SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1

Overview
NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
Smed IDSMED30005925
Length (bp)2316
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (SMED30005925) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (SMED30005925) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (SMED30005925) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 (SMED30005925) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005925

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005925h1SMcG0017108 SmedASXL_009066SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Match: SMARCAD1 (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:HGNC Symbol;Acc:HGNC:18398])

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 286/620 (46.13%), Postives = 415/620 (66.94%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +   +++ +L+ I  CS+ KA +I + RP+ + + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G  GPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++R+ I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    KS  +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ
Sbjct:  389 ILHFLQDASIGELTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNI--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQ 999          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Match: SMARCAD1 (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:HGNC Symbol;Acc:HGNC:18398])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 287/622 (46.14%), Postives = 416/622 (66.88%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +   +++ +L+ I  CS+ KA +I + RP+ + + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G  GPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++R+ I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    KS  +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++    K     + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ
Sbjct:  389 ILHFLQDASIGELTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNI--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLVTEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQ 1001          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Match: SMARCAD1 (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:HGNC Symbol;Acc:HGNC:18398])

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 287/622 (46.14%), Postives = 416/622 (66.88%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +   +++ +L+ I  CS+ KA +I + RP+ + + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G  GPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++R+ I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    KS  +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++    K     + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ
Sbjct:  389 ILHFLQDASIGELTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNI--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLVTEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQ 1001          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Match: SMARCAD1 (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:HGNC Symbol;Acc:HGNC:18398])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 274/576 (47.57%), Postives = 391/576 (67.88%), Query Frame = 2
Query:  431 KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G  GPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++R+ I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    KS  +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ
Sbjct:    3 KTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTML------TGNGGGWNI--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQ 569          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Match: HELLS (helicase, lymphoid specific [Source:HGNC Symbol;Acc:HGNC:4861])

HSP 1 Score: 301.212 bits (770), Expect = 8.167e-91
Identity = 181/538 (33.64%), Postives = 298/538 (55.39%), Query Frame = 2
Query:  617 QPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIF--LTENEGLKKIFQMSQKST-LKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER-----MKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISH-DMLLDEDHITSNTELIFE---DLSYMHDFEIHQNCLKYPHAV--------GKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQI 2158
            QP +    + ++ YQ+ G+ WLR++ E  +NGILADEMGLGKTVQ IA ++ ++  G+ GP ++  P STL NW  E  ++  ++  ++Y+G Q+ER+++   I +         V++T++ I++    DR  ++   + Y + DE H +KNM     + L  F    KLLLTGTPLQNN+ EL SLL+F++P++F  L   E    I  +S+ +  +       + +  + ++L PF LRRLKS V  ++P K   +   PLS+ Q I Y   + R       + + +   +          RK  N+S +  D + + + + IS     +D +       +  E   +L   +   + + C  +P+ +         ++K+ EEL+  S K   LD  LP   + G K+L+FSQ   +LDI+ ++   +   + RLDGS S  +R+  +  FN D ++ +F+++TRAGGLGINLT+A+ VII+D D+NP +D QA+DR HR+GQ + V V +L++  TID+ I+  A  K KLE++
Sbjct:   76 QPKHFTGGV-MRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPDIPTMLYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAM---RDRNALQHCYWKYLIVDEGHRIKNMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKI--DDFPNELEKLISQIQPEVDRERAVVEVNIPVESEVNLKLQNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDILMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKRKLEKL 607          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Match: M03C11.8 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:G5EDG2])

HSP 1 Score: 459.144 bits (1180), Expect = 3.400e-148
Identity = 258/628 (41.08%), Postives = 385/628 (61.31%), Query Frame = 2
Query:  320 DYFNKSTVDDLSQITGCSEIKALRIMKDRPYK----TIDDLKANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIA-QSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQK-----STLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQD--DAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDED-HITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE-QIT 2161
            ++FNK+  +DL Q    ++  A  ++ +RP++     +  +K        I+  +E L  +  L  +L  C   +            +V  D    TE  +  Q   +     L  YQLIG+ WL +++ ++LN IL DEMGLGKT+Q +AFLSYL   G  GPH+IVVP+ST+ NW  E HKWC +++++ YYG+QDER+ +R+R+  Q D  +V+LTTYN+  S  +D+ F K     Y ++DE HMLKN  S RY+ L   K K+K+LLTGTPLQNN++ELISL+ FV+  +F    E +  + Q  ++      T  ++ +  D+I + K +L P+ LRRLK+QVL  +P K+ +I  + + + Q  LY   +E ++  ++  D++G      ++M LR+ +NH LL R  YTD  L KI+  + L E  +     + + EDL+++ D +IHQ C ++     K+ L E+L LKS K + LD  LP   + GDK+LIFSQF  +LDI+E +L  +  +Y RLDG T   DRQ+ I++FN   D+ VF+L+TRAGGLGINLTSAN +II DID+NPYND+QAEDR HR+GQ + V V +L+SKGT++  +L +A +KL+LE Q+T
Sbjct:  294 EFFNKAKKEDLLQQARINDKIADFVLANRPFEIYGAMVAKMKGVTRGTNAIEAYMEFLEKRGILSRILDDCKDHAH-----------TVTKDFERCTEGPL--QLPLLKEGCTLHDYQLIGVKWLIMMYNKDLNAILGDEMGLGKTIQIVAFLSYLKQIGKTGPHLIVVPSSTIENWIGEFHKWCPSIQLLTYYGSQDERKHLRHRVKKQKDHIDVILTTYNMVTSKSDDKKFFKNFSLNYVIYDEGHMLKNCDSERYRGLMKVKGKKKILLTGTPLQNNLIELISLMYFVLSKVFNKYCEDITHLLQHFKQLGPALDTKNKALYQQDRIEEAKAILQPYILRRLKNQVLGSLPSKSEQIIEVEMKKPQKQLYDNIVEALQQSEESGDSYG------SLMRLRQAANHPLLRRSEYTDQKLDKIAKMLCLREKAYADKKWQHVSEDLAWLSDIKIHQLCERF-RCTSKFLLNEQLALKSGKCEQLDVMLPEIQKKGDKVLIFSQFTSMLDILEVYLNIRGYSYKRLDGQTPVLDRQEMINEFNLSKDLFVFLLSTRAGGLGINLTSANHIIIHDIDFNPYNDKQAEDRCHRMGQEKPVHVTRLVSKGTVEVGMLALAKKKLQLEKQVT 901          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Match: swsn-4 (SWI/SNF nucleosome remodeling complex component; SWI2/SNF2-like protein [Source:UniProtKB/TrEMBL;Acc:G5EF53])

