L L + WNRVDIAK +IFSG V  S ++    + E+++N K +FV LF+ NG  +  FLT   L++LY  C  S  NL  T+                +  N +N LGD             +KD L     G+Y+   A+            D    HP+++LF+W++L    E ANYFW    E++  ALV  KI K   EM+ L T      S     +E  A+ L  EC+   ++ A  ++ ++   W   T L IA  AE + F +    Q  L   W      + ++ + +L  F+P L++
Sbjct:   17 LGDIDFTGVSRTRGK---FVRVTSSTDPAEIYQILTKQWGLAPPHLVVALMGGDEVAQLKPWLRDTLRKGLVKAAQSTGAWILTSGLRFGITKNLGQAVRDHSLA---STSPKVRVVAIGIAPWNMIQNRDLLLSAKPDHPATYPTEDLPYGAVYSLDCNHSHFILVDEDPK---RPGATGEMRVKMLKHISLQRTGYGGTGSIEIPVLCLLVHGEPRILQKMYKNIQNSIPWLILAGSGGVADILVTLMDRGCWDADIVQ----------ELLINTFPDGLHSTEITSWTKL------IQRILDHGHLLTVHDPEQDSELDTVILKALVKACKSQSQEAQDFLD-ELKLAVAWNRVDIAKSEIFSGDVQWSAQDLEEVMMEALVNDKPDFVRLFVDNGVNIKQFLTYGRLQELY--CSVSEKNLLHTLLLKKNQERQAQLARKRMSGNPNNELGDRKFRFTFHEVSKVLKDFLDDTCKGFYQKLPAVSKALHQKNLPDMDRRCEHPWRDLFLWAILQNRQEMANYFWAMGPEAVAAALVGCKIMK---EMAHLATEAESARSMKNAKYEQFAMDLFSECYSNSEDRAYSLLVRKTCCWSKATVLNIATLAEAKCFFAHDGVQALLTKVWWGAMRTDTSISRLVLTFFIPPLVW 639          

HSP 2 Score: 52.7582 bits (125), Expect = 3.280e-6
Identity = 36/132 (27.27%), Postives = 66/132 (50.00%), Query Frame = 3
Query: 2610 NNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            +NWNK D++ + L  + +  R  +            Y   +T+ +L    F LR + + ++HK LGPKI+++ +M+  + F++  + + L+AYG+T Q    P            +  PY  IFG+I L ++
Sbjct:  786 DNWNKCDMVAISLFVVGLSCRMAM----------STYEAGRTVLALDFMVFTLRLIHIFAIHKQLGPKIIIVERMIKDVFFFLFFLSVWLIAYGVTTQALLHPNDPRIDWVFRRALYRPYLHIFGQIPLEEI 907          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 324.324 bits (830), Expect = 3.079e-90
Identity = 301/1052 (28.61%), Postives = 493/1052 (46.86%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKI--------FSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN----SYVIHES-----KKKDDTSNKGYFTNSGNW-----------------PL--KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ FH  +C   +  +K+      +C CG L  +H          + +K      ND     WSI    +  PT++FG IEF G   +N  +  +VRLS +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGD+++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++N  VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +I        FSG V  S E   L   ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N     Y+   +     +K+ +  +K      GN                  P+  K+ +FY AP  KF   ++A+   +  F+Y+VL  M R   ++ E + I Y+  + IEK  E+   +  K+  + K W     WN  D++ ++L ++ M+LR      +  G         + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S N   NI   PYW I+GE+  +Q+
Sbjct:   33 KSWIERAFHKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIFIYGQQWPFSGRVG-SLEQAML---DALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGILLPPSILSLEFKNKDEMPYMSQANEMDLQEKEVEEPDKTAMLARGNGDSSRKKDEDEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP-SMQEWIVISYIFTLGIEKMREILMSEPGKLLQKFKVWLQ-EYWNLADLVSILLFSIGMVLRLQEQPFSSYG---------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQI 1022          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 323.553 bits (828), Expect = 3.368e-90
Identity = 271/952 (28.47%), Postives = 468/952 (49.16%), Query Frame = 3
Query:  408 WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE---DCPRSF-----NLKRTIFHFLGRNFSNGLGDV---------------------KDLLTKIFGYYED------------------QCAMCDEEII---HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLS-----NWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINL---FQCILCIFLP----FLIYRRSFDNSY-----------------VIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            WSI    +  PT++FG +EF G   +N  +  ++R+S++   D ++ LM   W +E+  L ISV GG +NF+M+ K K +F +GLIKA  TT A I T G++ G+ R VGDA++    D   K++G   +C +GIAPWG V+NK+ L     T     +SN   L++   LN +HTH++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + ++E   VP+V+C G+GRASD++  A +  ++  I          + E  R+ L   +      + ++ ++ L  + E + K+ LIT+F +  +   D+E+AIL +L+K  + ++         QLSL L WNRVDIA+ +IF         +    + ++++  + +FV+L ++NG  M  FLT   LE+LY      P +      ++K+  F  L  ++   L D+                     + L   +FG   D                     + D E+    +PF EL +W+VL++  + A + W++ EE++  ALVA K+YK +   S  ++  ++ +S     N KD F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +      + I+ I  P    FL +R   D S+                 V + + +K D  N      S     K+ +FY AP  KF  +++++   +  F+YV+L  M+R   ++ E + I Y++ + +EK  E+   +  K+  ++K W     WN  D++ + +  +  ILR             M Y   + IY + + ++Y+R L +  V+K LGP ++MI KM+  +++++IIML++L+++G+  Q    P  + S     NI   PYW I+GE+  +Q+
Sbjct:   20 WSISKHTQLSPTDAFGILEFQGGGHSNKAM--YIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALK----DHSSKSRGR--ICAIGIAPWGIVENKEDLIGKDVTKPYQTMSNP--LSKLSVLNSSHTHFILADNGTLGKY--GAEVKLRRQLEKHISLQKINTRLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHKYSEEGGI----------ISESLRDQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTNASA-------PDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIVRDVKKVGFGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTLYNNLFGPKRDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESS-ESELVDDISQDLDNNSKD-FGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEEGKEKEDENMVRNTTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRL-------QNQPYMGY--GRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQI 929          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 322.013 bits (824), Expect = 1.673e-89
Identity = 300/1044 (28.74%), Postives = 487/1044 (46.65%), Query Frame = 3
Query:  267 KKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKI--------FSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN----SYVIH-------------------ESKKKD-DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            ++ FH  +C   +  +K+      +C CG L  +H          + +K      ND     WSI    +  PT++FG IEF G   +N  +  +VRLS +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGD+++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++N  VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +I        FSG V  S E   L   ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N     Y+                      S+KKD D   +      G    K+ +FY AP  KF   ++A+   +  F+Y+VL  M R   ++ E + I Y+  + IEK  E+   +  K+  + K W     WN  D++ ++L ++ M+LR      +  G         + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S N   NI   PYW I+GE+  +Q+
Sbjct:    4 ERAFHKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIFIYGQQWPFSGRVG-SLEQAML---DALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGILLPPSILSLEFKNKDEMPYMSQANEMDLQEKEAMLARGNGDSSRKKDEDEHPRHRLIPIGR---KIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP-SMQEWIVISYIFTLGIEKMREILMSEPGKLLQKFKVWLQ-EYWNLADLVSILLFSIGMVLRLQEQPFSSYG---------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQI 982          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:Xenbase;Acc:XB-GENE-942662])

HSP 1 Score: 321.242 bits (822), Expect = 3.445e-89
Identity = 299/1069 (27.97%), Postives = 495/1069 (46.30%), Query Frame = 3
Query:  207 KNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCA------------------MCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN----SYVIHES-----------------KKKDDTSNKGYFTNSGNW-----------------PL--KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            + S     A  +    K +I++ FH  +C   +  +K+      +C CG L  +H          + +K      ND     WSI    +  PT++FG IEF G   +N  +  +VRLS +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGD+++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++N  VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY       N   T++H               L  ++   L D+                     + L   +FG   D                     + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N     Y+   +                 +K++D          GN                  P+  K+ +FY AP  KF   ++A+   +  F+Y+VL  M R   ++ E + I Y+  + IEK  E+   +  K+  + K W     WN  D++ ++L ++ M+LR      +  G         + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S N   NI   PYW I+GE+  +Q+
Sbjct:   46 QGSTKRSGAAQQPTAQKSWIERAFHKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISIIQNEKNEGRHRNDIQSEKWSIGKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRLSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDSLK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDNPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSN---TLYHLVRDVKKVRVRHQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPIRSGRKTTKKREEEIDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSSLKVILGILLPPSILSLEFKNKDEMPYMSQANEMDLQEKEVEEPDKTVKEKEEDDMELTAMLARGNGDSSRKKDEDEHPRHRLIPIGRKIYEFYNAPIVKFWFFTMAYMGYLMLFNYIVLVKMDRWP-SMQEWIVISYIFTLGIEKMREILMSEPGKLLQKFKVWLQ-EYWNLADLVSILLFSIGMVLRLQEQPFSSYG---------RVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPSEEPSWNLAKNIFYMPYWMIYGEVFADQI 1055          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Match: TRPM1 (transient receptor potential cation channel subfamily M member 1 [Source:NCBI gene;Acc:100216447])

HSP 1 Score: 317.775 bits (813), Expect = 2.592e-88
Identity = 277/1018 (27.21%), Postives = 478/1018 (46.95%), Query Frame = 3
Query:  342 CLCGELKSEHKKDKIPYNKVND---------------WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEP----------------------IPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK---------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMC-----------------DEEII---HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLS-----NWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINL---FQCILCIFLP----FLIYRRSFDNSY-----------------VIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            C CG+L ++H    +P N   +               WSI    +  PT++FG +EF G   +N  +  ++R+S++   D ++ LM   W +E+  L ISV GG +NF+M+ K K +F +GLIKA  TT A I T G++ G+ R VGDA++    D   K++G   +C +GIAPWG V+NK+ L     T     +SN   L++   LN +HTH++  D      Y        R  LEK +S +  N +                       +PVV L++EG  +V     + ++E   VP+V+C G+GRASD++  A +  ++  I          + E  R+ L   +      + ++ ++ L  + E + K+ LIT+F +  +   D+E+AIL +L+K  + ++         QLSL L WNRVDIA+ +IF         +    + ++++  + +FV+L ++NG  M  FLT   LE+LY                    + P  +++                      R  F  L   ++N  G  +    K+ G  +D+                     D E+    +PF EL +W+VL++  + A + W++ EE++  ALVA K+YK +   S  ++  ++ +S     N KD F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +      + I+ I  P    FL +R   D S+                 V + + +K D  N      S     K+ +FY AP  KF  +++++   +  F+YV+L  M+R   ++ E + I Y++ + +EK  E+   +  K+  ++K W     WN  D++ + +  +  ILR             M Y   + IY + + ++Y+R L +  V+K LGP ++MI KM+  +++++IIML++L+++G+  Q    P  + S     NI   PYW I+GE+  +Q+
Sbjct:    2 CCCGQLLTQHIP--VPQNATGNKNGEECKQLEAVPEKWSISKHTQLSPTDAFGILEFQGGGHSNKAM--YIRVSYDSKPDSLLHLMVKEWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVIRHVGDALK----DHSSKSRGR--ICAIGIAPWGIVENKEDLIGKDVTKPYQTMSNP--LSKLSVLNSSHTHFILADNGTLGKY--GAEVKLRRQLEKHISLQKINTQALIFFFAHNRLYYELKLICLGQGVPVVALIVEGGPNVITIVLECLREEPPVPVVVCDGSGRASDIMSFAHKYSEEGGI----------ISESLRDQLLVTIQKTFNYSRNQAHQLLVVLMECMKKKELITVFRMGSEGQQDIEMAILTALLKGTNASA-------PDQLSLALAWNRVDIARSQIFVFGHHWPVSSLEQAMMDALVLDRVDFVKLLIENGVSMQRFLTIPRLEELYNTRLGPPNTLHYIVRDVKKGNLPPDYHVSLIDIGLVLEYLMGGAYRCHYTRKTFRTL---YNNLFGPKRPKALKLLGMEDDEPPTKGKKKKKKKEEEIDMDVDDPEVSRFKYPFHELMVWAVLLKRQKMALFLWQRGEETMAKALVACKLYKSMAHESS-ESELVDDISQDLDNNSKD-FGQLALELLDQSYKHDEQVAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILFPPTILFLEFRSQDDLSFHTSKEYEEGKEKEDENMVRNTTSRKGDEENGNRKQKSIPIGTKIYEFYNAPIVKFWFYTISYLAYLMLFNYVILVKMERWP-SVQEWVVISYIVTLALEKVREILMSEPGKLSQKVKVWLQ-EYWNITDLVAISVFLIGAILRL-------QNQPYMGY--GRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVIIMLVVLMSFGVARQAILHPDEEPSWRLARNIFYMPYWMIYGEVFADQI 972          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 324.324 bits (830), Expect = 2.471e-90
Identity = 297/1052 (28.23%), Postives = 493/1052 (46.86%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCAMC------------------DEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY       N   T++H         L  ++   L D+                     + L   +FG   D   +                   D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  ++      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSN---TLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1051          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 323.939 bits (829), Expect = 3.625e-90
Identity = 297/1052 (28.23%), Postives = 493/1052 (46.86%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCAMC------------------DEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY       N   T++H         L  ++   L D+                     + L   +FG   D   +                   D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  ++      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   64 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSN---TLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1053          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 320.472 bits (820), Expect = 4.389e-89
Identity = 297/1066 (27.86%), Postives = 495/1066 (46.44%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-FLKESIING----KYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +  L++++++     + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  ++      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   64 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1063          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 320.472 bits (820), Expect = 4.400e-89
Identity = 297/1066 (27.86%), Postives = 495/1066 (46.44%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-FLKESIING----KYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +  L++++++     + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  ++      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   64 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1063          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Match: Trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:MGI Symbol;Acc:MGI:2443101])

HSP 1 Score: 310.071 bits (793), Expect = 1.073e-85
Identity = 290/1045 (27.75%), Postives = 486/1045 (46.51%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRS----------FNLKRTIFHFLGRNFS-------------NGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG        + TL  L  D  +            ++   I + +G  +              N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  ++      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGR----HGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMTQAQEIHLQEKEPEEPEKPTKEKDEEDMELTAMLGRSNGESSRKKDEEEVQSRHRLIPVGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1043          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Match: sp|Q9HCF6|TRPM3_HUMAN (Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=2 SV=4)

HSP 1 Score: 311.227 bits (796), Expect = 3.588e-85
Identity = 297/1091 (27.22%), Postives = 492/1091 (45.10%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH--------------KKDKIPYNKVND--WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNK----------------------------EPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------------------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED-----------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN---------SYVIH---------------------------------ESKKKD--DTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F+  +C   +  +K+      +C CG L  +H               + ++  N +    WSI    +  PT++FG IEF G   +N  +  +VR+S +   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   +  +  Y+      ++ P+S    LN  H+H++  D      Y        R  LEK +S +  N                             + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +         +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT + LE+LY                    + P  + +                          RT++H       N  G  +    K+ G  +D                    + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N +D F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL I LP  I    F N         +  IH                                  S+KKD  +  +K      G    K+ +FY AP  KF  ++LA+   +  F+Y+VL  M+R   T  E + I Y+  + IEK  E+   +  K+  ++K W     WN  D++ ++L ++ MILR  L  + +  D        + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q   FP  + S     NI   PYW I+GE+  +Q+
Sbjct:   62 KSWIERAFYKRECVHIIPSTKD----PHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDIQSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSFDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDL-IGRDVVRPYQT-----MSNPMSKLTVLNSMHSHFILADNGTTGKY--GAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRD-FGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEPEKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGR---KIYEFYNAPIVKFWFYTLAYIGYLMLFNYIVLVKMERWPST-QEWIVISYIFTLGIEKMREILMSEPGKLLQKVKVWLQ-EYWNVTDLIAILLFSVGMILR--LQDQPFRSD-------GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGEVFADQI 1086          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Match: sp|A7T1N0|TMP2L_NEMVE (Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.663e-81
Identity = 207/743 (27.86%), Postives = 366/743 (49.26%), Query Frame = 3
Query:  192 LTDGSKNSNVN---FNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKA--SDFREALEK-KLSQRTKNKE-PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLF--DVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLK------------RTI-FHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEII---------------------HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDY---FENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRA--GFNINLFQCILCIFLPFLIY 2270
            L DG  +S+V+   F +N      K +I + F   +C  FV KS ++S    +C CG  +  H +  +   + ++ W++ SC    PT ++G+I+F  E     K   ++R+SH+ + + V+ LM   WN+EI  L ISV GG K+F +K + + +F +GLIKA KTT A I+T G N G+ + VG+A++  Q       + N     +GIA WG V K   ++    G              +   L+ NH+H+  VD+     Y       S   EA+ K K   R++     +PVVLL++EG  +      + IK+ VP V+  G+GRA+ ++G A+    K   + +    + ++   Y + ++ K+++  V      ++  + I++++  E +I+++  D +   D++LAIL +L+K       +  ++  +QL+L L WNR+D+AK  IF+     + E  +  +  ++++ K EF ELFLQNG  M +FL+   L KLY + P +  +K            +TI    +G      +GD+ +   +  G+Y  + A   E ++                      P+ ++F+W+VL    E A   WE   E +  AL+A+++ K +   +  D +  +  S+  D+   FE  A+ +L+EC + ++  +  ++ +E   +   T LE+A  AE Q FI+   CQ  L   W      N   ++ ++C++LP LI+
Sbjct:    9 LYDGGDSSHVHLNKFGSNQLSQSKKSWIARNFSRRECIRFVPKSHDVS----RCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDF--EGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVN----VIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIK---RNVDGQTINVIDPQYEDEVRAKVVE--VFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLK-------ANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIF 729          