HSP 1 Score: 329.331 bits (843), Expect = 8.397e-97
Identity = 192/520 (36.92%), Postives = 304/520 (58.46%), Query Frame = 2
Query:  632 NPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSN--FKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE----ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +P+L LK YQ+ G+ W+  ++  NLNGILADEMGLGKT+QTI+ ++YL++     GP++++VP STL+NW+ E  KW  ++  I+Y G +D RRR+  +I +  +FNVL+TTY   I  K     + K+ + Y + DE H LKN  + +   + N  F  + +LLLTGTPLQN + EL +LL+F++P+IF +     ++ F     +T ++   N ++    I ++ ++L PF LRRLK +V SQ+P KT  +     S  Q ++YR   + +      + G +  ++TV+ LRKL NH  L  +                                       I  +C  Y      +K+ E    +L+  + K++ LD  LP     G +IL+F Q   +++I E+FL +++ TYLRLDGST  D+R D + QFN  + D+ +F+L+TRAGGLG+NL +A+ VIIFD D+NP+ D QA+DR+HR+GQ ++V+V++LI+  +++E IL  A  KL +++
Sbjct:  528 DPNLLLKPYQIKGLEWMVSLYNNNLNGILADEMGLGKTIQTISLVTYLMEVKQNNGPYLVIVPLSTLSNWQNEFAKWAPSVTTIIYKGTKDARRRVEGQIRKG-AFNVLMTTYEYVIKEK---ALLGKIRWKYMIIDEGHRLKN-HNCKLTLMLNGFFHAQHRLLLTGTPLQNKLPELWALLNFLLPSIF-SSCGTFEQWFNAPFATTGEKVELNQEETMLIIRRLHKVLRPFLLRRLKKEVESQLPDKTEYVIKCDQSALQKVIYRHMQKGLLLDAKMSSGARSLMNTVVHLRKLCNHPFLFPN---------------------------------------IEDSCRAY------WKVNEVNGTDLMRVAGKLELLDRILPKLKATGHRILMFFQMTSMMNIFEDFLNFRRYTYLRLDGSTKPDERGDLLTQFNAPNSDLFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKKEVRVLRLITANSVEEKILAAARYKLNVDE 996          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Match: pqn-15 (Prion-like-(Q/N-rich)-domain-bearing protein [Source:UniProtKB/TrEMBL;Acc:P91094])

HSP 1 Score: 311.612 bits (797), Expect = 3.489e-90
Identity = 191/520 (36.73%), Postives = 293/520 (56.35%), Query Frame = 2
Query:  632 NPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNC-----LKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            NPSL LK YQ+ G+ W+  +   NLNGILADEMGLGKT+QTIAF++YL++     GP +++VP ST+ NW+ E  KW  N+ +I Y G + E R++   I +S  FNVLLTT+   I  K     + KL + Y + DE H LKN      + L + F+ +R+LL+TGTPLQN + EL +LL+F++P+IF +     ++ F     +T ++     ++    I ++ ++L PF LRRLK +V S++P K   +    +S  Q +LY+   + +        G K   +T++ LRKL NH  L                               FE+        + ++C      ++  AV  Y++       S K++ L   LP     G ++L+F Q   ++ IVE+FL    I YLRLDGST  D+R   +D+FN  + +  +F+L+TRAGGLG+NL +A+ VIIFD D+NP+ D QA+DR+HR+GQ  +V+V +LI+  +++E IL  A  KL +++
Sbjct: 1196 NPSLKLKPYQIKGLEWMVSLFNNNLNGILADEMGLGKTIQTIAFITYLMEIKKTSGPFLVIVPLSTVPNWQNEFDKWAANVHLIAYKGPK-ETRKVFEPIIKSGKFNVLLTTFEYVIREK---ALLGKLRWKYMIIDEGHRLKNQHCKLTEMLNTRFQCQRRLLITGTPLQNKLPELWALLNFLLPSIF-SSCSTFEQWFNAPFATTGEKVELTQEETMLIIRRLHKVLRPFLLRRLKKEVESELPDKMEFVVRCDMSALQKVLYKHMQKGLLLDGKTNTGSKSLRNTMIHLRKLCNHPFL-------------------------------FEN--------VEESCRNFWDARFISAVDLYRV-------SGKLELLSRILPKLQATGHRVLMFFQMTSMMTIVEDFLAGGTIQYLRLDGSTKPDERGALLDKFNAPNSEYFLFMLSTRAGGLGLNLQTADTVIIFDSDWNPHQDMQAQDRAHRIGQKAEVRVFRLITANSVEEKILAAARYKLNVDE 1664          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Match: isw-1 (Chromatin-remodeling complex ATPase chain isw-1 [Source:UniProtKB/Swiss-Prot;Acc:P41877])

HSP 1 Score: 300.056 bits (767), Expect = 2.587e-88
Identity = 190/526 (36.12%), Postives = 291/526 (55.32%), Query Frame = 2
Query:  605 LILDQ-PHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKG-PHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQV-LSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            +I D+ P YI  +  ++ YQ+ G+NWL  +    +NGILADEMGLGKT+QTI+ + Y+     K  PH+++VP STL NW  E  KWC ++  +V  G++  R ++   +     F+V  TTY + +  K     +KKL++ Y + DEAH +KN  S   + +     + +LL+TGTPLQNN+ EL +LL+F++P+IF T ++     F     S       N D + ++ ++L PF LRR+KS V  S +P K  ++  + LS+ Q   Y + + +  +  + A  V+ A  ++ +M LRK  NH  L                               F+       F   Q+                L+  S K+  LD+ L  F E G ++LIFSQF  +LD++E+F  ++   Y RLDGST  +DR + I+ +N  D  K +F+LTTRAGGLGINL +A+VVII+D D+NP +D QA DR+HR+GQ + V+V +LI++ T+DE I+  A  KL+L+ I +
Sbjct:  118 VIFDKSPFYIE-NGEMRDYQVRGLNWLASLQHNKINGILADEMGLGKTLQTISMIGYMKHYKNKASPHLVIVPKSTLQNWANEFKKWCPSINAVVLIGDEAARNQVLRDVILPQKFDVCCTTYEMMLKVKTQ---LKKLNWRYIIIDEAHRIKNEKSKLSETVRELNSENRLLITGTPLQNNLHELWALLNFLLPDIF-TSSDDFDSWFSNDAMSG------NTDLVQRLHKVLQPFLLRRIKSDVEKSLLPKKEVKV-YVGLSKMQREWYTKVLMKDIDIINGAGKVEKARLMNILMHLRKCVNHPYL-------------------------------FDGAEPGPPFTTDQH----------------LVDNSGKMVVLDKLLMKFKEQGSRVLIFSQFSRMLDLLEDFCWWRHYEYCRLDGSTPHEDRSNAIEAYNAPDSKKFIFMLTTRAGGLGINLATADVVIIYDSDWNPQSDLQAMDRAHRIGQKKQVRVFRLITENTVDERIIEKAEAKLRLDNIVI 584          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Match: chd-1 (Chromodomain and Helicase Domain protein [Source:UniProtKB/TrEMBL;Acc:O17909])

HSP 1 Score: 297.36 bits (760), Expect = 1.278e-85
Identity = 184/517 (35.59%), Postives = 285/517 (55.13%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDS-GLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGN---QDERRRMRYRIAQSDSF--NVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALST----VMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            L+ YQL G+NW+     +  + ILADEMGLGKT+Q+I+ L+ L     L GP+++VVP ST+  W++E  +W   + ++VY G+   +D  R+  + +  +     N +LTTY I +   +D+ F+  +D+   + DEAH LKN  S+ YK L+ F+   KLL+TGTPLQN++ EL +LL F+MP  F    E     F+ +   +      N   IS + + L PF LRR+K  V   +P KT +I  + ++  Q   Y+  +   KN ++ + GVK +++     VMEL+K  NH+ L R +                 DHI                         Y  A G+    ++LL  S K+  LD+ L    + G ++LIFSQ +M+LDI++E+L+ ++    RLDGS   D R+  +D +N        F+L+TRAGGLGINL +A+ VIIFD D+NP ND QA  R+HR+GQ + V + +L++KG+++E I+  A  KL L+ + +
Sbjct:  405 LRDYQLEGLNWMVYAWCKGNSSILADEMGLGKTIQSISLLASLFHRYDLAGPYLVVVPLSTMAAWQKEFAQWAPEMNLVVYMGDVVSRDMIRQYEWFVGGTKKMKINAILTTYEILL---KDKAFLSSIDWAALLVDEAHRLKNDESLLYKSLTQFRFNHKLLITGTPLQNSLKELWALLHFIMPEKFDCWEE-----FETAHNES------NHKGISALHKKLEPFLLRRVKKDVEKSLPPKTEQILRVDMTAHQKQFYKWIL--TKNYRELSKGVKGSINGFVNLVMELKKCCNHASLTRQY-----------------DHI-------------------------YDDAQGRL---QQLLKSSGKLILLDKLLCRLKDKGHRVLIFSQMVMMLDILQEYLQLRRFPSQRLDGSMRADLRKQALDHYNAPGSTDFAFLLSTRAGGLGINLATADTVIIFDSDWNPQNDLQAMSRAHRIGQTKTVNIYRLVTKGSVEEEIVERAKRKLVLDHLVI 860          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Match: Etl1 (gene:FBgn0032157 transcript:FBtr0079901)

HSP 1 Score: 506.908 bits (1304), Expect = 4.694e-168
Identity = 269/638 (42.16%), Postives = 399/638 (62.54%), Query Frame = 2
Query:  278 EESNSMKLDEINILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKAN----KISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGL-KGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSD--SFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQ---SSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDD--AFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            E S  M      +  + N++++ +L  +   SE KAL I+  RP+    DL+      ++S  L++   E++  +  +  +L KC     N++ R+         + ++     I++QP  ++  L L  YQ+IG+NWL ++H++ +NGILADEMGLGKT+Q IAFL+YL ++GL +  H+IVVP+STL+NWE E+ +WC  L V  Y+G+QDERRRMR R A+     F+VLLTTY+I  S+ E+R   +     Y +FDEAHMLKNM + RY  L     + ++LLTGTPLQNN++ELISLL FVMP  F    E +K +F    KS   Q   S F + +I + K ++ PF LRRLK  VL  +P K + +  +P+S  Q I Y + ++   N + +  +   +  ++ +ME+R+++NH LL+R ++TD+ LR  S  +        +N + IFE+L+ M DF+++Q   K  H     K+P+ L+  S K  YLD  LP     G ++L+FSQF M+LDIVEE+L+ ++  + RLDG+T+ + RQD I  FN DD I VF+L+T+AGG+GINLT+A+  +I DID+NPYND+QAEDR HR+GQ R V + +LIS+ TI+E IL  A EKLKLE+
Sbjct:  175 EMSTKMTGQRKKVFQFMNEASLIELQSVKTLSEKKALAIIDVRPFSDWSDLRQKLESIRMSGDLLNYAQELINKQNTVAAILSKC----NNMVSRL---------EKAISNGAGIVEQPKLLSSGLQLADYQIIGLNWLTVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLSQAAHLIVVPSSTLDNWEAEISRWCPELVVEKYHGSQDERRRMRGRFAKDGFTGFDVLLTTYHIVGSTPEERKMFRVCKLDYVIFDEAHMLKNMTTQRYANLITINARMRILLTGTPLQNNLLELISLLCFVMPKFFAKSIEDIKSLFAKKGKSDGDQDEVSQFQETQIQRAKRIMKPFVLRRLKKDVLKNLPKKLSLVEKVPMSSQQKIYYHELVDYYSNNKGEVCSSSERAGIAIMMEMRRIANHPLLMRHYFTDANLRGFSKRLANASSFKKTNEQYIFEELAVMSDFQVYQMMNK--HEFYDVKIPDNLICDSGKFLYLDTLLPKLKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNGDDSIFVFLLSTKAGGVGINLTAADTCVIHDIDFNPYNDKQAEDRCHRMGQQRPVTIYRLISESTIEEGILMAAEEKLKLEK 797          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087841)