HSP 2 Score: 73.559 bits (179), Expect = 1.183e-11
Identity = 54/174 (31.03%), Postives = 100/174 (57.47%), Query Frame = 3
Query: 2499 EILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQ-----RDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            EI+   ++  + IE+  ++       + D++  +++ + WN VDI  + +  +A+ILRF     N       I+  S+ I SL + +F +R L++ SV++ LGPK+VMI KM+  L  +III+ +  +AYGI +    FP      R+ +  T+ +++ YPYW ++GE+ L+++
Sbjct:  879 EIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFS-DTWNFVDIFSLTVFIIAIILRF---FTN-----SRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEI 1043          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Match: sp|A0A0R4IMY7|TRPM2_DANRE (Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2)

HSP 1 Score: 280.411 bits (716), Expect = 1.452e-75
Identity = 262/1010 (25.94%), Postives = 460/1010 (45.54%), Query Frame = 3
Query:  219 VNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGN--NSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRT-KNKEP---IPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVN--EALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFL-TTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNG-----------LGDVKDLLTKIFGYYEDQCAM------------------------CDEE------IIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIET-LSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILC-IFLP-----FLIYRRSFD---------------NSYVIHESKKKDDTSNKGYFTNSGNWPL----KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDY-PYWAIFGEITLN 2999
            ++ + + ++  L  +IK+     +C F+VE  +E       C CG  K +H  + I P + + + W  H      PT++FG I F G      K  ++VR+S + + +++ +LM + W +    L ISV GG KNF +K   K  F +GLIK  +TT A ILT G + G+ + VG A+++     Y  + G+    +  +G+APWG + N+  L H +G    Y   +E        L+ NHTH+L VD+  +  Y      + R  LEK +S+ +  N+E    IPVV ++++G           +  + P V+  G+GR +D++      +   P+ ++    +        N L K+   +   N  ++   E    I++I+   +L+T+F + ED  +D+++AIL +L+K       +  +    QL L + WNRVDIA+ +IF+     +  +    +  +++  K EFV L L+NG  + +FL    TL +LY   P  F L++      G     G           L  V + +  + G +     +                        C  E      +  P ++LF+W+V+  N E A   WE+  + +  AL A+KI + L + S  D S   T +    +++E  AI +  ECH  D + A  ++ + + +WG  TCL +A +A D+ FI+    Q  L   W    +++   ++ +LC IF P     FL +RR  D                S    +S  K     +G+   S   PL    +L+ F  +PQ KF  +  ++   ++ F+ V++   +    +  E+L  ++L  +  E+  +++         R    +  + WN +D+L ++L    +I R          D V  +   K I  +    F LR + + S+ + LGPKI+++ +M+  L F++ ++ I ++AYG+  QG    + +  LN +     Y PY  IFG    N
Sbjct:   25 LSLSPSFQRCSLASWIKENIKKKECCFYVEDGRE-----GICKCGYPKVQHCDEAIKPEDYMGEQWDKHRHVRETPTDAFGDISFGG---LGQKTGKYVRVSSDTSCENLYQLMTEQWKLRSPNLLISVTGGAKNFYIKTHLKDKFRRGLIKVAQTTGAWILTGGTHAGVMKHVGMAVRD-----YTLSSGSMEGQIVVIGVAPWGVIHNRSTLIHPEGRFPAYYSLDEQGQGRLSCLDINHTHFLLVDDGTQGHYGVE--IELRARLEKLISKLSLGNRESGVTIPVVCVVLDGGPGTLNTIYNSMLNHTPCVVLEGSGRLADVIA----HVASVPVSKVTMALI--------NRLLKRFFMQEYKNFTELQIIEWTKKIQDILRMPHLLTVFRIDEDKNYDVDVAILQALLKASRSDEHAGRHCWERQLELAVAWNRVDIAESEIFTEESQWTSSDLHPAMFSALVGDKPEFVRLLLENGVCVREFLEREETLCELYSHLPSCFFLRKLAKRVQGGKMRRGQEPLPGSRKVCLSHVSEEVRHLLGSFTQPLYIASRYKPTKDDVRLKVPSKGALDLPCSGEEWSADTVWDPGRDLFLWAVVQNNRELAEIGWEQCRDCIAAALAASKILRKLAQESGEDDSEEATEMLELANHYEKQAIGVFSECHSWDAQRAQKLLIRISPSWGRSTCLWLALEAHDKSFIAHSGVQALLTQIWCGELSVDNPHWKVLLCMIFFPLIYTGFLTFRRDEDIQRQAERTEQQKLAMESVFAGQSDGKIKRHLRGFSQKSELKPLNCSSRLMSFLKSPQVKFYWNIASYFGFLWLFAVVLMIDFQ-TSPSWRELLLYVWLTSLVCEEIRQLYHDFDGSGFRRKAKMYIKDLWNILDVLSIVLFIAGLICRLQ------ASDTV--FYIGKVILCIDFIIFCLRLMAIFSISRTLGPKIIIVRRMMLDLFFFMFLLSIWVVAYGVAKQGILI-ENEERLNWIIRGAVYEPYITIFGNFPTN 997          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Match: sp|Q91YD4|TRPM2_MOUSE (Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 2.781e-71
Identity = 236/923 (25.57%), Postives = 422/923 (45.72%), Query Frame = 3
Query:  231 ANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYN-KVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKE----PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGE-AFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRS--FNLK------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYE-DQCAMCDEEI-----------------------IHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVG-DRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
            +++++ +L  +I +     +C +FVE SK     +  C CG    +H +  I P+  +  +W      + +PT++FG I F   D++  K+ ++VR+S +     + +LM  +W +++  L ISV GG KNF MK + K IF +GL+K  +TT A I+T G + G+ + VG+A+++    L    K    +  +G+A WG + N++ L H  G      + +E        L+ NH+H++ VD+     Y        R  LEK +S++TK +      IP+V +++EG           I    P VI  G+GR +D++ + A   + +  I  ++        EM+    + +++           E    I++I+ +  L+T+F   +D   D+++AIL +L+K               QL L + WNRVDIA+ +IF+        +    +  ++I+ K EFV LFL+NG  + +F+T  TL  LYE+   S  F+ K                  R   H + +     LGD   LL     Y +  + +M    I                       I P ++L IW+V+  + E A   W ++++    AL  +KI K L +      S  E L+   D FE+ AI +  EC+  D+E A  ++ + +  WG  TCL++A +A+D KF+S    Q  L   W     ++  L++ ILC+    L++       ++    K+                P ++  F+ AP   F ++ L++   +  F+YV++   +    +  E L  ++L  +  E+  ++F Y  +  G  ++   +  + WNK+D+  ++L  + +  R           I       + I SL    F LR + + ++ K LGPKI+++ +
Sbjct:   51 SSEKQENLSSWIPENIKKKECVYFVESSKLSDAGKVVCACGYTHEQHLEVAIKPHTFQGKEWDPKKHVQEMPTDAFGDIVFT--DLSQ-KVGKYVRVSQDTPSSVIYQLMTQHWGLDVPNLLISVTGGAKNFNMKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRD--FSLSSSCK-EGEVITIGVATWGTIHNREGLIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP--LRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAINNGTPCVIVEGSGRVADVIAQVATLPVSEITISLIQQKLSIFFQEMFETFTENQIV-----------EWTKKIQDIVRRRQLLTIFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPADLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEQRLAYASATPRLHMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSMTVPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAVIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLA-LADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLF-----TGFISFREKRLQALCR----------PARVRAFFNAPVVIFHMNILSYFAFLCLFAYVLMVDFQPSP-SWCEYLIYLWLFSLVCEETRQLF-YDPDGCGLMKMASLYFSDFWNKLDVGAILLFIVGLTCRL----------IPATLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKR 926          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Match: sp|E9PTA2|TRPM2_RAT (Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3)

HSP 1 Score: 266.544 bits (680), Expect = 3.992e-71
Identity = 236/927 (25.46%), Postives = 413/927 (44.55%), Query Frame = 3
Query:  231 ANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYN-KVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKE----PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGE-AFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRS--FNLK-------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYE-DQCAMCDEEI-----------------------IHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKF---CIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVG-DRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
            +++++ +L  +I +     +C +FVE SK     +  C CG    +H +  I P+  +  +W        +PT++FG I F G    + K+ ++VRLS + +   + +LM  +W +++ +L ISV GG KNF MK + K IF +GL+K  +TT A I+T G + G+ + VG+A+++    L    K    +  +GIA WG + N++ L H  G      + +E        L+ NH+H++ VD+     Y        R  LEK +S++TK +      IP+V +++EG           I    P VI  G+GR +D++ + A   + +  I  ++        EM+    + +++           E    I++I+ +  L+T+F   +D   D+++AIL +L+K               QL L + WNRVDIA+ +IF+        +    +  ++I+ K EFV LFL+NG  + +F+T  TL  LYE+   S  F+ K                   R   H + +     LGD   LL     Y +  + ++    I                       I P ++L IW+++  + E A   W ++++    AL  +KI K L +      S  E L+   D FE+ AI +  EC+  D+E A  ++ + +  WG  TCL++A +A+D KF+S    Q  L   W     ++  L++ ILC+    L++       ++    K+              N P  +V FYL   + F   C+ +    V                  +  E L  ++L  +  E+  ++F Y  +  G  ++   +  + WNK+D+  ++L    +  R           I       + I SL    F LR + + ++ K LGPKI+++ +
Sbjct:   51 SSEKQENLSSWIPENIKKKECVYFVESSKLSDAGKVVCECGYTHEQHIEVAIKPHTFQGKEWDPKKHVHEMPTDAFGDIVFTG---LSQKVGKYVRLSQDTSSIVIYQLMTQHWGLDVPSLLISVTGGAKNFNMKLRLKSIFRRGLVKVAQTTGAWIITGGSHTGVMKQVGEAVRD--FSLSSSCK-EGDVITIGIATWGTIHNREALIHPMGGFPAEYMLDEEGQGNLTCLDSNHSHFILVDDGTHGQYGVEIP--LRTKLEKFISEQTKERGGVAIKIPIVCVVLEGGPGTLHTIYNAITNGTPCVIVEGSGRVADVIAQVAALPVSEITISLIQQKLSVFFQEMFETFTENQIV-----------EWTKKIQDIVRRRQLLTVFREGKDGQQDVDVAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFTDEWQWKPSDLHPMMTAALISNKPEFVRLFLENGVRLKEFVTWDTLLCLYENLEPSCLFHSKLQKVLAEEHERLAYASETPRLQMHHVAQVLRELLGDSTQLLYPRPRYTDRPRLSLPMPHIKLNVQGVSLRSLYKRSTGHVTFTIDPVRDLLIWAIIQNHRELAGIIWAQSQDCTAAALACSKILKELSKEEEDTDSSEEMLA-LADEFEHRAIGVFTECYRKDEERAQKLLVRVSEAWGKTTCLQLALEAKDMKFVSHGGIQAFLTKVWWGQLCVDNGLWRIILCMLAFPLLF-----TGFISFREKRLQALCRLARVRAFFNAP--VVIFYLNILSYFAFLCLFAYVLMVDFQPSP------------SWCEYLIYLWLFSLVCEETRQLF-YDPDGCGLMKMASLYFSDFWNKLDVGAILLFIAGLTCRL----------IPATLYPGRIILSLDFIMFCLRLMHIFTISKTLGPKIIIVKR 927          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|22832657 (tr|A0A5K4FE95|A0A5K4FE95_SCHMA Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 532.717 bits (1371), Expect = 2.321e-165
Identity = 361/1012 (35.67%), Postives = 555/1012 (54.84%), Query Frame = 3
Query:  228 NANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQT--KCLCGELKSEHKKDKIPYNKVN--DWSIHSCFETV-PTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNI---EIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKIL------EHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF----------------------------LGRNFSNG----LGDVKDLLTKIFGYYEDQCAMCDEEIIH----------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPL-DTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIY---------RRSFDNSYVIHES----------KKKDDTSNKGYFTNSG---NWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGD-RIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQR-DFSLNTLPNIMDYPYWAIFGEITLN 2999
            +  D K     F+ K F   +C  FV   +  +  +   +C CGE +  H       ++ +  +WS   C + V P+ +FG+IEFI E  +N K TEFVR+S ED L+DVM LM +YW +   E  +LCISV+GG KNF ++  +K +FY GL++A +TT A I+TSGLNLGI R VGDA+Q  Q    DK   +  L C+GIAPWG+V N+  L      +H     I Y VS  I   +PVSLN+NHTHY+FVDE +R  Y   +++ FR  LEK+++         IPVVL+++EG +DVF +A   IKE VP+VIC GTGRA+D+L  AF         +L+ +      E   + L +KL  K VS  +KV  AL  I+ I+    LIT FD+ +  DL+LAIL++LIK    TS    + L  QL L L W+R DIA+ KIF     +  +     + E+++  K +FV + LQNG VM  FLT   L +LY +   S +L R + ++                             G++F++     L  +  L+ ++ G Y ++    D E++H                PFQELF+W++L + H+ A YFWE+++++L LAL+A  +Y  + ++ P  DT       ++ + FENLAI +LEEC+  D E   Y++E E+  WGG+ CL++A ++  +KFIS   CQNSLDF W  G   N+    + + LPFL+Y         +R   +    H++            ++D S+K    +     N+  K+  FY AP+TKFC++++ + + + +FSY +LF   + + TIHE   + Y I M I+   ++F   +  VG  ++  WW+   W + ++ +++L+ ++M LR  L       +   IY  SKT Y L +   Y+R   L S H NLGPK+VMI  ML +L+ +I I++++ LAYGI++    +P R +FS + + +++ YPYW ++GE++L+
Sbjct:   18 HVRDTKEKKISFVLKHFTFKECIKFVADPQYATETKPSDRCFCGEYRIYHYFHGQNRSETDNKEWSESECLKVVGPSNAFGQIEFITESTSNHKPTEFVRISDEDKLEDVMLLMKNYWKMMEPEKPSLCISVIGGAKNFVLEGHKKEVFYSGLVQAAQTTRAWIVTSGLNLGIIRVVGDALQE-QSYSTDKRMLSQQLRCIGIAPWGYVLNRNTLVATNYEDHFHP--IPYTVSTVIETGQPVSLNQNHTHYIFVDEGKRLRYGGCESARFRARLEKQIALPEEAGGFGIPVVLVIVEGGHDVFIDARNSIKERVPVVICSGTGRAADILDMAFN-------FRLKHNEFTSFTERECSILSQKL--KIVSGKNKVEAALKMIQLIVKDTKLITTFDMNKSDDLDLAILFALIK----TS----SELDKQLRLALTWDRCDIAEAKIFRQGKQVKPDILEPIMMEALLRNKTDFVRILLQNGVVMRQFLTFERLHRLYNESTHSNDLIRCLKNYKLLTSEHLTVSSTKLHLPVMISNEMTAERGQSFTSPYRIYLSTICKLIRRMLGRYTNKIYDMDTEVLHGRRADWSRVSKLTFVSPFQELFLWAILYQRHKMALYFWERSDDALTLALIACCLYTDMSKLLPTYDTEGKTKYESYVEEFENLAIGVLEECNAIDPEFTLYLVEGESSLWGGFNCLQLAAQSVRRKFISSQACQNSLDFAWCHGMRANMLVTSVILILPFLLYFDHILSWEDKRPHVSVNHHHQTVARFTENADVSDREDISHKNSKRSEPMQRNFTEKIKMFYTAPKTKFCLYTMVYVIFLLFFSYTLLFSTLQNEITIHEGFIMAYFIAMIIDIIRQIFL--SPGVGPKKVATWWDQYEWGRSELFVILLALLSMFLRIGL-------ETTFIY--SKTFYVLTLITCYIRIYGLYSYHPNLGPKLVMIRSMLEELISFIFILIVVFLAYGISLHVLLYPNRHEFSWSDVRDVLYYPYWNLYGELSLD 998          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18242619 (tr|A0A267FX17|A0A267FX17_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g3 PE=4 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 3.542e-159
Identity = 335/952 (35.19%), Postives = 525/952 (55.15%), Query Frame = 3
Query:  237 DEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNI---EIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKIL----EHAKGTI---IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVS--NPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY-EDCPRSFNLKRTIFHFLG-----RN-FSNGLGDVKDLLTKIFGYYEDQC-------AMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLME-MSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF-----NINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITL 2996
            +++  L+ FI   F   +C  F  K  +      KC CGE++ +H    +P      W+  +      T ++G+I    E   N     F R+  ED++D +++LM  +W +   +  +LCISV+GG KNFK++ ++K +F+ GLI+A +TTNA I+TSGLNLGITR VG+A++ G+   ++K+  ++ L C+G+APWG+V N+  L    +   G +   ++YK+SN I   +PVSLN NHTHYL VD+ +R  Y  SK+   +  L+++++Q    KE I VVLL++EG  D+F E    I+ N+P+V C  TGRA+D++  A++++QK   K L    +  L E   ++  + L D      N  KV+E ++ + EI+ KE LIT+FD+    DL+LAIL +L+K MD     +L+    QL L + WNR DIA +KIF+       EN   F   +I   K EF+ LFL+NG +M +FLT   L  LY E    S      +   L      RN +   L D++ LL K+ G +              DE+   PF +LF W+VL+   + A + WE+T+ES+ LAL A+K+Y  +   +S  +  R   L  +KD FE+LA+ ++EEC   D   A  +IEK+   +G + CLE+A  A  +KF+SC   QNS+   W  G      N+ +F   LC+ LPFL+    F+    +  S + D+        +      K+  +Y AP TKF  +++ + + +F +S+ +LF MK    +  E + I ++  M +E+  EMF  K + V ++++ WW F+ WN++D+  ++L+ + + LR P            I    +T Y L    FYLR  RL   +  LGPK+VMI KM+ +L+FY+ I+++ LL YG+  Q   +P RDF+ +   +I+ YPYW I+GEI L
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAKDGK------KCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQ----KEGISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQKADKKTLSESQLADLRERMISTFSENLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEDLAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLL---PFEFLVRVEPSVRLDEGGRCAQLAH------KVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATD-------AITTGVRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYL 993          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18281819 (tr|A0A267E1J7|A0A267E1J7_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g2 PE=4 SV=1)