HSP 1 Score: 309.686 bits (792), Expect = 1.548e-91
Identity = 190/520 (36.54%), Postives = 286/520 (55.00%), Query Frame = 2
Query:  620 PHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGV-KYALSTV-MELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            P YI  S  ++ YQ+ G+NW+  ++E  +NGILADEMGLGKT+QTI+ L YL       GPHI++VP STL NW  E  KWC +L+ +   G+QD R      +     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + L  FK   +LL+TGTPLQNN+ EL +LL+F++P++F   +E   + F  +       +   DD  I+++  +L PF LRRLK++V  ++  K      + LS+ Q   Y + + +  +  + A  V K  L  + M+LRK +NH  L               D        T++T L++                                  S K+  LD+ LP   E G ++LIFSQ   +LDI+E++  ++   Y RLDG T  +DR   I +FN D+  K +F+L+TRAGGLGINL +A+VVII+D D+NP  D QA DR+HR+GQ + V+V +LI++ T++E I+  A  KL+L+++ +
Sbjct:  120 PAYIK-SGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVF-NSSEDFDEWFNTN-------TCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLF--------------DGAEPGPPYTTDTHLVY---------------------------------NSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVI 580          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087842)

HSP 1 Score: 309.686 bits (792), Expect = 1.548e-91
Identity = 190/520 (36.54%), Postives = 286/520 (55.00%), Query Frame = 2
Query:  620 PHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGV-KYALSTV-MELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            P YI  S  ++ YQ+ G+NW+  ++E  +NGILADEMGLGKT+QTI+ L YL       GPHI++VP STL NW  E  KWC +L+ +   G+QD R      +     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + L  FK   +LL+TGTPLQNN+ EL +LL+F++P++F   +E   + F  +       +   DD  I+++  +L PF LRRLK++V  ++  K      + LS+ Q   Y + + +  +  + A  V K  L  + M+LRK +NH  L               D        T++T L++                                  S K+  LD+ LP   E G ++LIFSQ   +LDI+E++  ++   Y RLDG T  +DR   I +FN D+  K +F+L+TRAGGLGINL +A+VVII+D D+NP  D QA DR+HR+GQ + V+V +LI++ T++E I+  A  KL+L+++ +
Sbjct:  120 PAYIK-SGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVF-NSSEDFDEWFNTN-------TCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLF--------------DGAEPGPPYTTDTHLVY---------------------------------NSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVI 580          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Match: Iswi (gene:FBgn0011604 transcript:FBtr0087843)

HSP 1 Score: 309.686 bits (792), Expect = 1.548e-91
Identity = 190/520 (36.54%), Postives = 286/520 (55.00%), Query Frame = 2
Query:  620 PHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGV-KYALSTV-MELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            P YI  S  ++ YQ+ G+NW+  ++E  +NGILADEMGLGKT+QTI+ L YL       GPHI++VP STL NW  E  KWC +L+ +   G+QD R      +     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + L  FK   +LL+TGTPLQNN+ EL +LL+F++P++F   +E   + F  +       +   DD  I+++  +L PF LRRLK++V  ++  K      + LS+ Q   Y + + +  +  + A  V K  L  + M+LRK +NH  L               D        T++T L++                                  S K+  LD+ LP   E G ++LIFSQ   +LDI+E++  ++   Y RLDG T  +DR   I +FN D+  K +F+L+TRAGGLGINL +A+VVII+D D+NP  D QA DR+HR+GQ + V+V +LI++ T++E I+  A  KL+L+++ +
Sbjct:  120 PAYIK-SGEMRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTISLLGYLKHFKNQAGPHIVIVPKSTLQNWVNEFKKWCPSLRAVCLIGDQDTRNTFIRDVLMPGEWDVCVTSYEMCIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEILREFKTANRLLITGTPLQNNLHELWALLNFLLPDVF-NSSEDFDEWFNTN-------TCLGDDALITRLHAVLKPFLLRRLKAEVEKRLKPKKEMKIFVGLSKMQRDWYTKVLLKDIDVVNGAGKVEKMRLQNILMQLRKCTNHPYLF--------------DGAEPGPPYTTDTHLVY---------------------------------NSGKMAILDKLLPKLQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKFLFMLSTRAGGLGINLATADVVIIYDSDWNPQMDLQAMDRAHRIGQKKQVRVFRLITESTVEEKIVERAEVKLRLDKMVI 580          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Match: brm (gene:FBgn0000212 transcript:FBtr0075524)