HSP 1 Score: 525.013 bits (1351), Expect = 5.511e-159
Identity = 335/952 (35.19%), Postives = 524/952 (55.04%), Query Frame = 3
Query:  237 DEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNI---EIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKIL----EHAKGTI---IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVS--NPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY-EDCPRSFNLKRTIFHFLG-----RN-FSNGLGDVKDLLTKIFGYYEDQC-------AMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLME-MSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF-----NINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITL 2996
            +++  L+ FI   F   +C  F  K  +      KC CGE++ +H    +P      W+  +      T ++G+I    E   N     F R+  ED++D +++LM  +W +   +  +LCISV+GG KNFK++ ++K +F+ GLI+A +TTNA I+TSGLNLGITR VG+A++ G+   ++K+  ++ L C+G+APWG+V N+  L    +   G +   ++YK+SN I   +PVSLN NHTHYL VD+ +R  Y  SK+   +  L+++++Q    KE I VVLL++EG  D+F E    I+ N+P+V C  TGRA+D++  A++++QK   K L    +  L E   ++  + L D      N  KV+E ++ + EI+ KE LIT+FD+    DL+LAIL +L+K MD     +L+    QL L + WNR DIA +KIF+       EN   F   +I   K EF+ LFL+NG +M +FLT   L  LY E    S      +   L      RN +   L D++ LL K+ G +              DE+   PF +LF W+VL+   + A + WE+T+ES+ LAL A+K+Y  +   +S  +  R   L  +KD FE LA+ ++EEC   D   A  +IEK+   +G + CLE+A  A  +KF+SC   QNS+   W  G      N+ +F   LC+ LPFL+    F+    +  S + D+        +      K+  +Y AP TKF  +++ + + +F +S+ +LF MK    +  E + I ++  M +E+  EMF  K + V ++++ WW F+ WN++D+  ++L+ + + LR P            I    +T Y L    FYLR  RL   +  LGPK+VMI KM+ +L+FY+ I+++ LL YG+  Q   +P RDF+ +   +I+ YPYW I+GEI L
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAKDGK------KCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKTGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQ----KEGISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQKADKKTLSESQLADLRERMISTFSENLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLL---PFEFLVRVEPSVRLDEGGRCAQLAH------KVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATD-------AITTGVRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYL 993          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|18260343 (tr|A0A267FD75|A0A267FD75_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017231g1 PE=4 SV=1)

HSP 1 Score: 523.472 bits (1347), Expect = 1.834e-158
Identity = 335/952 (35.19%), Postives = 522/952 (54.83%), Query Frame = 3
Query:  237 DEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNI---EIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTII-------KYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVS--NPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY-EDCPRSFNLKRTIFHFLG-----RN-FSNGLGDVKDLLTKIFGYYEDQC-------AMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLME-MSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGF-----NINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITL 2996
            +++  L+ FI   F   +C  F  K  +      KC CGE++ +H    +P      W+  +      T ++G+I    E   N     F R+  ED++D +++LM  +W +   +  +LCISV+GG KNFK++ ++K +F+ GLI+A +TTNA I+TSGLNLGITR VG+A++ G+   ++K+  ++ L C+G+APWG+V N+  L + +   I       +YK+SN I   +PVSLN NHTHYL VD+ +R  Y  SK+   +  L+++++Q    KE I VVLL++EG  D+F E    I+ N+P+V C  TGRA+D++  A++++QK   K L    +  L E   ++    L D      N  KV+E ++ + EI+ KE LIT+FD+    DL+LAIL +L+K MD     +L+    QL L + WNR DIA +KIF+       EN   F   +I   K EF+ LFL+NG +M +FLT   L  LY E    S      +   L      RN +   L D++ LL K+ G +              DE+   PF +LF W+VL+   + A + WE+T+ES+ LAL A+K+Y  +   +S  +  R   L  +KD FE LA+ ++EEC   D   A  +IEK+   +G + CLE+A  A  +KF+SC   QNS+   W  G      N+ +F   LC+ LPFL+    F+    +  S + D+        +      K+  +Y AP TKF  +++ + + +F +S+ +LF MK    +  E + I ++  M +E+  EMF  K + V ++++ WW F+ WN++D+  ++L+ + + LR P            I    +T Y L    FYLR  RL   +  LGPK+VMI KM+ +L+FY+ I+++ LL YG+  Q   +P RDF+ +   +I+ YPYW I+GEI L
Sbjct:   75 EQQRSLRQFILANFQRKECCLFEAKDGK------KCACGEVREKHD-GLLPAGPEEKWNEATHMRRSVTNAYGRITLKNEGFDNRDPIHFARVCDEDSMDKMLELMKTHWQLADPQKPSLCISVIGGAKNFKLEGRKKEVFHHGLIRAAQTTNAWIITSGLNLGITRVVGNALEEGRASHWEKSSRSSKLRCIGVAPWGYVLNRDHLINKRDPKIGELSLDVEYKISNVISKGQPVSLNANHTHYLLVDDGKRNRYGGSKSGVIKAKLQEQINQ----KEGISVVLLIVEGGLDIFEETQSMIQSNIPVVTCDNTGRAADIIAFAYKKVQKADKKTLSESQLADLRERMISTFSDNLKDPKTKKVNDKKVDENMSMLLEIVQKEKLITVFDMNRSDDLDLAILSALLKVMDA---KRLDDYKQQLQLSMTWNRPDIAAEKIFTEEHQWGTENLDKFALSAISQEKIEFLRLFLKNGLIMREFLTVGRLRSLYRESLAASSQASLQVRKLLAARTRCRNPWEPTLADIRVLLRKLVGKFHAPSMDKDVGTGGDDEQFERPFNQLFFWAVLLCKQDTAKFLWERTDESVPLALAASKVYNEMARALSSHEDGRKRMLQAYKDEFEELAVHVVEECQMVDPSKAELLIEKKVEAFGDFNCLELAASANCKKFVSCNSSQNSITSRWLNGLMHGTSNLRIF---LCVVLPFLL---PFEFLVRVEPSVRLDEGGRCAQLAH------KVRIYYTAPVTKFFANAIWYVIFIFLYSWFILFEMKAASISWLEWVIIAWICVMVVEEIREMFSSKADTVQEKLRDWWGFSAWNRLDLFTMLLALIGIFLRIPEATD-------AITTGVRTCYILAGVLFYLRVFRLYYANSYLGPKLVMIQKMVKELLFYMSILIVALLTYGVAAQALLYPTRDFTTSIFVDIVYYPYWQIYGEIYL 993          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Match: gnl|BL_ORD_ID|21772021 (tr|A0A183AFB2|A0A183AFB2_9TREM LSDAT_euk domain-containing protein OS=Echinostoma caproni OX=27848 PE=4 SV=1)

HSP 1 Score: 487.649 bits (1254), Expect = 3.338e-149
Identity = 333/971 (34.29%), Postives = 511/971 (52.63%), Query Frame = 3
Query:  438 PTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNI---EIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNK-KILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY---------EDCPRSFNLKRTI------------------FHFLGRNFSNG---------------LGDVKDLLTKIFGYYEDQCAMCDEEIIH----------------PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSP-LDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLI----------------------------------------------YRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPL-----KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGD-RIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQR-DFSLNTLPNIMDYPYWAIFGEITLN 2999
            PT +FG+I+F+ E   + +LTEFVR+S +D L+DVM+LM D+W++      +LCISV+GG KNF ++ + K +F      A +TTNA I+TSGLNLGI R VGDA+Q GQ   +D+ + +N L CLGI+PWG+V N+ +++  +  T + Y+VSN I    PVSLN+NHTHY+FVDE +R  Y  S+++ FR  L K+++  +      IPVVL+++EG +DVF +A   I+E +P+V+C GTGRASDL+  AF    K P K    D     PE   + L +KLI   +S   K + AL  I EI+    LIT FD+ +  DL+LAIL++LIK     ++S++NT   QL L   WNR DIA++KIF   V +  E+    + E+++  K EFV + LQNG +M  FLT   L +LY         E C     L++ +                  F F+    +                 L  V  L  K+ G + ++    D E +                 PFQELF+W+VL +  + A +FWE+ E+SL LAL+A  +Y  +++  P  DT      + + D FE LA++LLEEC+  D ET  +++E E   WGGY CL +A KA  +KFIS + CQNSL + W  G   + F   + +F P L+                                              +R S D        +   D +     TN    P      KL   Y AP+TKF ++++A+   + +FSY +LF +   Q T+ E + + Y I + ++   ++    T   G  +++ W   N+   +DI+ ++L+ ++M LR  L            +  +KT Y+L +   Y+R  RL   H  LGPK+VMI +M+ +L+ ++ I+ +ILL+YG+++Q   +P R +F  + + ++  YPYW ++GE+ L+
Sbjct:    6 PTRAFGQIDFLTETAMSQRLTEFVRISDKDKLEDVMELMKDHWHMMEPHKPSLCISVIGGAKNFALEGRRKDVFN----TAAQTTNAWIVTSGLNLGIVRVVGDALQEGQTWHFDRRRLSNQLRCLGISPWGYVLNRDELICSSYSTPVLYRVSNVIETGRPVSLNENHTHYIFVDEGKRLRYGGSESAKFRARLGKQMALPQQAGGWGIPVVLVVVEGGHDVFIDARDCIRERIPVVVCCGTGRASDLMNLAFYFRMKQPSK----DFTAFRPE-EESILLQKLIP--ISGKAKADSALEMIIEILRDPKLITTFDMNKSDDLDLAILFALIK-----TNSRINT---QLELAFTWNRSDIAEEKIFRQGVRVEPESLEPTMMEALLQDKPEFVRILLQNGIIMRQFLTVERLHELYNKSTHRDAFERCLAQKGLRKPLLPKVSDRKIAPHSQSEGKFDFVLSQVAATANVFPIKLPQAAPVYLSTVSRLSRKMIGRFTNKIYDQDTEELRRRPNDWDSFRNFTFSSPFQELFLWAVLHQRQQMALFFWERAEDSLTLALIACALYADMIKSLPQYDTETQAEYTRYMDEFEMLAVRLLEECYSMDPETTLFLVENEAPLWGGYNCLNLADKATRRKFISSVACQNSLFYAWSHGTQASPFVFTVTLFCPLLLLSDRFVEFDDKRNIGSGVRRVMDERRPSVLWRPTSPSRTSGQLSTYHRTSADAEIDFGLKRHLTDGAEDYSATNVTRQPRMTLKNKLEILYTAPRTKFFLNTIAYIAFLLFFSYTLLFKIISTQITVEEAVTMTYFITLFVDIIRQI--CVTPGTGSYKLRLWVKTNSLVYLDIIAMLLALVSMFLRIGL---------ASTFTVAKTFYALTLIVCYMRVFRLYGFHPALGPKLVMIQRMIAELILFLFIVAVILLSYGVSVQALLYPNRSEFDSSAIRDVFYYPYWNLYGELGLD 946          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm3 (transient receptor potential cation channel, subfamily M, member 3 [Source:ZFIN;Acc:ZDB-GENE-060531-95])

HSP 1 Score: 273.478 bits (698), Expect = 3.438e-74
Identity = 269/957 (28.11%), Postives = 450/957 (47.02%), Query Frame = 3
Query:  504 FVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYK-VSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLL--GEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF----------------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCA-------------------MCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDY----FENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN----SYVIHE----------------SKKKDD-----TSNKGYFTNSGNW--------------PL--KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLI 3008
            +VR+S++   D ++ LM   W +E+  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+ +SN   L++   LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L  G  + E               ++ E  R+ L   +      +  +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  M+ FLT   L +L E          T++H                 L  ++   L D+                     + L   +FG   D                      + D EI H   PF EL +W+VL++  + A +FW+  EE++  ALVA K+ K  M     +   +E +S   ++    F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL + LP  I    F N    SY+  E                +K KD+     T+  G  ++  +               P+  K+ +FY AP  KF  H++A+   +  F+Y+VL  M  +  +  E + I Y+    IEK  E+   +  K+  ++K W     WN  D++ +++ ++ M+LR            +M Y   + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q    P  D S     NI   PYW I+GE    Q I
Sbjct:    3 YVRVSYDTKPDLLLHLMTKEWQLELPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQTMSNP--LSKLTVLNSLHSHFILADNGTTGKYGAE--VKLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGG------------LINESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRFLT---LSRLEELYNTRHGPSNTLYHLVRDVKKSEETLYLQGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFSFPFHELMVWAVLLKRQKMALFFWQHGEEAMAKALVACKLCKA-MAHEASENDMVEDISQELNHNSREFGQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQEQEAYLQEKDSDEADKPAKDKDEEDMEFTAMLGNVSSEASRKKVVEEVQHRHRLIPVGRKIYEFYNAPIVKFWFHTMAYVGYLMLFNYIVLVKMD-LWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSIGMVLRL-------QDPPLMSY--GRVIYCVNIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEAPCGQNI 909          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: hrc (transient receptor potential cation channel subfamily M member 4-like [Source:NCBI gene;Acc:103047479])

HSP 1 Score: 249.21 bits (635), Expect = 6.438e-67
Identity = 240/970 (24.74%), Postives = 432/970 (44.54%), Query Frame = 3
Query:  264 IKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK----DKIPYNKVNDW--SIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSL---CCLGIAPWGFVKNKKILEHAKGTI-IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNK-----EPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEM---YRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKED--HDLELAILYSLIK--RMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLG------------------DVKDLLTKIFG-----YYEDQCAMC----------------------DEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINL--FQCILCIFLPFLIYR--------------------RSFDNSYVIHES-------KKKDDTSNKGYFTNSGNWPLK------------LVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIH---EILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRC---SKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
            IKK+     C  FVE S   SN    C CG  +  H      D      V+ W  ++HS     PT++FG++EF G    + + + F+RLS +        ++   W +    L +SV+GG    K+K K + +  QGL++A ++T A IL+ GL  GI R +G+A+++     +  A  ++SL     +G+APWG V  +  L + +G+    Y V+N     +   L+ NH  +L VD+           + FR  LE  +SQ+   K       IPV+  L+ GE  +       +K+ +P ++  G+G  +DL+ +    +   P+                  R  + +K++    S PD V++ ++ +  +   + LI+++ ++++   D +  +L +L++  +   +SD+ L+T   +L L + WNRVDIA+ ++F+G +    E+   F+ ++++N K +FV LF++NG  + +++T   LE+LY    RS +     +  L R+ S   G                  +V  LL  + G     +Y+D+  +                        +  + P+  LF W+VL    E A +FWE T ES+  AL A K+ + L ++   +T    +L      FENLA  +  +C+ + +  +  +++K+++ W G TCL++A +A+ + F S    Q  L   W    + N   ++ +L +F+P L Y                     ++ D  ++  E+       K+      +  FT  GN P K              QF+ AP T F  + L + + +  F+YV+L   K          E+L   ++  +  E+    F      V  RI+  +  + W+K D++ + L  + +  R             M  R    ++    L    F LR + + ++HK LGPKI+++ K
Sbjct:   31 IKKRV----CTTFVEDS--FSNGHL-CQCGGSRDSHATVSLNDYFSSAIVSHWDSALHS--SEAPTDAFGEVEFGG---VSKRHSNFLRLSSDTPPATAYTILTSNWGLPKPNLVLSVVGGVGRSKVKPKLREVLRQGLVRAAQSTGAWILSGGLREGIDRCLGEAVRD-----HTTAASSDSLTKVVAIGVAPWGLVNLRDELVNPEGSYPAGYFVTNTS--RDSYCLDTNHQAFLLVDDGS--TGRRGGEARFRAGLENYISQQRTGKLGSGSMDIPVLCTLVSGELYMLERLDLSLKKCIPWMVLAGSGGLADLVTDVLENVAAAPVLPAGGAEGEGEATTKINLRERVAEKVVKHFPSEPD-VDKLVDKLLNVHKSQDLISIYHLEQEGPEDFDTVLLKALVRASKQRLSSDASLST--EELKLAVTWNRVDIARSELFTGDIQWKNESLESFMTDALVNDKPQFVRLFIENGLNVQEYMTFGRLEELY----RSISDSSVAYTLLQRHLSERQGVAGTGWPAADPAKGLTLYEVAQLLEDLLGDVCQPFYDDKLKIQGITSRRKTIKKLTTVLQEGEYRQQRCVFPWASLFTWAVLQNRSEMAVFFWEMTPESVLSALSACKLLRELCKLEN-ETETKHSLKELAMKFENLAHDVFSKCYQSSESRSFVLLKKKSVVWRGATCLQMAMEADARHFFSHDGVQTLLSQIWWGDMDRNTENWKLVLTLFIPPLCYTSLISFREVEEAEDGTPEEAPKARDIDWLYAETVFSFADIKRIQTKQEELRFTPKGN-PTKKSPQKQCFLLSRWKQFWYAPVTAFLGNMLMYFLFLLLFAYVLLVDFKPPPPKGPSPMELLLYFWVFTIVCEEIRGTFFIGNMTVRQRIRQ-YTQDLWHKCDLIAITLFLIGLCCR-------------MFRRSFWFARAALCLDYMVFTLRLIHIFAIHKQLGPKIIIVGK 956          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 223.016 bits (567), Expect = 1.236e-58
Identity = 196/772 (25.39%), Postives = 338/772 (43.78%), Query Frame = 3
Query:  195 TDGSKNSNVNFNANDEKNH--LKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK----DKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTI-IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTK-----NKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLK------KKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDH--DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE------------------------------DCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFG------YY---------------------EDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFN--INLFQCILCIFLPFLIY 2270
            ++  + S  N +   EK+   +   IKKK     C  F+E S+   +   +C CG  ++ H      D      V+ W         PT++FG++EF G      + + F+RLS +     V  +M  +W +    L +SV+GG    K+K   + +  QGL+ A ++T A I+T GL  G+   VG+A+++        +   + +  +G+APWG V N++ L +A+G+   +Y + N     +   L+ N+  +L VD+           ++F   +E  +S QRT      N E IPV+ +LI GE  V       +K+  P ++  G+G A+D++ E         +  L P   P   ++  +S        K++I K+      + + ++    I     LIT+F   +D   D +  +L +L++     S S  +  + +L L + WNRVDIAK ++F+G +    E     + ++++N K +FV +F++NG  + ++LT   LE LY+                              D P   + K        R  S  L +V  LL ++FG      YY                     +   A       HP+  LFIW+VL    E A YFWE   ES+  AL A K+ + L ++     +++ ++      FE LA      C+ + +  +  ++ + +  WGG TCL++A  A+ + F S    Q  L   W    N    +++ +    +P LIY
Sbjct:    4 SEKEEESARNGSGKGEKDQSWVPKIIKKKV----CTTFLEDSQ---SNGDRCQCGSERAAHSSSATGDFFGSAVVSQWDTAVHTSEYPTDAFGEVEFAG---AGRRHSHFLRLSCDTPASLVYSIMTVHWGLPPPNLVVSVMGGGGREKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAA--SSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTS--HDSCYLDNNYQAFLLVDDGSVGHRGGE--TNFITNMEDYISNQRTGIWGSGNIE-IPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISEL--------LDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMS-SDASEYTEELKLAVAWNRVDIAKSELFNGDIQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQSLSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELS--LYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLRELCKLENETETKL-SIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVASFLMPPLIY 746          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm4a (transient receptor potential cation channel subfamily M member 4 [Source:NCBI gene;Acc:103041664])

HSP 1 Score: 222.631 bits (566), Expect = 1.575e-58
Identity = 196/772 (25.39%), Postives = 338/772 (43.78%), Query Frame = 3
Query:  195 TDGSKNSNVNFNANDEKNH--LKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKK----DKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTI-IKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTK-----NKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLK------KKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDH--DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE------------------------------DCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFG------YY---------------------EDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFN--INLFQCILCIFLPFLIY 2270
            ++  + S  N +   EK+   +   IKKK     C  F+E S+   +   +C CG  ++ H      D      V+ W         PT++FG++EF G      + + F+RLS +     V  +M  +W +    L +SV+GG    K+K   + +  QGL+ A ++T A I+T GL  G+   VG+A+++        +   + +  +G+APWG V N++ L +A+G+   +Y + N     +   L+ N+  +L VD+           ++F   +E  +S QRT      N E IPV+ +LI GE  V       +K+  P ++  G+G A+D++ E         +  L P   P   ++  +S        K++I K+      + + ++    I     LIT+F   +D   D +  +L +L++     S S  +  + +L L + WNRVDIAK ++F+G +    E     + ++++N K +FV +F++NG  + ++LT   LE LY+                              D P   + K        R  S  L +V  LL ++FG      YY                     +   A       HP+  LFIW+VL    E A YFWE   ES+  AL A K+ + L ++     +++ ++      FE LA      C+ + +  +  ++ + +  WGG TCL++A  A+ + F S    Q  L   W    N    +++ +    +P LIY
Sbjct:    4 SEKEEESARNGSGKGEKDQSWVPKIIKKKV----CTTFLEDSQ---SNGDRCQCGSERAAHSSSATGDFFGSAVVSQWDTAVHTSEYPTDAFGEVEFAG---AGRRHSHFLRLSCDTPASLVYSIMTVHWGLPPPNLVVSVMGGGGREKVKSWVRDVLRQGLVLAAQSTGAWIMTGGLKEGVGHCVGEAVRDHVAAA--SSPSQSKVVAIGVAPWGLVANRQQLVNAQGSFPARYYIQNTS--HDSCYLDNNYQAFLLVDDGSVGHRGGE--TNFITNMEDYISNQRTGIWGSGNIE-IPVLCMLISGEASVLKRMDMSLKKATPWLVLDGSGPAADMISEL--------LDDLSPAASPADGDVRDSSTAELRNRTKEIIKKHFPAEKVLEKLVDRALSIYQNRALITVFHGDQDSPDDFDTVLLKALVRACRQMS-SDASEYTEELKLAVAWNRVDIAKSELFNGDIQWQYEALKDCMTDALVNNKPQFVRVFIENGLNILEYLTYQRLESLYQSLSDSSLAYSLLQKWLRERHSLVAMSPHSPDSPEKKSKKSLKVPPNVRELS--LYEVSRLLGELFGGMCQPFYYSVLDLDPGASNRKAAKQLNKLQADGAYGKRSCNHPWASLFIWAVLQNRSEMAIYFWEMAGESVLSALCACKMLRELCKLENETETKL-SIKELAQKFETLAHDTFSACYQSSESRSFTLLIRTSPVWGGVTCLQMAMAADARLFFSHDGVQTLLSQIWWGDMNSRTEVWKLVASFLMPPLIY 746          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Match: trpm7 (transient receptor potential cation channel subfamily M member 7 [Source:NCBI gene;Acc:111197571])

HSP 1 Score: 213.001 bits (541), Expect = 3.077e-55
Identity = 160/521 (30.71%), Postives = 268/521 (51.44%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSK---------ELSNKQTKCLCGELKSEH----------------KKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVS----LNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLS-QRTKNK--EPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY--EDCPRSFNL 1703
            K +I+  F   +C + +  SK         ++  +  +C CG L  +H                 + + P+    +WS+ +  E  PT+++G I F G   +++   ++VRLSH+   + +++LM   W +E+  + ISV GG +NF +  + K +  +GLIKA  TT A ILT G+N G+ + VGDA++         ++    +C +GIAPWG ++N+  L   +  +  Y+      L  P+S    LN  H+H++ VD      Y      + R  LEK ++ QR   +  + +PVV L+ EG  +V     + ++E+  VP+V+C GTGRA+D+L    ++ +        PDGV    E    +  KK    N+S  D V+     +E + +KE LIT+F V  EDH D+++AIL +L+K  D ++         QL L L W+RVDIAKD +F     L  ++    + ++++  + +FV+L ++NG  M+ FLT + LE+LY  +  P + NL
Sbjct:    4 KSWIESTFTKRECVYILPVSKDPHRCLPGCQICQQLVRCCCGRLVRQHVGFTASLAMKYSDMKLGEAQPPHE---EWSVENHTEQSPTDAYGIINFQGG--SHSYRAKYVRLSHDSRPEAILRLMLKEWQMELPKIVISVHGGIQNFDLHPRIKQVVGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKE------HSSRSARKICTIGIAPWGVIENRNDLI-GRDVVAPYQT-----LLNPLSKLNVLNNLHSHFILVDNGTVGKY--GAEVNLRRDLEKHINLQRIHARIGQGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADILSFVHKQTED---DGGLPDGV----ETDIIATVKKTF--NLSQNDAVHLFQTLMECMKNKE-LITVFHVGSEDHQDIDVAILKALLKGTDASA-------FDQLVLTLAWDRVDIAKDHVFVYGQKLLVDSLEQAMLDALVMDRVDFVKLLIENGVSMHRFLTISRLEELYNTKQSPTNPNL 488          

HSP 2 Score: 119.783 bits (299), Expect = 1.370e-33
Identity = 110/430 (25.58%), Postives = 208/430 (48.37%), Query Frame = 3
Query: 1830 HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCL---MEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLI----YRRSFDNSYV-----IHESKKKDDTSN--------------------------KGYFTNSGNWPL--KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            +PF EL +W+VLM+  + + +FW+  EES+  ALVA K+ + +    + S +     E L  + + F  LA+ LLE+    D+  +  ++  E   W   TCL++A  +  + F++    Q  L   W    N+   + ++ IL I +P  I    Y+   + +++      H+   +D   N                              T S   P+  K   FY AP  KF  ++L + V +  +SYVVL  +     +  E   I+Y+    IEK  EMF  +  K+  +IK W++ + +N+ D + +++ A+   LRF       +G++ +  R    IY L + ++Y+R L +++V++  GP ++MI KM+  + + ++IM ++L+ YG+  +   +P  +   + + +++  PYW ++GE+
Sbjct:  617 YPFNELLVWAVLMKRQKMSLFFWQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSNEFGTLAVDLLEQSFRQDELMSMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMERLNMRKNSWYKVILSILVPPAILALEYKSKAEMAHIPQSQDAHQMTMEDSEHNLQNPDDIQMDVFKETRINDHVEVKHETEVVTRSRRLPIMRKFHAFYHAPIVKFWTNTLFYLVFLMLYSYVVLVKLPIFP-SPQEWAVILYIFTSAIEKIREMFMSEGGKISQKIKVWFS-DYFNRSDFIAIVMFAVGFGLRF------GSGNVFIAGRL---IYCLNIIFWYVRLLDILAVNQQAGPYVMMIGKMVANMFYIVVIMCVVLVTYGVPRKAILYPNSEAEWSLIIDVVFQPYWMMYGEV 1035          

HSP 3 Score: 45.0542 bits (105), Expect = 1.370e-33
Identity = 43/131 (32.82%), Postives = 69/131 (52.67%), Query Frame = 2
Query: 2978 IWGD-YIESIDLPWCDDKTTNYNISNECPELNYFVPVXXXXXXXXXXXXXXXXXXXVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLC---------GNQCEKTEENEKNL 3340
            ++G+ Y   ID+  C + T N N+ + C    +  P L A+Y+FI  IL++N+L A FN ++ ++   S  +WK+  +  +M Y+ KP+ P P  IF H   F   LC         G +   TEE++K L
Sbjct: 1031 MYGEVYAYEIDV--CANSTEN-NMDHLCTTGVWLTPALQAVYLFIQYILMVNLLIAFFNNVYLQVMSISNLVWKYQRYHFIMAYHDKPVLPPPLIIFYHISSFLSFLCKRRKKDSAYGPKLFLTEEDQKKL 1158          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 293.123 bits (749), Expect = 6.204e-83
Identity = 277/962 (28.79%), Postives = 454/962 (47.19%), Query Frame = 3
Query:  501 EFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEP----VSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQ---RTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIF----SGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLY--EDCPRSFNLKRTIFHF--LGRNFSNGLGDVKDLLTKIFG------------------YYEDQCAMCDEE--------------------------IIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCL---MEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLP----FLIYRRSFDNSYV-----IHESKKKD--------------------------------------------DTSNKGYFTNSGNW--------PLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFP--LLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            ++ R+S++   D +++LM   W +E+  L ISV GG +NF++  K K +F +GLIKA  TT A I T G+N G+   VG+A++         ++ ++ +C +GIAPWG ++N+  L      +    VS    L+ P      LN  H+H++ VD+     Y     +  R  LEK ++    R    + +PVV L+ EG  +V     + + E   VP+V+C GTGRA+D+L  AF         +L  DG   L +    ++KK     N S+   ++  L  + E + ++ LIT+F    EDH D++LAIL +L+K  +F+S       + QL+L L W+RVDIAK+ +F      +V L    W   + ++++  + +FV+L ++NG  M+ FLT T LE+LY   D  +  NL+  +  F  L  ++   L DV  ++  + G                   Y    A  D                              +PF EL  W+VLM+    A +FW+  EESL  ALVA K+Y+ L    + S  D  + + L   +  F  LA+ LL++    D+  A  ++  E   W  +TCL++A  +  + F++    Q  L   W    N+   + F+ IL I +P     L Y+   + S++     +H+  +++                                            D    G+    G W          ++ +FY AP  KF  ++LA+   +  F+YVVL  ++++  ++ E   I+YL    IE+  E+F  +  K G +IK W +   WN  D L ++L  +A+ LR    LL++            +K +YSL V ++Y+R L + +V++N+GP I+MI KM++Q    +IIM I+LL++G+  Q   F + D S     NI+  PYW IFGE+
Sbjct:    1 QYARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKE------HASRSSHKICTIGIAPWGVIENRGDLVGQDSHV----VSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAE--AQLRRELEKHIATVACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADIL--AFLHKNTDDTGEL-CDG---LHDEIVGTIKKTF---NFSHGQAMH-LLQTLLECMRRKELITVFHTGSEDHSDVDLAILTALLKGTNFSS-------ADQLNLALAWDRVDIAKNHVFVYGQHWMVRLEWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTSDHHQMSNLRILLHRFSHLPPDYKITLIDVGLVIEFLMGGAFRSMYTRKRFRLLYHNLYGQHRASVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSREDELKWKRLWCARVKFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGQEEREHRAAATRDIPMQRCLSRRVFLRLLSFAIRILLLRTVGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREIFMSEPGKFGQKIKVWLD-GYWNINDSLGILLFFVAVALRSQSHLLIE------------AKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMWQQCMLMIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEV 919          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm7 (transient receptor potential cation channel, subfamily M, member 7 [Source:ZFIN;Acc:ZDB-GENE-021115-2])