HSP 1 Score: 301.212 bits (770), Expect = 1.150e-86
Identity = 182/517 (35.20%), Postives = 294/517 (56.87%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKR-KLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-------LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQ+ G+ WL  ++  NLNGILADEMGLGKT+QTI+ ++YL+D   + GP++I+VP STL NW  E  KW   + V+ Y G+   RR ++ ++ ++  FNVLLTTY   I   +D+  + K+ + Y + DE H +KN      + L+   I   +LLLTGTPLQN + EL +LL+F++P+IF + +   ++ F     +T ++   N+++    I ++ ++L PF LRRLK +V  Q+P K   I    +S  Q +LY+    +     D +   K+        ++T+++LRKL NH  + + H  +              DH   +  +   DL                     Y++       S K + LD  LP       ++L+F Q    + I+E++L ++Q  YLRLDG+T  +DR + + +FN +  D+ VF+L+TRAGGLG+NL +A+ V+IFD D+NP+ D QA+DR+HR+GQ  +V+V++L++  +++E IL  A  KL +++
Sbjct:  769 LKEYQIKGLEWLVSLYNNNLNGILADEMGLGKTIQTISLVTYLMDRKKVMGPYLIIVPLSTLPNWVLEFEKWAPAVGVVSYKGSPQGRRLLQNQM-RATKFNVLLTTYEYVI---KDKAVLAKIQWKYMIIDEGHRMKNHHCKLTQVLNTHYIAPYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCST-FEQWFNAPFATTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVEHQLPDKVEYIIKCDMSALQRVLYKHMQSKGVLLTDGSEKGKHGKGGAKALMNTIVQLRKLCNHPFMFQ-HIEEKYC-----------DHTGGHGVVSGPDL---------------------YRV-------SGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLDGTTKAEDRGELLRKFNAKGSDVFVFLLSTRAGGLGLNLQTADTVVIFDSDWNPHQDLQAQDRAHRIGQRNEVRVLRLMTVNSVEERILAAARYKLNMDE 1240          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Match: smarcad1b (Danio rerio SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 b (smarcad1b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353868])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 296/621 (47.67%), Postives = 419/621 (67.47%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +F  ++VD+L+ I GCS  KA +I + RP+KT  DL     + N +S +L+ GC E+L  ++ +  L+ KC +IS  L++ +  ++     D   G+    + QP  ++ +  LK YQLIG+NWL ++H+  L+GILADEMGLGKT+Q I+FL++L   G  GPH+I VP STL+NW REL+ WC + KV+VYYG+ D+R+ MRY I  Q   +N++++TYN++I +  DR    KL   Y VFDE H+LKNM S+RY++L     K +LLLTGTPLQNN++EL+SLL+F+MPN+F +    + K+F M  KS+ +QSSF  D+I+  K ++ PF LRR+KS+VL Q+P K  ++    +SE Q  LY   + ++K+  +   G K  L+ VM +LRK+SNH LL R  YT   L+ +S  ML +  H  ++  LI ED+  + DFE+H+ C +Y  A+ +Y+L  ++LL S K+  L + L    E GD++++FSQF M+LDI+E FL++ +  Y RLDGST   DR   IDQFN D DI VF+L+TRAGGLGINLTSANVVI+ DID NPYND+QAE R HR+GQ + VKVIKLISK +I++ +LRI   KLKLEQ
Sbjct:  322 ILCFFQSASVDELTLIAGCSLKKAQKITELRPFKTWKDLDDAMRRRNGLSAELLAGCREVLKEREVVKGLMSKCEEISVKLIQDVTQVM-----DKGPGS----MTQPEILSSTFQLKPYQLIGLNWLVLLHQNKLSGILADEMGLGKTIQAISFLAHLYQEGNHGPHLITVPASTLDNWVRELNLWCPSFKVLVYYGSADDRKYMRYEILNQIVEYNIIVSTYNLAIGNSSDRSLFCKLKLEYAVFDEGHLLKNMNSLRYRHLMAINAKYRLLLTGTPLQNNLLELMSLLNFIMPNMFSSSTSQIAKMFSM--KSSEEQSSFERDRITHAKLIMKPFILRRVKSEVLKQLPAKEEQVEFCAMSERQQELYSALLHKLKHSSN---GEKRELTNVMMQLRKMSNHPLLHRQFYTTEKLKAMSKLMLKEPSHRDADPALIKEDMEVLSDFELHRLCQQY-SALHEYQLNTDVLLDSGKLSLLTQLLNSLKEKGDRVVLFSQFTMMLDILEVFLRHHKHRYNRLDGSTPMSDRIGLIDQFNTDQDIFVFLLSTRAGGLGINLTSANVVILHDIDCNPYNDKQAEGRCHRVGQTKTVKVIKLISKDSIEDTMLRIGERKLKLEQ 927          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Match: smarcad1a (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 a [Source:NCBI gene;Acc:557875])