HSP 1 Score: 271.166 bits (692), Expect = 1.212e-75
Identity = 255/935 (27.27%), Postives = 426/935 (45.56%), Query Frame = 3
Query:  504 FVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKN----HTHYLFVDEHERFDYSNSKASDFREALEKK--------LSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPM--LPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIF---SGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYE-------DCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEE--------------------------IIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCL---MEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLP----FLIYRRSFDNSYV-----IHE--SKKKDDTSNKGYFTNSGNW--------PLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMF--QYKTNKVGD-----------RIKYWWNFNNWNKVDILMVILSAMAMILRFP--LLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL--ICLGVMT 3026
            + R+S++   D +++LM   W +E+  L ISV GG +NF++  K K +F +GLIKA  TT A I T G+N G+   VG+A++         ++ ++ +C +GIAPWG ++N+  L      +    VS    L+ P+S        H+H++ VD+     Y     +  R  LEK         L+ R    + +PVV L+ EG  +V     + + E   VP+V+C GTGRA+D+L    +             G  M  L  +     +K+L+          +   +    I     + TL                 + R    + +  ++ + QL+L L W+RVDIAK+ +F      ++L    W   + ++++  + +FV+L ++NG  M+ FLT T LE+LY        + P+   L  +    +G N +     + +LL  I G         D                              +PF EL  W+VLM+    A +FW+  EESL  ALVA K+Y+ L    + S       E L  +   F  LA+ LL++    D+  A  ++  E   W  +TCL++A  +  + F++    Q  L   W    N+   + F+ IL I +P     L Y+   + S++     +H+  +    D    G+    G W          ++ +FY AP  KF  ++LA+   +  F+YVVL  ++++  ++ E   I+YL    IE+  E+     +T K              +IK W +   WN  D L ++L  +A+ LR    LL++            +K +YSL V ++Y+R L + +V++N+GP I+MI KM+  +   +IIM I+LL++G+  Q   F + D S     NI+  PYW IFGE+   ++  IC+ V+ 
Sbjct:    1 YARVSYDSRPDLLLQLMVKEWQMELPRLLISVHGGLQNFELHPKLKQVFSKGLIKAALTTGAWIFTGGVNTGVVNHVGNALKE------HASRSSHKICTIGIAPWGVIENRGDLVGQDSHV----VSPYQTLSNPLSKLNLLNSLHSHFILVDDGTVGKYGAE--AQLRRELEKHIALQKIHTLACRAGMGQGVPVVGLVAEGGPNVIVTVLEYLLEEPPVPVVVCEGTGRAADILAFLHKNTDDTGWAHTHRHGQAMHLLQTLLECMRRKELVGTRARVRTHTHTCTHGSAAISGGPSVETLIA---------------LHRTGAAAGTNFSS-ADQLNLALAWDRVDIAKNHVFVYGQHWMALMWARWRRPMLDALVMDRVDFVKLLIENGVSMHKFLTITRLEELYNTVSGPLTNPPKRPLLANSRSPPVGLNCTLNPPVIGNLLLMILGGTCSAIQAVDNTRQRKQKMSTASGVGVTLDGSDPECSCFAYPFNELLAWAVLMKRQRMAMFFWQHGEESLAKALVACKLYRSLAGEAKQSEAVEDSSEELKQYSTEFGQLALDLLDQSFRQDERMAMKLLTYELRNWSNFTCLKLAVSSRHRPFVAHTCTQMLLADMWMGRLNMRKNSWFKVILSILMPPSILMLEYKSKAEMSHIPQSEELHQMGNGSAADGGESGHKEEEGIWIRPSGLSLSRRIYEFYHAPIVKFWFNTLAYIGFLMLFTYVVLVKLQQLP-SVQEWFVILYLFMSAIERVREVSDGARETRKAAGLRSDSEASAHRKIKVWLD-GYWNINDSLGILLFFVAVALRSQSHLLIE------------AKIVYSLDVIFWYVRLLDVFAVNQNVGPYIMMIGKMMANMFSIVIIMAIVLLSFGVARQAILFKEADPSWYLARNIVFQPYWMIFGEVYAPEIDGICVAVLA 893          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Match: trpm2 (transient receptor potential cation channel, subfamily M, member 2 [Source:NCBI gene;Acc:799412])

HSP 1 Score: 127.487 bits (319), Expect = 8.554e-30
Identity = 124/521 (23.80%), Postives = 217/521 (41.65%), Query Frame = 3
Query:  252 LKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI--PYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTN---ALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGN--NSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTG---RASDLLGEAFREMQKYPIKQLRPDGVPMLPEM---YRNSLKKKLIDKNVSN--PDKVNEALNYIEEIIHKEYLITLFDVKEDHDLEL-------AILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNG 1748
            +K +I +      C +++E S      +  C C   +SEH    +  P      W         PT +FG I+F G      +L +FVR+ ++     + KLM ++W++++  L ISV GG KNF +K + + IF  GL K  ++T    A I+T G   G+ ++VG+++++     +  A G+    +  +GIA WG +                              NK H     +D   +F           EA + +LS    N     +V     G+Y V      R+++ +      G+G   R+S  +G             +R +    L +M    R+  K  LI     +    ++N ++ + ++ I+ + LI LF +       L       A++   I      ++    +   QL L L WNRVDIA  +IF+        +    +  +++  + EF+ LF+++G ++ ++LT   LE LY   P S     ++ H L R  S G
Sbjct:    4 VKAWISQNIKMKVCCWYIESSTAGGAARRVCECRHPRSEHANTALLKPTLLGQKWEPAKHTANEPTNAFGDIQFTG---LGQRLGKFVRVGNDTEPSVLFKLMMEHWHLDVPNLLISVTGGAKNFHLKPQLRTIFRHGLNKTARSTGIQGAWIITGGSYAGVMKYVGESVRD-----FALASGSKEGKIVAIGIATWGIIH-----------------------------NKEH----LIDAQGKF----PAEYPMDEAGQGRLSCLDNNHSHFILVDNGTHGQYGVEIVLRARLEQYIS-TQHTGSGGECRSSKAVG-------------VRGNCAARLWDMCVRVRHCGKIVLIIMQAXSMVVREINSSVIFEKQNIYFDVLICLFFLGRIISRALLTGTYACAMVVVCISASRGEANKAQESCDHQLRLALAWNRVDIATSEIFTDDRKWQTGDLEQVMDAALLENRPEFISLFVEHGLILREYLTWARLESLYNGAPAS-----SLLHILLRRISEG 460          

HSP 2 Score: 126.716 bits (317), Expect = 1.255e-29
Identity = 92/339 (27.14%), Postives = 178/339 (52.51%), Query Frame = 3
Query: 1833 PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINL--FQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIY--LICMNIEKFAEMFQ--YKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISK 2831
            P ++LFIW+VL+   E AN+FW + ++ +  AL+A+K+ K +++    D+ R   +    D +E LAI LL+EC+  D+  A  ++ ++  +WGG TCL +AY A ++ F S    Q  L   W  G +++L  ++ ILCI  P LIY R     +V++                    P +   F+ AP T F  + +++ + ++ F+YV+   +   Q+T     +++Y  ++ + +E+  ++F    K  +    ++Y  +   WN++DIL ++L  + +I R   L+ N   +    ++  +++  +    F LR + + +V+K LGPKI+++ +
Sbjct:  549 PERDLFIWAVLLNRRELANFFWSQGKDCMAAALMASKLLKAMVQEED-DSDRTSDMLAQADNYEQLAIGLLDECYKDDELRAQKLLIRQLHSWGGATCLSMAYHANNKSFFSHSGVQALLTQIWWGGMSVDLKTWRVILCIIFPLLIYTRIITFRWVLYAHTCT---------------PTRWRNFWTAPITVFWANVVSYFIFLWLFAYVI---IMDFQYTPDWPEYVLYAWVLSLILEELRQVFTDPEKAGQWKAAVRYIKDI--WNRIDILALLLFTIGVICR---LIPNSINE--STFQAGRSVLCVDYMVFCLRLMHIFTVNKTLGPKIIIVKR 861          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Match: EDO30135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1N0])

HSP 1 Score: 299.286 bits (765), Expect = 6.818e-83
Identity = 207/743 (27.86%), Postives = 366/743 (49.26%), Query Frame = 3
Query:  192 LTDGSKNSNVN---FNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFV-KNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKA--SDFREALEK-KLSQRTKNKE-PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLF--DVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLK------------RTI-FHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEII---------------------HPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDY---FENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRA--GFNINLFQCILCIFLPFLIY 2270
            L DG  +S+V+   F +N      K +I + F   +C  FV KS ++S    +C CG  +  H +  +   + ++ W++ SC    PT ++G+I+F  E     K   ++R+SH+ + + V+ LM   WN+EI  L ISV GG K+F +K + + +F +GLIKA KTT A I+T G N G+ + VG+A++  Q       + N     +GIA WG V K   ++    G              +   L+ NH+H+  VD+     Y       S   EA+ K K   R++     +PVVLL++EG  +      + IK+ VP V+  G+GRA+ ++G A+    K   + +    + ++   Y + ++ K+++  V      ++  + I++++  E +I+++  D +   D++LAIL +L+K       +  ++  +QL+L L WNR+D+AK  IF+     + E  +  +  ++++ K EF ELFLQNG  M +FL+   L KLY + P +  +K            +TI    +G      +GD+ +   +  G+Y  + A   E ++                      P+ ++F+W+VL    E A   WE   E +  AL+A+++ K +   +  D +  +  S+  D+   FE  A+ +L+EC + ++  +  ++ +E   +   T LE+A  AE Q FI+   CQ  L   W      N   ++ ++C++LP LI+
Sbjct:    9 LYDGGDSSHVHLNKFGSNQLSQSKKSWIARNFSRRECIRFVPKSHDVS----RCKCGRPRERHSQQALESGQGSEEWNVASCTTKHPTNAYGEIDF--EGYGGQKRAPYLRMSHDTDANLVITLMLKRWNLEIPNLVISVTGGAKSFVLKPRLREMFRRGLIKAAKTTGAWIITGGTNTGVMKHVGEAVKEQQLMFGSDTQVN----VIGIATWGIVDKQSDLISEKNGKYPALYSMEPTPGHQGAMLDPNHSHFFLVDDGTEGKYGVEIGMRSRIEEAIMKVKTDSRSEAGSIGVPVVLLVLEGGPNTVATMYELIKKKVPAVVIDGSGRAASVVGFAYNHTIK---RNVDGQTINVIDPQYEDEVRAKVVE--VFGAKGADKTYSMIKDVLEDEKMISVYSLDGEISQDIDLAILKALLK-------ANRSSPVAQLNLALAWNRIDLAKSDIFTEEQQWTTETLSAAMLTALLDDKAEFAELFLQNGLSMREFLSLDILCKLYAEVPGNTTIKPLLQKEMGKRQVKTIDMDVVGEVIEELMGDMFESYYRKDGHYFGELASYAEGLVLKNRKSSKDLLANINRIDPLPTPYLDVFLWAVLCNRRELARVLWEAGREPMAAALMASRLLKRMASRAQEDNTITDISSDLYDHARLFEERAVGVLDECFNENETLSQTLLVRELDHYSRMTALELAVSAESQDFIAHTSCQVLLTRLWMGTMAMNTRWWKVLVCLYLPVLIF 729          

HSP 2 Score: 73.559 bits (179), Expect = 4.850e-13
Identity = 54/174 (31.03%), Postives = 100/174 (57.47%), Query Frame = 3
Query: 2499 EILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQ-----RDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            EI+   ++  + IE+  ++       + D++  +++ + WN VDI  + +  +A+ILRF     N       I+  S+ I SL + +F +R L++ SV++ LGPK+VMI KM+  L  +III+ +  +AYGI +    FP      R+ +  T+ +++ YPYW ++GE+ L+++
Sbjct:  879 EIVLYFWVFTILIEEIRQLAAKPPKYIKDKVSVYFS-DTWNFVDIFSLTVFIIAIILRF---FTN-----SRIFTASRIILSLDIIFFIVRSLQIFSVNRLLGPKLVMIQKMMQDLAQFIIILAVFTIAYGIALHAVMFPSPGIYARNNTWVTITSVVQYPYWQMYGELFLDEI 1043          

HSP 3 Score: 52.373 bits (124), Expect = 1.404e-6
Identity = 18/47 (38.30%), Postives = 30/47 (63.83%), Query Frame = 2
Query: 3143 VFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDF 3283
            +FNY F+R+  +S ++WKF  + LV EY+++P+F  P  +  H   F
Sbjct: 1084 IFNYTFERVQEDSDKVWKFQRYDLVQEYHSRPVFAPPLVLLGHILIF 1130          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Match: EDO47658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT7])

HSP 1 Score: 194.897 bits (494), Expect = 2.243e-50
Identity = 147/476 (30.88%), Postives = 249/476 (52.31%), Query Frame = 3
Query:  432 TVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNS--LCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALE-----KKLSQRTKNKEPIPVVLLLIEGEYDVF---FEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKN---VSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLEL--AILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRS---FNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQC 1805
            T+PT++FG++EF G         +++RL+H+ + + V++L+   W +++  L ISV GG KNF +  K K +  +GL+KA +TT A ++T G N G+ R VG+A++        +   N +  +  +GIA WG V +K++L + K  ++ Y++++  + +    L+ NH+H++ VD     +Y    +  FR +LE     KK++Q+      +PVVLL++EG  +      E+  R    VP+VI  G+GRA+D+L  A R +           GV  + E +R  L K  I+K+    S  D+++   N ++ +  +E+ +T+F V +D  LE+  AIL +L+K       S+ + L  QLSL L W+R DIAK +IF+             + E++++ + EFV+L L NG  M +FLT   LE+LY     S       R   H+    ++N    +        G Y  +C
Sbjct:   14 TLPTDAFGELEFQG--AGQPSRAKYIRLAHDTDPELVLRLLCGEWALDLPKLLISVTGGAKNFILSPKIKRVLREGLLKAAQTTGAWVITGGTNTGVMRHVGEAVKGHTVMSRGEQLKNTAHQVHLIGIASWGIVDHKEMLVNPKVEVVPYQMTSS-MQSRGACLDNNHSHFILVDNGTDGEYGGEIS--FRASLENLIASKKMAQKFHG---VPVVLLVLEGGPNTIRTVLESVSRCPA-VPVVIAEGSGRAADILAFAHRFIAP---SNGEMSGVADVVE-HRQLLHK--IEKSFAECSPEDRLSIYQNVLKCVAKREF-VTIFCV-DDGGLEVDKAILRALLK-------SQHSQLEDQLSLALVWDRADIAKTEIFTEDQKWEVPMLETAMMEALLHDRVEFVDLLLDNGVSMANFLTVKRLEELYRKVRGSKANHASSRIFMHYHNDTYTNASTQMNK---HTHGIYTQRC 462          