HSP 1 Score: 540.036 bits (1390), Expect = 3.434e-179
Identity = 280/621 (45.09%), Postives = 421/621 (67.79%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKA-----NKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQS-DSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            I+ +   +++D+L+ I+GCS  KA +I+  RP+ T  D+K      N +S  L+ GC  +L  +Q +++L+ +C +I+  + + +  +     I++ +G+    + QP  +N +L L++YQLIG+ WL ++H+  L+GILADEMGLGKT+Q IAFL++L + G+KGPH+I VP+STL+NW REL  WC +LKV++YYG+ ++R+ +R  I      FN++++TYN++I +  DR   +KL   Y VFDE HMLKNM S+RY++L     + +LLLTGTPLQNN++EL+SLL+F+MP++F +    + K+F  S +S+ ++SSF+ D+I+Q + ++ PF LRR+KS+VL ++P K  +I + P+S+AQ  LY    +R+K   +   G K  L  VM +LRK++NH LL R +YT   L  +S  ML +  H  ++  LI ED+  M DFE+H  C +Y    G ++L + L+L S K   L + L    E GD++++FSQF M+LDIVE  LK+    Y+RLDGST   +R   ID++N + +I VF+L+TRAGG GINL SAN VI+ DID NP+ND+QAEDR HR+GQ R V+VIKLISK +I++C+LR+  EKLKLEQ
Sbjct:  341 IIQFLQDASLDELALISGCSIKKAQKIISLRPFNTWKDVKEQFFKDNGLSIDLVHGCKVVLKERQVVLDLMGRCEKIAQKMTKDVTQV-----IEAGMGS----IKQPKVLNSNLKLQAYQLIGLKWLILLHQHKLSGILADEMGLGKTIQAIAFLAHLYEKGIKGPHLITVPSSTLDNWVRELGLWCPSLKVLIYYGSVEDRKYLRQDILTGLIDFNIIVSTYNLTIGNDHDRSLFRKLKLKYAVFDEGHMLKNMNSLRYRHLMTINAEHRLLLTGTPLQNNLLELMSLLNFIMPSMFSSSTSQISKMF--STRSSEEESSFHKDRIAQARLIMKPFILRRVKSEVLKELPPKMEKIEMCPMSDAQHKLYDILFKRLKKTPN---GDKRELCNVMMQLRKMANHPLLHRQYYTSDKLAAMSKAMLKEPTHYDADPALIQEDMEVMSDFELHNLCREYSSISG-FQLEKALILDSGKFALLTKTLAKLKEKGDRVVLFSQFTMMLDIVEILLKHLDHQYVRLDGSTPMAERIGLIDKYNTNPEIFVFLLSTRAGGQGINLASANTVILHDIDCNPFNDKQAEDRCHRMGQTRTVQVIKLISKDSIEDCMLRVGQEKLKLEQ 946          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Match: hells (helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-GENE-030131-9923])

HSP 1 Score: 305.449 bits (781), Expect = 3.320e-91
Identity = 191/565 (33.81%), Postives = 313/565 (55.40%), Query Frame = 2
Query:  572 VDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILY----RQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSI------LRKISHDMLLDEDHITSNTELI--FEDLSYMHDFEI------------HQNCLKYP--HAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            +D + ++  + +   QP      + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++   + V++Y+G Q ER  +  +I Q         V++T++ I++    DR F+++  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P++F  + +  +  F +S  ++  ++   +++    +  + ++L PF LRRLKS V  ++P K   +   PL+  Q   Y     +TI ++   + D       L+     ++ S   +   +  TDS+      L K+  ++    D   S+T ++  F  +    + ++            H   ++YP     G +K+ E+L+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   +   Y RLDGS S  DR + + +F+ D ++ +F+L+TRAGGLGINLTSA+ VIIFD D+NP  D QA+DR HR+GQ + V V +LI+  TIDE IL  A+ K KLE++ +
Sbjct:  209 LDPERTVNGQPVPAQQPQLFTGGV-MRWYQVEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMVEKKVLGPFLVVAPLSTLPNWISEFKRFTPEVSVLLYHGPQKERLDLVKKIRQHQGSLRMCPVVVTSFEIAM---RDRKFLQRFHWNYLIVDEGHRIKNLNCRLVQELKMLPTDNKLLLTGTPLQNNLSELWSLLNFLLPDVF-DDLKSFESWFDISTITSDAENIVANEREQNILHMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTNKQEAFYMAIVNKTIAKLLGQEKDE-SAPAPLTPSGRPKRRSRKVVNYTEPNTDSMKDLEKYLEKVQQEL----DSQASSTPVVNVFMPVDAQVNLKLQNILMLLKRCCNHAYLIEYPLDPTTGDFKIDEQLVEASGKFLILDRMLPELKKRGHKVLIFSQMTSILDILMDYCYLRGYEYSRLDGSMSYADRDENMKKFSSDPEVFLFLLSTRAGGLGINLTSADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLITANTIDEKILERASAKRKLEKMVI 763          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Match: hells (helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-GENE-030131-9923])

HSP 1 Score: 305.064 bits (780), Expect = 3.423e-91
Identity = 191/565 (33.81%), Postives = 313/565 (55.40%), Query Frame = 2
Query:  572 VDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILY----RQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSI------LRKISHDMLLDEDHITSNTELI--FEDLSYMHDFEI------------HQNCLKYP--HAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            +D + ++  + +   QP      + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++   + V++Y+G Q ER  +  +I Q         V++T++ I++    DR F+++  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P++F  + +  +  F +S  ++  ++   +++    +  + ++L PF LRRLKS V  ++P K   +   PL+  Q   Y     +TI ++   + D       L+     ++ S   +   +  TDS+      L K+  ++    D   S+T ++  F  +    + ++            H   ++YP     G +K+ E+L+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   +   Y RLDGS S  DR + + +F+ D ++ +F+L+TRAGGLGINLTSA+ VIIFD D+NP  D QA+DR HR+GQ + V V +LI+  TIDE IL  A+ K KLE++ +
Sbjct:  194 LDPERTVNGQPVPAQQPQLFTGGV-MRWYQVEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMVEKKVLGPFLVVAPLSTLPNWISEFKRFTPEVSVLLYHGPQKERLDLVKKIRQHQGSLRMCPVVVTSFEIAM---RDRKFLQRFHWNYLIVDEGHRIKNLNCRLVQELKMLPTDNKLLLTGTPLQNNLSELWSLLNFLLPDVF-DDLKSFESWFDISTITSDAENIVANEREQNILHMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTNKQEAFYMAIVNKTIAKLLGQEKDE-SAPAPLTPSGRPKRRSRKVVNYTEPNTDSMKDLEKYLEKVQQEL----DSQASSTPVVNVFMPVDAQVNLKLQNILMLLKRCCNHAYLIEYPLDPTTGDFKIDEQLVEASGKFLILDRMLPELKKRGHKVLIFSQMTSILDILMDYCYLRGYEYSRLDGSMSYADRDENMKKFSSDPEVFLFLLSTRAGGLGINLTSADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLITANTIDEKILERASAKRKLEKMVI 748          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Match: hells (helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-GENE-030131-9923])