HSP 2 Score: 83.5741 bits (205), Expect = 3.927e-16
Identity = 100/382 (26.18%), Postives = 171/382 (44.76%), Query Frame = 3
Query: 2019 FENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTW----RAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTS---------------------NKGYFTN----------SGN--WPL----------KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNF----------NNWNKVDILMVILSAMAMILRF-PLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            F ++A+ LL+EC+ A+   A  ++    + WGG T L +A  +  ++F++   CQ  L   W    + G+N +L + +L I  P LI+   F +   +      DD S                     N GY  +          SGN   P+          +++ FY AP TKF  + + + + +  FS+V+L  +  +  +I E + I ++  +  E+  ++          R+   WNF          N WN  D   ++L  +A+ LR  P  L           R    +YSL +  + +R L + SV K+LGP +VMI +M   +M++++IM++ LLAYG+  Q   FP    S   +  I   PY+ ++GE+
Sbjct:  595 FYDIALGLLDECYKANDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTEIWMGALKTGYNGSL-KVLLGILFPPLIFALEFRSREEMQRVPTTDDDSADDLPPDFDPYHHREPGSAQYNDGYLGDGVAFVKNRKSSGNEEEPIVEIRLLGLGKRIIGFYNAPITKFWSNLIVYLLFLVVFSHVILIELPPVP-SIEEWVLIGFVFSLCAEEVRQV----------RVINVWNFSFFESSDWASNVWNLCDGFAMVLFFLAVGLRLNPGTL-----------RIGHLVYSLDIMLWIIRLLDIFSVSKDLGPYVVMIGRMTIDMMYFLVIMVVFLLAYGVAQQAILFPHEKPSWELITKIFFRPYFQVYGEL 953          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 306.99 bits (785), Expect = 7.012e-85
Identity = 296/1044 (28.35%), Postives = 490/1044 (46.93%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYK-VSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHF--------LGRNFSNGLGDV---------------------KDLLTKIFGYYEDQCA-------------------MCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNI---NLFQCILCIFLPFLIYRRSFDN----SYVIHE-------------------------------SKKKDDTSNKGYFTNSGNW----PL--KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL 3005
            K +I++ F   +C   +  +K+      +C CG L  +H          + DK      ND     WSI    +  PT++FG IEF G   +N  +  +VR+S++   D ++ LM   W +++  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+ +SN   L++   LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L    +  ++  I          + E  R+ L   +      +  +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  ++ FLT + LE+LY       N   T++H         L  ++   L D+                     + L   +FG   D                      + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W     +   +  + IL + LP  I    F N    SY+  +                                K   DTS K       +     PL  K+ +FY AP  KF  H+LA+   +  F+Y+VL  M  +  +  E + I Y+    IEK  E+   +  K+  ++K W     WN  D++ +++ ++ M+LR             M Y   + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q    P  D S     NI   PYW I+GE+  +Q+
Sbjct:   44 KSWIERAFSKRECVHIIVSAKD----PHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQTMSNP--LSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGI----------INESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSN---TLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYHNLFGPKRDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNSGLKVILGLLLPPSILSLEFKNKDEMSYMPQDQEAYLQEKEEEEPEKPVKEKEEEDMEFTAMLGKVATDTSRKKDVEEVQSRHRLIPLGRKIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMD-LWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSVGMVLRL-------QEPPFMSY--GRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQI 1033          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 285.034 bits (728), Expect = 3.737e-78
Identity = 267/987 (27.05%), Postives = 464/987 (47.01%), Query Frame = 3
Query:  240 EKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKE----PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDH--DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTT-TTLEKLYEDCPRSFNLKRTIFHFLGRN---FSNG--LGDVKDLLTKIFG---------YYEDQCAMCDEEI----------IHPFQE---------LFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILC-IFLP-----FLIYRRS--FDNSYVIHESKKK-----DDTSNKGYFTNSGNWPL----KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQF----TIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNN-WNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDY-PYWAIFGEITLN 2999
            E+  L  ++K+  +  +C  F +   E       C CG  K  H  + I P + V + W+ H     VPT +FG+I+F G   T  K   + R+S E + + +  L+ + W++    L ISV GG KNF +K   + +F++GLIK  +TT A I+T G N G+ + VG A+++    L +  +G   +  +G+A WG + N++ L + +G      ++++        L+KNHTH+L VD+     Y      + R  LEK +S +   K+     IPVV +++EG           +K   P VI  GTGR +D++     ++   P++Q+    +  L E +     KK  + +V       E    I++I+   +L+T+F V ED   D+++AIL +L+K    +    L+   +QL L + WNRVDIAK +IF+     S  +    +  +++  K +FV L L+NG  +  FL    TL  LY + P    L++       +     SN   L  V D +  + G         Y E +  M  E++            P  E         +F+W+VL  N + A   WE+ ++S+C AL AT+I K L      D    E + N   ++E  AI +  EC++ D+E A  ++   +  WGG T L +A KAED++F++    Q  +   W    +++  + + ++C +F P     FL +R    F       E+ KK      +T       ++ + PL    +LV  Y +PQ KF      +++  ++F   +  G+  M F    ++ E+L  +++  +  E+F ++F   ++  G +IK      + WN +D+L ++L  + +  R              ++   K +  +    F LR + + ++ + LGPKI+++ +M+  L F++ ++ I ++AYG+  QG      D  L+ +     Y PY  IFG    N
Sbjct:   26 ERCALSCWMKQNINKKECALFQKGPSE-----EICKCGYSKEAHNVEAIKPEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAK---YARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRD--YSLSNSIQGQ--IVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHYGVE--IELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIA----QVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVI------EWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGES-DAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDKPLSCWDRLVSLYGSPQVKF-----YWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQLF-CNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRL----------TSELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILI-HNDTRLDWIFRGAIYEPYLIIFGNFPEN 970          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm2 (transient receptor potential cation channel subfamily M member 2 [Source:NCBI gene;Acc:101170060])

HSP 1 Score: 284.648 bits (727), Expect = 5.286e-78
Identity = 267/987 (27.05%), Postives = 464/987 (47.01%), Query Frame = 3
Query:  240 EKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKI-PYNKVND-WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKE----PIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDH--DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTT-TTLEKLYEDCPRSFNLKRTIFHFLGRN---FSNG--LGDVKDLLTKIFG---------YYEDQCAMCDEEI----------IHPFQE---------LFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNIN--LFQCILC-IFLP-----FLIYRRS--FDNSYVIHESKKK-----DDTSNKGYFTNSGNWPL----KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQF----TIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNN-WNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDY-PYWAIFGEITLN 2999
            E+  L  ++K+  +  +C  F +   E       C CG  K  H  + I P + V + W+ H     VPT +FG+I+F G   T  K   + R+S E + + +  L+ + W++    L ISV GG KNF +K   + +F++GLIK  +TT A I+T G N G+ + VG A+++    L +  +G   +  +G+A WG + N++ L + +G      ++++        L+KNHTH+L VD+     Y      + R  LEK +S +   K+     IPVV +++EG           +K   P VI  GTGR +D++     ++   P++Q+    +  L E +     KK  + +V       E    I++I+   +L+T+F V ED   D+++AIL +L+K    +    L+   +QL L + WNRVDIAK +IF+     S  +    +  +++  K +FV L L+NG  +  FL    TL  LY + P    L++       +     SN   L  V D +  + G         Y E +  M  E++            P  E         +F+W+VL  N + A   WE+ ++S+C AL AT+I K L      D    E + N   ++E  AI +  EC++ D+E A  ++   +  WGG T L +A KAED++F++    Q  +   W    +++  + + ++C +F P     FL +R    F       E+ KK      +T       ++ + PL    +LV  Y +PQ KF      +++  ++F   +  G+  M F    ++ E+L  +++  +  E+F ++F   ++  G +IK      + WN +D+L ++L  + +  R              ++   K +  +    F LR + + ++ + LGPKI+++ +M+  L F++ ++ I ++AYG+  QG      D  L+ +     Y PY  IFG    N
Sbjct:   26 ERCALSCWMKQNINKKECALFQKGPSE-----EICKCGYSKEAHNVEAIKPEDFVGETWNKHRHVLDVPTNAFGEIQFDGLQQTTAK---YARVSSETSPEVLYDLLTEQWHLLPPNLLISVTGGAKNFNLKPHLRNMFHRGLIKVAQTTGAWIITGGTNAGVMKHVGQAVRD--YSLSNSIQGQ--IVAIGVATWGVIHNREALINEEGCFPALYMTDKTSQGRLSCLDKNHTHFLLVDDGTHGHY--GVEIELRTCLEKCISGKQLGKKDSSVTIPVVCVVLEGGPGTLNTIFNAMKNGTPCVIFEGTGRIADVIA----QVSGLPLQQITITLIHQLMEKFFGQEYKKFTELSVI------EWTKKIQDIVRMSHLLTIFRVTEDSHGDVDVAILKALLKASRSSETLTLDCWKTQLELAVAWNRVDIAKTEIFTEDSLWSSADLHQAMFSALVGNKPQFVTLLLENGMSLRKFLQNEETLCNLYREMPSCIFLRKLAKRVHSKADLVDSNNITLTHVSDEVRHLLGNATRHIYPPYVEQRYCMSAEDLSLSLSKNNGAPRPAGEVAQRDASSDVFLWAVLQNNRDLAEIAWEQCQDSICAALAATRILKKLAGGES-DAEEAEEMLNQASHYEEHAIGVFSECYNTDEERALKLLVHVSNFWGGTTSLWLALKAEDKRFVALSGVQAFMTRVWCGELSVDNHILRVLICMLFFPLIYTGFLAFRHDELFQKEAKKQEAMKKVKRVTGNTHGAQSLGSAPDKPLSCWDRLVSLYGSPQVKF-----YWNIVSYFFFLNLFAGVLMMDFHATPSVPELLLYVWVFSLVCEEFRQLF-CNSDGFGFKIKAKLYITDLWNILDVLSILLFLLGLAFRL----------TSELFYAGKIVLCIDFVVFCLRLMAIFTISQTLGPKIIIVRRMMKDLFFFMFLLSIWVVAYGVAKQGILI-HNDTRLDWIFRGAIYEPYLIIFGNFPEN 970          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 254.603 bits (649), Expect = 3.338e-68
Identity = 221/805 (27.45%), Postives = 374/805 (46.46%), Query Frame = 3
Query:  102 IKMNKTVSTTGDS--FSQNELFAQAVHQARF-----RLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYK-VSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-FLKESIING----KYEFVELFLQNGAVMNDFLTTTTLEK-----------LYE--------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED------------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTW 2204
            ++ ++  ST  DS   S      ++  + RF     RL+    ++      + +    K +I++ F   +C   +  +K+      +C CG L  +H          + DK      ND     WSI    +  PT++FG IEF G   +N  +  +VR+S++   D ++ LM   W +++  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+ +SN   L++   LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L    +  ++  I          + E  R+ L   +      +  +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +  L++++++     + +FV+L ++NG  ++ FLT + LE+           LY         + P  + +                          RT++H       N  G  +    K+ G  +D                     + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W
Sbjct:   13 LRRDRAFSTRDDSSVASGTSGPGRSTTRGRFSESWKRLSSRGGSTKRGALNSQQPPAQKSWIERAFSKRECVHIIVSAKD----PHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQTMSNP--LSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGI----------INESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMW 770          

HSP 2 Score: 75.8702 bits (185), Expect = 3.206e-13
Identity = 71/225 (31.56%), Postives = 121/225 (53.78%), Query Frame = 3
Query: 2370 KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLICLGVMTKQQIII 3044
            K+ +FY AP  KF  H+LA+   +  F+Y+VL  M  +  +  E + I Y+    IEK  E+   +  K+  ++K W     WN  D++ +++ ++ M+LR             M Y   + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q    P  D S     NI   PYW I+GE+  +Q+  +     QQ +I
Sbjct:  882 KIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMD-LWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSVGMVLRL-------QEPPFMSY--GRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDHMHSRKFQQRLI 1095          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Match: trpm3 (transient receptor potential cation channel subfamily M member 3 [Source:NCBI gene;Acc:100533512])

HSP 1 Score: 254.218 bits (648), Expect = 4.913e-68
Identity = 211/747 (28.25%), Postives = 351/747 (46.99%), Query Frame = 3
Query:  255 KGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEH----------KKDKIPYNKVND-----WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYK-VSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQR---TKNKEPIPVVLLLIEGEYDVFFEASKRIKEN--VPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDV-KEDH-DLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWAL-----FLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEK-----------LYE--------DCPRSFNLK-------------------------RTIFHFLGRNFSNGLGDVKDLLTKIFGYYED------------------QCAMCDEEIIH---PFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLM----EMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTW 2204
            K +I++ F   +C   +  +K+      +C CG L  +H          + DK      ND     WSI    +  PT++FG IEF G   +N  +  +VR+S++   D ++ LM   W +++  L ISV GG +NF+++ K K +F +GLIKA  TT A I T G+N G+ R VGDA++    D   K++G   +C +GIAPWG V+N++ L   K  +  Y+ +SN   L++   LN  H+H++  D      Y        R  LEK +S +   T+  + +PVV L++EG  +V     + +++   VP+V+C G+GRASD+L    +  ++  I          + E  R+ L   +      +  +       + E + K+ LIT+F +  E H D++LAIL +L+K  + ++         QLSL L WNRVDIA+ +IF     +  + W +      + ++++  + +FV+L ++NG  ++ FLT + LE+           LY         + P  + +                          RT++H       N  G  +    K+ G  +D                     + D EI H   PF EL +W+VLM+  + A +FW+  EE++  ALVA K+ K +     E   +D    E   N ++ F  LA++LL++ +  D++ A  ++  E   W   TCL++A  A+ + FI+    Q  L   W
Sbjct:   33 KSWIERAFSKRECVHIIVSAKD----PHRCCCGRLIGQHVGLPPGISSSQNDKAERMAKNDSLSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAM--YVRVSYDTKPDLLLHLMTKEWQLDLPKLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALK----DHASKSRGK--ICTIGIAPWGIVENQEDLV-GKDVVRPYQTMSNP--LSKLTVLNSLHSHFILADNGTTGKYGAE--VRLRRQLEKHISLQKINTRIGQGVPVVALIVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGI----------INESLRDQLLVTIQKTFTYSRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASA-------PDQLSLALAWNRVDIARSQIF-----IYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSVHRFLTLSRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYTRKRFRTLYH-------NLFGPKRPKALKLLGMEDDMPIRRGRQKTTRKREEEVDIDLDDPEINHFPFPFHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNHNSRE-FAQLAVELLDQSYKQDEQMAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQMLLTDMW 732          

HSP 2 Score: 75.8702 bits (185), Expect = 2.718e-13
Identity = 71/225 (31.56%), Postives = 121/225 (53.78%), Query Frame = 3
Query: 2370 KLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLICLGVMTKQQIII 3044
            K+ +FY AP  KF  H+LA+   +  F+Y+VL  M  +  +  E + I Y+    IEK  E+   +  K+  ++K W     WN  D++ +++ ++ M+LR             M Y   + IY + + Y+Y+R L +  V+K LGP ++MI KM+  +M+++IIML++L+++G+  Q    P  D S     NI   PYW I+GE+  +Q+  +     QQ +I
Sbjct:  844 KIYEFYNAPIVKFWFHTLAYVGYLMLFNYIVLVKMD-LWPSPQEWIVIAYIFTNGIEKMREILMSEPGKLLQKVKVWLQ-EYWNITDLMAILIFSVGMVLRL-------QEPPFMSY--GRVIYCINIIYWYIRLLDIFGVNKYLGPYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILNPNEDPSWMLARNIFFMPYWMIYGEVFADQIDHMHSRKFQQRLI 1057          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 1592.02 bits (4121), Expect = 0.000e+0
Identity = 770/770 (100.00%), Postives = 770/770 (100.00%), Query Frame = 3
Query:  108 MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH 2417
            MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH
Sbjct:    1 MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH 770          

HSP 2 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 340/340 (100.00%), Postives = 340/340 (100.00%), Query Frame = 2
Query: 3008 LPWCDDKTTNYNISNECPELNYFVPVXXXXXXXXXXXXXXXXXXXVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCGNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLAIPLESEIDKLVKYFENNSQXXXXXXXXXXXXQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYYPTLDISEFEVQNPTTFIEEDIINTNKEIVSLIHDLRTGQLSVSAPSSNANVRSSFLIPRIIVDENCDNNFSDPNSDLGGNKLKNWVTELINIDSETVLEVQNLQKKLCDFQDHVVESFTKIESFL 4027
            LPWCDDKTTNYNISNECPELNYFVPVLTAIYIFIAAILLLNILTAVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCGNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLAIPLESEIDKLVKYFENNSQKCVVKELVEEKEQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYYPTLDISEFEVQNPTTFIEEDIINTNKEIVSLIHDLRTGQLSVSAPSSNANVRSSFLIPRIIVDENCDNNFSDPNSDLGGNKLKNWVTELINIDSETVLEVQNLQKKLCDFQDHVVESFTKIESFL
Sbjct:  899 LPWCDDKTTNYNISNECPELNYFVPVLTAIYIFIAAILLLNILTAVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCGNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLAIPLESEIDKLVKYFENNSQKCVVKELVEEKEQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYYPTLDISEFEVQNPTTFIEEDIINTNKEIVSLIHDLRTGQLSVSAPSSNANVRSSFLIPRIIVDENCDNNFSDPNSDLGGNKLKNWVTELINIDSETVLEVQNLQKKLCDFQDHVVESFTKIESFL 1238          

HSP 3 Score: 207.608 bits (527), Expect = 0.000e+0
Identity = 119/122 (97.54%), Postives = 121/122 (99.18%), Query Frame = 3
Query: 2649 SAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLICL 3014
            +AMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKMLYQLMFYIIIMLIILLAYGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQL+ L
Sbjct:  778 TAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKMLYQLMFYIIIMLIILLAYGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLVYL 899          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064637.1 (SMESG000064637.1)

HSP 1 Score: 1589.32 bits (4114), Expect = 0.000e+0
Identity = 770/770 (100.00%), Postives = 770/770 (100.00%), Query Frame = 3
Query:  108 MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH 2417
            MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH
Sbjct:    1 MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIH 770          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064622.1 (SMESG000064622.1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 524/958 (54.70%), Postives = 688/958 (71.82%), Query Frame = 3
Query:  144 SQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKY--PIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRS-FDNSYVIHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEITLNQLI 3008
            +QNE +   + QAR ++ +  + SNV+F  NDEK   + +I  KF S++CR+F    KE+ +K +KC CGE+K  HK++KIPY     WS   C E +PT SFGKIEF GED+TN+KLT+FVR+S+ D LDD++ L+F+ W I  GTLCISV+GGT +FKM  KEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VKN+KILE AKG  + Y VSNE+   +P+SLNKNHTHY+F D+  R   +  K   FR+ALE K+SQ+  ++  IPVVLL++EG +D+F EAS+R+KE V IV+C GTG+ASD++GEAFREMQ+     K +R DGV MLPE ++N LK+KLI++++S   +V+EA+  IE+II  E LIT+FD+K   DL+ AILYSLIKRMD   DS  N LSSQLSLCL WNRVDI KDKIFSG +SLS + WA FLK+SII GK +F+ELFL+N + + DFLT   L++LYE CP+S N ++T    +GR FS GL DVK+LL+K+ G+YE  C+  D  I HPFQELF+W+VLME  +CA +FW K +ESL LALVAT+IYK     S  DT R ETL  WK+YFENLA+KL+EECHD DQE AAY+IEK+N  WGG +CLE+A K+ D KF+S +VCQN                CILCI  PFLI +R+ F   +   +S+   D +     T+  +   KL +FYLAPQTKFCIHS  F   + YFSYVVL+GMKRMQ TIHEI+F+IYL+ M ++KF E+F+ +++++  RIKYWW FN+WNKVD+++++ + +AM+LR+ L +     D V+++R SKTIYSLIVG FYL+ LRL++ HK LGPKI M+SK++ +L+ +  I+LI LL+YG+T Q  Y+PQRDFS   L NI+DYPY+ +FG + L   +
Sbjct:   11 TQNEDYTVTIRQARCKINESYRESNVHFAENDEKMQYRNYINAKFQSVECRYFSVAIKEIDDKNSKCSCGEIKKSHKENKIPYGPRESWSEGDCMEMLPTYSFGKIEFTGEDITNSKLTDFVRVSYRDKLDDIVDLIFNKWKITAGTLCISVIGGTIDFKMHHKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKNRKILEFAKGRTVHYNVSNEVEKHQPISLNKNHTHYIFFDDGYRLQMTKKKVGYFRQALENKISQKQGDRVGIPVVLLIVEGGHDIFIEASRRVKEKVSIVVCEGTGKASDIIGEAFREMQRICSRHKMIRSDGVAMLPESFKNVLKRKLIEQDISELHQVDEAIKCIEDIIKNELLITVFDIKSHEDLDFAILYSLIKRMDLLCDSNQNPLSSQLSLCLTWNRVDIVKDKIFSGDISLSNDEWAAFLKDSIITGKVKFIELFLENVSNIQDFLTANILKELYETCPKSTNFRKTFLRLIGRPFSKGLNDVKELLSKMIGFYEYPCSEND-SIKHPFQELFLWAVLMEKQKCAKFFWGKCDESLFLALVATRIYKYHQRTSLRDTDRSETLETWKNYFENLAVKLIEECHDIDQEVAAYLIEKKNENWGGISCLELASKSTDLKFMSNIVCQN----------------CILCIIFPFLISKRTEFTKDFKTCQSESFPDFNEDNCRTSISS---KLRRFYLAPQTKFCIHSFTFISFIIYFSYVVLYGMKRMQVTIHEIMFMIYLVLMILDKFVEIFKSRSDRIYGRIKYWWTFNHWNKVDMIIIVFAIVAMVLRYQLAINGVYTDKVVMFRWSKTIYSLIVGSFYLKILRLLACHKKLGPKIFMMSKIIKELLIFSTIILIFLLSYGVTSQAGYYPQRDFSWIALSNILDYPYYTMFGVLNLGNTV 948          

HSP 2 Score: 109.768 bits (273), Expect = 7.973e-24
Identity = 80/188 (42.55%), Postives = 118/188 (62.77%), Query Frame = 2
Query: 2999 SIDLPWCDDKTTNYNISNECPELNYFVPVXXXXXXXXXXXXXXXXXXXVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLC--GNQCEKTEENEKNLDTLSRDSQITFSPPKKMKSFNFRKLA-IPLESEIDKLVKYFENNSQXXXXXXXXXXXXQLIESGMSRLESRL 3553
            ++   WC+  +TNY +SNECPE N+ +P+L A Y+ I  ILLLNIL A  +YI Q IHRNSI IWK++M+SL++EY  KP+ P+PFS F + +    + C    +C     N K  +    +S++    P   K       + I  +S+++KL+KYFEN SQK V+K +  EK++ I+SG+SR+E RL
Sbjct:  947 TVYFTWCN-ASTNYEVSNECPENNFLIPILFAGYVIIINILLLNILIATSSYICQDIHRNSIVIWKYSMYSLILEYNDKPILPMPFSTFVYIYQVL-AFCYQKGRCYNL-SNSKKFEITKHNSKLHIDKPMAFKHDTLNIFSNIKSDSDLNKLIKYFENYSQKFVIKNIAIEKQKSIKSGISRMEIRL 1131          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 939.488 bits (2427), Expect = 0.000e+0
Identity = 488/956 (51.05%), Postives = 663/956 (69.35%), Query Frame = 3
Query:  150 NELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQ--LRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYV-------IHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            N+ F+ ++ QARF++TD ++ S++ F+ NDEK   + F+K  FHSI+CR F    + L +   KC+CGE K  HK DK P++  + W  +   E + T+SFGKIEF GED+TNTKLT+FVR+S+ D LDD+++L+F+ WNI +GTLCISV+GGT +FKM+KKEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VK + ILE AKG  + Y VSNE+   +PVSLNK+HTHY+FVD+  R   S  K + FR+ALE K+SQ+   +  IPVVLL++EG ++V  E S                RAS++LGE F+E+     K+   R     +  E YR +LK KLI++N+    +V+E +  IEEI+ KE+LITLF +K   DL+ AIL+SLIKRMDF  D + N LSSQLSLCL WNR+DI KDKIF G +SLS   W  F KESI+ G+ +F+ELFL+N + ++DFLTT  L+ LY+  P+S N ++T    +GR+FS GL + K+L+ K+ G    Q  M ++  +HPFQELF+WSVLME ++CA +FW K +++LCLALVAT+IYKCL   S  DT R  TL+ WK+ FENLA+KL+EECHD DQETAAY+IEKE   + G TCLE+A K+++ KF+S +VCQNS+DFTWRAGF I+ ++CILCI  PFLI      N Y        +H +++  D        +   +  KL +FY+APQTKF IHS+ F+  + YFSYVVL+GM+RM  + HE +F+ YL+ +  E   EMFQ ++  + DR+KYWW FN  NK+D ++++L+  AM LR+PL     + DI++IYRCSKTIYSLIVG  Y+RFLRL++ HK LGPK++M+++++ QLM Y+II++I L +YG+T Q  Y+ QRDFS + L N+  YPY+ + G I
Sbjct:   13 NDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGS----------------RASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYRKALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLIL---MQNKYTKDLKPLKLHRAQECQDYIE---VRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVI 946          

HSP 2 Score: 72.0182 bits (175), Expect = 3.227e-12
Identity = 53/139 (38.13%), Postives = 80/139 (57.55%), Query Frame = 2
Query: 2948 EYNGLPVLGYIWGDYIESIDLPWCDDKTTNYNISNECPELNYFVPVXXXXXXXXXXXXXXXXXXXVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCGNQCEKTEENEKNLDTLSRDSQ 3364
            +Y    +LG I+  Y  ++ L WCD    N   S +CPE N  +P+L A ++ I+ IL++NIL A    + + IH++SI+IWK+  +SL++EY  KP+ PLPFS+  H ++     CG   E    N KN D + R  Q
Sbjct:  936 QYPYYTMLGVIFSKY--NVYLSWCDP-AMNTTESKDCPEQNVVMPILFAAFVMISNILIMNILVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCG---ESECYNLKNKDEMMRYEQ 1068          
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Match: SMESG000064632.1 (SMESG000064632.1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 488/956 (51.05%), Postives = 663/956 (69.35%), Query Frame = 3
Query:  150 NELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLKGFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVNDWSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMFDYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSGLNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHAKGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREALEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGRASDLLGEAFREMQKYPIKQ--LRPDGVPMLPEMYRNSLKKKLIDKNVSNPDKVNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLNTLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFVELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGDVKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKTEESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECHDADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWRAGFNINLFQCILCIFLPFLIYRRSFDNSYV-------IHESKKKDDTSNKGYFTNSGNWPLKLVQFYLAPQTKFCIHXXXXXXXXXXXXXXXXXGMKRMQFTIHEILFIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAMAMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLGPKIVMISKXXXXXXXXXXXXXXXXXXXGITMQGAYFPQRDFSLNTLPNIMDYPYWAIFGEI 2990
            N+ F+ ++ QARF++TD ++ S++ F+ NDEK   + F+K  FHSI+CR F    + L +   KC+CGE K  HK DK P++  + W  +   E + T+SFGKIEF GED+TNTKLT+FVR+S+ D LDD+++L+F+ WNI +GTLCISV+GGT +FKM+KKEK IF QGLIKA  TTNALI+T GLN GIT  +GDAIQ  Q  LYDK K NN + CLGIAPWG+VK + ILE AKG  + Y VSNE+   +PVSLNK+HTHY+FVD+  R   S  K + FR+ALE K+SQ+   +  IPVVLL++EG ++V  E S                RAS++LGE F+E+     K+   R     +  E YR +LK KLI++N+    +V+E +  IEEI+ KE+LITLF +K   DL+ AIL+SLIKRMDF  D + N LSSQLSLCL WNR+DI KDKIF G +SLS   W  F KESI+ G+ +F+ELFL+N + ++DFLTT  L+ LY+  P+S N ++T    +GR+FS GL + K+L+ K+ G    Q  M ++  +HPFQELF+WSVLME ++CA +FW K +++LCLALVAT+IYKCL   S  DT R  TL+ WK+ FENLA+KL+EECHD DQETAAY+IEKE   + G TCLE+A K+++ KF+S +VCQNS+DFTWRAGF I+ ++CILCI  PFLI      N Y        +H +++  D        +   +  KL +FY+APQTKF IHS+ F+  + YFSYVVL+GM+RM  + HE +F+ YL+ +  E   EMFQ ++  + DR+KYWW FN  NK+D ++++L+  AM LR+PL     + DI++IYRCSKTIYSLIVG  Y+RFLRL++ HK LGPK++M+++++ QLM Y+II++I L +YG+T Q  Y+ QRDFS + L N+  YPY+ + G I
Sbjct:   13 NDEFSASIRQARFKITDSNRGSHIRFSENDEKALYRKFVKSNFHSIECRKFSSLEEILDHNNAKCMCGEAKKNHKIDKTPFSLCDPWKENESMEVISTDSFGKIEFFGEDITNTKLTDFVRVSYNDKLDDILELLFNKWNINVGTLCISVIGGTIDFKMRKKEKNIFCQGLIKAAITTNALIITPGLNKGITSVIGDAIQYSQSYLYDKMKHNNFISCLGIAPWGYVKKRNILESAKGRTVHYNVSNEVEQNQPVSLNKHHTHYIFVDDGYRLQMSRKKVAYFRQALENKISQKLGERAAIPVVLLIVEGGHEVLVEGS----------------RASNILGEVFQEVSNSSWKRERTRSGDTSVFSENYRKALKTKLIEQNICELHQVDEDVKCIEEIVKKEFLITLFYIKSHQDLDFAILHSLIKRMDFLCDPRYNPLSSQLSLCLIWNRIDIVKDKIFLGDISLSNAEWIAFFKESIMKGRIDFIELFLENVSNLHDFLTTEILDDLYKTYPKSNNFRKTFLILIGRSFSKGLSEAKELVFKMIGVNRKQLKMRNDYSLHPFQELFLWSVLMEKNKCARFFWGKCDDALCLALVATRIYKCLRGTSVRDTDRQVTLTLWKESFENLAVKLIEECHDIDQETAAYLIEKEIPIFEGITCLELANKSKNLKFMSNIVCQNSIDFTWRAGFTISFYECILCILFPFLIL---MQNKYTKDLKPLKLHRAQECQDYIE---VRSMPYYKAKLKRFYMAPQTKFVIHSITFTSFLLYFSYVVLYGMRRMTLSTHETIFMSYLVILIFESIIEMFQSRSYSIFDRMKYWWKFNYCNKLDAIIILLAISAMALRYPLAYYPIDADIIIIYRCSKTIYSLIVGMLYIRFLRLLTRHKKLGPKMMMMTELVKQLMIYLIIIVIFLASYGVTSQAGYYLQRDFSWSALANLFQYPYYTMLGVI 946          