HSP 1 Score: 305.064 bits (780), Expect = 3.423e-91
Identity = 191/565 (33.81%), Postives = 313/565 (55.40%), Query Frame = 2
Query:  572 VDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILY----RQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSI------LRKISHDMLLDEDHITSNTELI--FEDLSYMHDFEI------------HQNCLKYP--HAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            +D + ++  + +   QP      + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++   + V++Y+G Q ER  +  +I Q         V++T++ I++    DR F+++  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P++F  + +  +  F +S  ++  ++   +++    +  + ++L PF LRRLKS V  ++P K   +   PL+  Q   Y     +TI ++   + D       L+     ++ S   +   +  TDS+      L K+  ++    D   S+T ++  F  +    + ++            H   ++YP     G +K+ E+L+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   +   Y RLDGS S  DR + + +F+ D ++ +F+L+TRAGGLGINLTSA+ VIIFD D+NP  D QA+DR HR+GQ + V V +LI+  TIDE IL  A+ K KLE++ +
Sbjct:  194 LDPERTVNGQPVPAQQPQLFTGGV-MRWYQVEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMVEKKVLGPFLVVAPLSTLPNWISEFKRFTPEVSVLLYHGPQKERLDLVKKIRQHQGSLRMCPVVVTSFEIAM---RDRKFLQRFHWNYLIVDEGHRIKNLNCRLVQELKMLPTDNKLLLTGTPLQNNLSELWSLLNFLLPDVF-DDLKSFESWFDISTITSDAENIVANEREQNILHMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTNKQEAFYMAIVNKTIAKLLGQEKDE-SAPAPLTPSGRPKRRSRKVVNYTEPNTDSMKDLEKYLEKVQQEL----DSQASSTPVVNVFMPVDAQVNLKLQNILMLLKRCCNHAYLIEYPLDPTTGDFKIDEQLVEASGKFLILDRMLPELKKRGHKVLIFSQMTSILDILMDYCYLRGYEYSRLDGSMSYADRDENMKKFSSDPEVFLFLLSTRAGGLGINLTSADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLITANTIDEKILERASAKRKLEKMVI 748          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Match: larp4b (La ribonucleoprotein domain family member 4B [Source:Xenbase;Acc:XB-GENE-966333])

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 284/637 (44.58%), Postives = 427/637 (67.03%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT 2167
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L       +  G     ++QP  ++ +L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ   T
Sbjct:  352 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQL-------TEDGECGWNIEQPSIMSENLVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQDMTT 980          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Match: larp4b (La ribonucleoprotein domain family member 4B [Source:Xenbase;Acc:XB-GENE-966333])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 285/637 (44.74%), Postives = 425/637 (66.72%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT 2167
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L       +  G     ++QP  I   L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ   T
Sbjct:  352 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQL-------TEDGECGWNIEQPSII---LVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQDMTT 977          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Match: larp4b (La ribonucleoprotein domain family member 4B [Source:Xenbase;Acc:XB-GENE-966333])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 284/633 (44.87%), Postives = 424/633 (66.98%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L       +  G     ++QP  I   L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ
Sbjct:  139 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQL-------TEDGECGWNIEQPSII---LVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQ 760          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Match: larp4b (La ribonucleoprotein domain family member 4B [Source:Xenbase;Acc:XB-GENE-966333])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 285/633 (45.02%), Postives = 424/633 (66.98%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L      D   G     ++QP  I   L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ
Sbjct:  185 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQLTE----DGECGWN---IEQPSII---LVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQ 806          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Match: larp4b (La ribonucleoprotein domain family member 4B [Source:Xenbase;Acc:XB-GENE-966333])

HSP 1 Score: 549.28 bits (1414), Expect = 0.000e+0
Identity = 284/633 (44.87%), Postives = 424/633 (66.98%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L       +  G     ++QP  I   L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ
Sbjct:  118 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQL-------TEDGECGWNIEQPSII---LVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQ 739          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Match: Smarcad1 (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:MGI Symbol;Acc:MGI:95453])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 287/624 (45.99%), Postives = 412/624 (66.03%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQS-DSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT 2167
            IL +   S++ +L+ I  CS+ KA +I + RP+   + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N   +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G KGPH+IVVP ST++NW RE++ WC +L V+ YYG+Q+ER+++R+ I    + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    K   +QS +  ++I+  K+++ PF LRR+K +VL  +P K   I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  Y+L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ   T
Sbjct:  384 ILHFLQVSSIAELTLIPKCSQKKAQKITELRPFNNWEALFTKMSKINGLSEDLIWNCKTVIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNR--EQPSLLNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLFQEGNKGPHLIVVPASTIDNWLREVNLWCPSLNVLCYYGSQEERKQIRFNIHNKYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINARNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKPADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKLLPPKKDRIELCAMSEKQEQLYSGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHPLLHRQYYTPEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYQH-INSYQLDMDLILDSGKFRALGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTT 998          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Match: Hells (helicase, lymphoid specific [Source:MGI Symbol;Acc:MGI:106209])