HSP 2 Score: 68.9366 bits (167), Expect = 2.241e-11
Identity = 46/118 (38.98%), Postives = 72/118 (61.02%), Query Frame = 2
Query: 2948 EYNGLPVLGYIWGDYIESIDLPWCDDKTTNYNISNECPELNYFVPVXXXXXXXXXXXXXXXXXXXVFNYIFQRIHRNSIEIWKFTMFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCG 3301
            +Y    +LG I+  Y  ++ L WCD    N   S +CPE N  +P+L A ++ I+ IL++NIL A    + + IH++SI+IWK+  +SL++EY  KP+ PLPFS+  H ++     CG
Sbjct:  936 QYPYYTMLGVIFSKY--NVYLSWCDP-AMNTTESKDCPEQNVVMPILFAAFVMISNILIMNILVATNCELCENIHKDSIDIWKYNKYSLLLEYEKKPIIPLPFSMIIHIYNILTDRCG 1050          
The following BLAST results are available for this feature:
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRPM31.799e-9027.77transient receptor potential cation channel subfam... [more]
TRPM33.195e-8927.86transient receptor potential cation channel subfam... [more]
TRPM31.936e-8028.34transient receptor potential cation channel subfam... [more]
TRPM34.981e-7828.12transient receptor potential cation channel subfam... [more]
TRPM34.981e-7828.12transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtl-24.858e-6023.71Gon-Two Like (TRP subfamily) [Source:UniProtKB/Tr... [more]
gon-29.553e-4426.15Transient receptor potential channel [Source:UniP... [more]
gon-21.022e-4326.15Transient receptor potential channel [Source:UniP... [more]
gon-21.148e-4326.15Transient receptor potential channel [Source:UniP... [more]
gtl-18.758e-4326.96GTL-1; Gon-Two Like (TRP subfamily) [Source:UniPr... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm1.595e-7226.30gene:FBgn0265194 transcript:FBtr0339075[more]
Trpm2.240e-7226.53gene:FBgn0265194 transcript:FBtr0339082[more]
Trpm2.417e-7126.52gene:FBgn0265194 transcript:FBtr0339074[more]
Trpm7.576e-7126.53gene:FBgn0265194 transcript:FBtr0339079[more]
Trpm9.314e-7126.59gene:FBgn0265194 transcript:FBtr0339077[more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm21.924e-7625.94transient receptor potential cation channel, subfa... [more]
trpm34.669e-7028.65transient receptor potential cation channel, subfa... [more]
hrc2.497e-6525.08histidine rich calcium binding protein [Source:ZFI... [more]
trpm4b.21.314e-6324.43transient receptor potential cation channel, subfa... [more]
trpm51.444e-6027.83transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3a23.079e-9028.61aldehyde dehydrogenase 3 family member A2 [Source:... [more]
TRPM13.368e-9028.47transient receptor potential cation channel subfam... [more]
aldh3a21.673e-8928.74aldehyde dehydrogenase 3 family member A2 [Source:... [more]
aldh3a23.445e-8927.97aldehyde dehydrogenase 3 family member A2 [Source:... [more]
TRPM12.592e-8827.21transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trpm32.471e-9028.23transient receptor potential cation channel, subfa... [more]
Trpm33.625e-9028.23transient receptor potential cation channel, subfa... [more]
Trpm34.389e-8927.86transient receptor potential cation channel, subfa... [more]
Trpm34.400e-8927.86transient receptor potential cation channel, subfa... [more]
Trpm31.073e-8527.75transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HCF6|TRPM3_HUMAN3.588e-8527.22Transient receptor potential cation channel subfam... [more]
sp|A7T1N0|TMP2L_NEMVE1.663e-8127.86Transient receptor potential cation channel subfam... [more]
sp|A0A0R4IMY7|TRPM2_DANRE1.452e-7525.94Transient receptor potential cation channel subfam... [more]
sp|Q91YD4|TRPM2_MOUSE2.781e-7125.57Transient receptor potential cation channel subfam... [more]
sp|E9PTA2|TRPM2_RAT3.992e-7125.46Transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|228326572.321e-16535.67tr|A0A5K4FE95|A0A5K4FE95_SCHMA Uncharacterized pro... [more]
gnl|BL_ORD_ID|182426193.542e-15935.19tr|A0A267FX17|A0A267FX17_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182818195.511e-15935.19tr|A0A267E1J7|A0A267E1J7_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182603431.834e-15835.19tr|A0A267FD75|A0A267FD75_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|217720213.338e-14934.29tr|A0A183AFB2|A0A183AFB2_9TREM LSDAT_euk domain-co... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm33.438e-7428.11transient receptor potential cation channel, subfa... [more]
hrc6.438e-6724.74transient receptor potential cation channel subfam... [more]
trpm4a1.236e-5825.39transient receptor potential cation channel subfam... [more]
trpm4a1.575e-5825.39transient receptor potential cation channel subfam... [more]
trpm73.077e-5530.71transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
trpm76.204e-8328.79transient receptor potential cation channel, subfa... [more]
trpm71.212e-7527.27transient receptor potential cation channel, subfa... [more]
trpm28.554e-3023.80transient receptor potential cation channel, subfa... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO301356.818e-8327.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476582.243e-5030.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trpm37.012e-8528.35transient receptor potential cation channel subfam... [more]
trpm23.737e-7827.05transient receptor potential cation channel subfam... [more]
trpm25.286e-7827.05transient receptor potential cation channel subfam... [more]
trpm33.338e-6827.45transient receptor potential cation channel subfam... [more]
trpm34.913e-6828.25transient receptor potential cation channel subfam... [more]
back to top
BLAST of Transient receptor potential cation channel subfamily M member 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064637.10.000e+0100.00SMESG000064637.1[more]
SMESG000064637.10.000e+0100.00SMESG000064637.1[more]
SMESG000064622.17.973e-2454.70SMESG000064622.1[more]
SMESG000064632.13.227e-1251.05SMESG000064632.1[more]
SMESG000064632.12.241e-1151.05SMESG000064632.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005926 ID=SMED30005926|Name=Transient receptor potential cation channel subfamily M member 6|organism=Schmidtea mediterranea sexual|type=transcript|length=4027bp
TCTAATATAGATATAAAAGCTGATACATATTTAAATTATTCTTGTTTTCT
TGATTTACACCGACTTCATGAATTATATTAAGTTTATTAAAAATTGGTAA
TATCAAAATGAATAAAACAGTTTCCACTACTGGCGATTCTTTTTCACAGA
ATGAATTGTTCGCACAAGCCGTTCACCAAGCTCGATTCAGGCTGACGGAT
GGTAGCAAAAACAGCAACGTTAATTTTAATGCAAATGATGAAAAAAACCA
TTTAAAGGGTTTCATCAAGAAGAAATTTCATTCGATTGACTGCCGGTTTT
TTGTTGAAAAATCTAAAGAACTATCAAACAAACAAACAAAGTGCTTATGT
GGAGAGCTGAAATCAGAACATAAAAAAGATAAGATTCCTTACAATAAAGT
CAATGATTGGAGCATTCATTCGTGTTTTGAAACTGTTCCAACTGAAAGTT
TTGGTAAAATAGAATTTATTGGAGAAGATGTTACAAATACCAAATTAACA
GAATTTGTCCGTCTTAGCCATGAAGATAATTTAGATGATGTCATGAAGCT
CATGTTTGATTACTGGAATATAGAAATTGGTACTCTCTGTATTTCTGTCC
TTGGAGGCACAAAAAATTTTAAAATGAAGAAAAAAGAAAAATACATTTTC
TACCAAGGACTTATTAAAGCTGTCAAAACCACAAATGCACTGATTCTTAC
ATCTGGCTTGAATCTTGGAATTACTCGGTTCGTTGGTGATGCCATTCAAA
ATGGTCAATGCGATCTTTATGATAAAGCAAAAGGCAACAATTCTCTATGC
TGTCTAGGAATTGCACCATGGGGATTTGTGAAAAATAAAAAGATATTAGA
ACATGCCAAAGGGACAATAATTAAGTATAAGGTTTCTAACGAAATTCTTT
TAACCGAGCCTGTCTCCTTAAATAAAAATCACACTCATTACTTATTTGTT
GATGAACATGAACGGTTTGACTATTCTAATTCGAAAGCCAGTGATTTTAG
AGAGGCGCTTGAAAAGAAATTAAGCCAAAGAACAAAAAACAAAGAACCGA
TTCCAGTGGTTCTACTATTAATCGAAGGAGAGTATGATGTTTTCTTTGAG
GCAAGTAAACGAATCAAGGAAAATGTTCCAATTGTGATTTGTGTTGGCAC
TGGGAGAGCTTCCGACTTGCTCGGAGAAGCTTTCCGTGAAATGCAAAAAT
ACCCAATCAAACAACTTCGACCAGATGGTGTACCAATGCTCCCGGAAATG
TATCGTAATAGTTTAAAAAAGAAACTAATTGACAAAAATGTTTCTAATCC
TGACAAAGTGAATGAGGCATTAAATTACATTGAAGAAATAATTCATAAAG
AATATTTAATAACATTATTTGACGTAAAAGAGGATCATGATCTGGAACTT
GCCATTTTATATTCCCTAATCAAACGAATGGATTTCACTAGCGATTCCAA
GTTAAACACTTTGTCAAGTCAATTGTCACTTTGTTTGAAATGGAACAGAG
TTGACATTGCAAAAGATAAAATCTTTTCAGGAGTGGTTTCTCTTTCAAAA
GAAAATTGGGCGTTGTTTCTAAAAGAATCTATCATTAACGGGAAATATGA
ATTTGTTGAGTTATTTTTACAAAATGGCGCCGTAATGAATGATTTCTTAA
CAACTACTACTTTGGAAAAATTATATGAAGATTGTCCGAGGTCATTTAAC
CTAAAAAGAACTATTTTTCATTTTCTCGGGAGAAATTTTTCCAATGGATT
GGGAGATGTCAAAGATTTACTGACGAAAATTTTTGGATATTATGAAGATC
AGTGTGCTATGTGTGATGAAGAAATAATTCATCCATTTCAAGAATTGTTT
ATTTGGTCGGTACTTATGGAGAATCATGAATGTGCAAATTATTTTTGGGA
AAAAACTGAAGAATCATTGTGTTTGGCATTAGTTGCAACAAAGATCTATA
AATGTTTGATGGAAATGTCTCCTTTGGACACTTCTAGAATAGAAACTTTA
TCCAACTGGAAAGATTATTTTGAAAATTTAGCAATTAAGCTTCTAGAGGA
ATGTCATGATGCTGATCAGGAAACTGCAGCATACATCATTGAAAAGGAAA
ATATCACATGGGGCGGTTATACTTGCTTAGAAATAGCTTATAAAGCAGAA
GATCAAAAATTTATTAGTTGTATGGTTTGTCAGAATTCCCTTGATTTCAC
CTGGCGTGCTGGATTCAATATTAATCTTTTCCAATGTATTTTATGTATAT
TCTTGCCATTTCTCATTTACAGGAGATCCTTTGACAACAGTTATGTAATA
CATGAATCCAAGAAGAAGGATGATACATCGAATAAAGGTTATTTCACCAA
CAGTGGCAATTGGCCGTTGAAATTGGTACAATTCTATCTGGCTCCTCAAA
CTAAATTTTGCATTCACAGTCTCGCCTTCTCCGTGTCGGTCTTTTATTTT
TCTTATGTGGTTTTGTTTGGAATGAAACGGATGCAGTTTACGATCCACGA
AATACTTTTTATAATATATTTGATATGCATGAATATTGAAAAGTTTGCGG
AGATGTTTCAATACAAGACCAATAAAGTTGGAGACCGAATTAAATACTGG
TGGAATTTTAATAATTGGAATAAAGTTGATATTTTAATGGTCATTTTGTC
AGCAATGGCAATGATATTAAGGTTTCCTTTGCTCTTGAAAAATTGGAATG
GGGACATTGTTATGATTTATAGGTGTTCAAAAACAATATACAGTTTAATA
GTTGGTTATTTTTATCTACGATTTTTGCGGCTCATAAGCGTTCACAAAAA
CCTTGGCCCAAAAATAGTTATGATTTCAAAAATGTTATACCAACTTATGT
TTTACATAATCATTATGCTGATTATTCTGCTGGCTTACGGAATTACTATG
CAAGGAGCTTATTTTCCTCAAAGAGATTTTAGTCTGAATACTCTACCGAA
TATAATGGACTACCCGTACTGGGCTATATTTGGGGAGATTACATTGAATC
AATTGATTTGCCTTGGTGTGATGACAAAACAACAAATTATAATATTTCAA
ATGAATGCCCTGAACTCAACTATTTTGTTCCGGTTTTGACAGCTATATAT
ATTTTTATTGCAGCTATATTATTATTAAATATCCTGACTGCAGTTTTCAA
CTACATTTTTCAAAGAATTCACAGAAATTCGATAGAAATCTGGAAATTCA
CAATGTTTTCTTTGGTTATGGAATATTATACGAAACCGCTTTTTCCGCTG
CCTTTTTCTATATTTGCTCACGCGTTTGACTTTTTCTACTCACTCTGTGG
AAACCAATGTGAAAAAACTGAAGAAAATGAAAAAAATCTCGACACCTTGA
GCAGAGATTCTCAAATTACTTTTTCTCCTCCGAAAAAAATGAAATCTTTC
AACTTTAGAAAACTAGCAATACCATTAGAATCAGAAATTGATAAATTAGT
TAAATATTTCGAAAACAACTCCCAAAAATGTGTGGTAAAAGAACTTGTTG
AAGAAAAAGAGCAATTAATTGAATCGGGAATGTCTCGACTGGAATCTCGA
TTAAAGGCAATGTCTACGATTATAAAATCTATTGAGTCGAAATTTGAAGA
TTCTGAAAATCCAGGAAATCACAATTCTGCAGAAATGGGCAATTGTTATT
ATCCAACACTGGATATTAGTGAATTTGAAGTCCAAAATCCAACAACATTT
ATTGAAGAAGACATCATTAATACAAATAAAGAAATAGTGTCACTGATTCA
TGATCTGAGAACTGGCCAGCTGTCGGTCTCTGCTCCTTCGTCAAATGCAA
ACGTCAGGTCCAGTTTCTTGATTCCTAGAATAATTGTCGATGAAAATTGT
GACAACAATTTTTCTGATCCAAATTCTGACTTGGGTGGAAATAAATTGAA
AAATTGGGTCACTGAGTTGATCAACATTGATTCAGAAACTGTTCTGGAAG
TCCAAAATCTGCAGAAAAAACTCTGTGATTTTCAAGATCATGTTGTGGAA
TCATTTACCAAAATCGAATCATTCTTG
back to top

protein sequence of SMED30005926-orf-1

>SMED30005926-orf-1 ID=SMED30005926-orf-1|Name=SMED30005926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MFSLVMEYYTKPLFPLPFSIFAHAFDFFYSLCGNQCEKTEENEKNLDTLS
RDSQITFSPPKKMKSFNFRKLAIPLESEIDKLVKYFENNSQKCVVKELVE
EKEQLIESGMSRLESRLKAMSTIIKSIESKFEDSENPGNHNSAEMGNCYY
PTLDISEFEVQNPTTFIEEDIINTNKEIVSLIHDLRTGQLSVSAPSSNAN
VRSSFLIPRIIVDENCDNNFSDPNSDLGGNKLKNWVTELINIDSETVLEV
QNLQKKLCDFQDHVVESFTKIESFL
back to top

protein sequence of SMED30005926-orf-2

>SMED30005926-orf-2 ID=SMED30005926-orf-2|Name=SMED30005926-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=994bp
MNKTVSTTGDSFSQNELFAQAVHQARFRLTDGSKNSNVNFNANDEKNHLK
GFIKKKFHSIDCRFFVEKSKELSNKQTKCLCGELKSEHKKDKIPYNKVND
WSIHSCFETVPTESFGKIEFIGEDVTNTKLTEFVRLSHEDNLDDVMKLMF
DYWNIEIGTLCISVLGGTKNFKMKKKEKYIFYQGLIKAVKTTNALILTSG
LNLGITRFVGDAIQNGQCDLYDKAKGNNSLCCLGIAPWGFVKNKKILEHA
KGTIIKYKVSNEILLTEPVSLNKNHTHYLFVDEHERFDYSNSKASDFREA
LEKKLSQRTKNKEPIPVVLLLIEGEYDVFFEASKRIKENVPIVICVGTGR
ASDLLGEAFREMQKYPIKQLRPDGVPMLPEMYRNSLKKKLIDKNVSNPDK
VNEALNYIEEIIHKEYLITLFDVKEDHDLELAILYSLIKRMDFTSDSKLN
TLSSQLSLCLKWNRVDIAKDKIFSGVVSLSKENWALFLKESIINGKYEFV
ELFLQNGAVMNDFLTTTTLEKLYEDCPRSFNLKRTIFHFLGRNFSNGLGD
VKDLLTKIFGYYEDQCAMCDEEIIHPFQELFIWSVLMENHECANYFWEKT
EESLCLALVATKIYKCLMEMSPLDTSRIETLSNWKDYFENLAIKLLEECH
DADQETAAYIIEKENITWGGYTCLEIAYKAEDQKFISCMVCQNSLDFTWR
AGFNINLFQCILCIFLPFLIYRRSFDNSYVIHESKKKDDTSNKGYFTNSG
NWPLKLVQFYLAPQTKFCIHSLAFSVSVFYFSYVVLFGMKRMQFTIHEIL
FIIYLICMNIEKFAEMFQYKTNKVGDRIKYWWNFNNWNKVDILMVILSAM
AMILRFPLLLKNWNGDIVMIYRCSKTIYSLIVGYFYLRFLRLISVHKNLG
PKIVMISKMLYQLMFYIIIMLIILLAYGITMQGAYFPQRDFSLNTLPNIM
DYPYWAIFGEITLNQLICLGVMTKQQIIIFQMNALNSTILFRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005216ion channel activity
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000204ovary
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR041491TRPM_SLOG
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR041491TRPM, SLOG domainPFAMPF18139LSDAT_eukcoord: 132..364
e-value: 1.2E-55
score: 188.7
NoneNo IPR availablePANTHERPTHR13800TRANSIENT RECEPTOR POTENTIAL CATION CHANNEL, SUBFAMILY M, MEMBER 6coord: 50..967
NoneNo IPR availableTMHMMTMhelixcoord: 767..789
NoneNo IPR availableTMHMMTMhelixcoord: 910..932
NoneNo IPR availableTMHMMTMhelixcoord: 699..721
NoneNo IPR availableTMHMMTMhelixcoord: 868..890
NoneNo IPR availableTMHMMTMhelixcoord: 952..971
NoneNo IPR availableTMHMMTMhelixcoord: 793..810
NoneNo IPR availableTMHMMTMhelixcoord: 831..853