HSP 1 Score: 301.982 bits (772), Expect = 4.531e-90
Identity = 183/543 (33.70%), Postives = 298/543 (54.88%), Query Frame = 2
Query:  611 LDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIF--LTENEGLKKIFQMSQKST-LKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER-----MKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISH-------DMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAV--------GKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQI 2158
              QP +    + ++ YQ+ G+ WLR++ E  +NGILADEMGLGKTVQ IA ++ ++  G+ GP ++  P STL NW  E  ++   +  ++Y+G +++RR++   I +         V++T++ I++    D+  ++   + Y + DE H +KNM     + L  F    KLLLTGTPLQNN+ EL SLL+F++P++F  L   E    I  +S+ +  +       + +  + ++L PF LRRLKS V  ++P K   +   PL   Q I Y   + R       +C+ +   +          RK  N+S L  D +   + + IS        +  + E +I   +E+   +L   +   + + C  +P+ +         ++K+ EEL+  S K   LD  LP   + G K+L+FSQ   +LDI+ ++   +   + RLDGS S  +R+  I  FN D D+ +F+++TRAGGLGINLT+A+ VII+D D+NP +D QA+DR HR+GQ + V V +L++  TID+ I+  A  K KLE++
Sbjct:  195 FQQPKHFTGGV-MRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPLSTLPNWMAEFKRFTPEIPTLLYHGTREDRRKLVKNIHKRQGTLQIHPVVVTSFEIAM---RDQNALQHCYWKYLIVDEGHRIKNMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSLSETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLCNKQEIFYTAIVNRTIANMFGSCEKETVELSPTGRPKRRSRKSINYSEL--DQFPSELEKLISQIQPEVNRERTVVEGNIPIESEV---NLKLRNIMMLLRKCCNHPYMIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLVFSQMTSMLDILMDYCHLRNFIFSRLDGSMSYSEREKNIYSFNTDPDVFLFLVSTRAGGLGINLTAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKRKLEKL 728          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Match: Chd1 (chromodomain helicase DNA binding protein 1 [Source:MGI Symbol;Acc:MGI:88393])

HSP 1 Score: 297.36 bits (760), Expect = 1.095e-86
Identity = 193/529 (36.48%), Postives = 291/529 (55.01%), Query Frame = 2
Query:  617 QPHYI--NPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLL-DSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMR---YRIAQSD--SFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALST----VMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            QP YI  +  L L+ YQL G+NWL     +  + ILADEMGLGKT+QTI+FL+YL  +  L GP ++VVP STL +W+RE+  W   +  +VY G+ + R  +R   +   Q+    FN+LLTTY I +   +D+ F+  L++ +   DEAH LKN  S+ YK L +FK   +LL+TGTPLQN++ EL SLL F+MP  F +        ++  ++   K   +     + + + L PF LRR+K  V   +P K  +I  + +S  Q   Y+  + R  N +  + G K + S     +MEL+K  NH  L++                        N E   +  +  H                       L+  S K+  LD+ L    E G+++LIFSQ + +LDI+ E+LKY+Q  + RLDGS   + R+  +D FN E  +   F+L+TRAGGLGINL SA+ V+IFD D+NP ND QA+ R+HR+GQ + V + +L++KG+++E IL  A +K+ L+ + +
Sbjct:  467 QPSYIGGHEGLELRDYQLNGLNWLAHSWCKGNSCILADEMGLGKTIQTISFLNYLFHEHQLYGPFLLVVPLSTLTSWQREIQTWASQMNAVVYLGDINSRNMIRTHEWMHPQTKRLKFNILLTTYEILL---KDKAFLGGLNWAFIGVDEAHRLKNDDSLLYKTLIDFKSNHRLLITGTPLQNSLKELWSLLHFIMPEKFSS--------WEDFEEEHGKGREYG---YASLHKELEPFLLRRVKKDVEKSLPAKVEQILRMEMSALQKQYYKWILTR--NYKALSKGSKGSTSGFLNIMMELKKCCNHCYLIKP---------------------PDNNEFYNKQEALQH-----------------------LIRSSGKLILLDKLLIRLRERGNRVLIFSQMVRMLDILAEYLKYRQFPFQRLDGSIKGELRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTKGSVEEDILERAKKKMVLDHLVI 935          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Match: Smarca5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:MGI Symbol;Acc:MGI:1935129])

HSP 1 Score: 295.049 bits (754), Expect = 6.484e-86
Identity = 188/522 (36.02%), Postives = 286/522 (54.79%), Query Frame = 2
Query:  614 DQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            D P Y+     L+ YQ+ G+NWL  ++E  +NGILADEMGLGKT+QTI+ L Y+     + GPH+++VP STL+NW  E  KW   L+ +   G++++R      +     ++V +T+Y + I  KE  +F KK ++ Y V DEAH +KN  S   + +  FK   +LLLTGTPLQNN+ EL SLL+F++P++F + ++     F  +       +   D K + ++  +L PF LRR+K+ V   +P K      + LS+ Q   Y + + +  +  + A  +     L+ +M+LRK  NH  L               D        T++          MH                       L+  S K+  LD+ LP   E G ++LIFSQ   VLDI+E++  ++   Y RLDG T  D+RQD I+ +NE +  K VF+L+TRAGGLGINL +A+VVI++D D+NP  D QA DR+HR+GQ + V+V + I+  T++E I+  A  KL+L+ I +
Sbjct:  169 DSPSYVKWG-KLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMSEFKKWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLI--KEKSVF-KKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADD-FDSWFDTN-------NCLGDQKLVERLHMVLRPFLLRRIKADVEKSLPPKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF--------------DGAEPGPPYTTD----------MH-----------------------LVTNSGKMVVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVI 631          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Match: Smarca2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:MGI Symbol;Acc:MGI:99603])

HSP 1 Score: 298.13 bits (762), Expect = 1.284e-85
Identity = 183/517 (35.40%), Postives = 291/517 (56.29%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-------LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQL G+ W+  ++  NLNGILADEMGLGKT+QTIA ++YL++   L GP++I+VP STL+NW  E  KW  ++  I Y G    RR +  ++ +S  FNVLLTTY   I   +D+  + K+ + Y + DE H +KN      + L +++   R++LLTGTPLQN + EL +LL+F++P IF + +   ++ F      T ++   N+++    I ++ ++L PF LRRLK +V SQ+P K   +    +S  Q ILYR    +     D +   K         ++T+M+LRK+ NH  + + H  +S    + +      + + +  EL                      A GK++L             LD  LP       ++L+F Q   ++ I+E++  ++   YLRLDG+T ++DR   + +FNE      +F+L+TRAGGLG+NL +A+ V+IFD D+NP+ D QA+DR+HR+GQ  +V+V++L +  +++E IL  A  KL ++Q
Sbjct:  735 LKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQL-RSGKFNVLLTTYEYII---KDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCST-FEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQ-HIEESFAEHLGYS-----NGVINGAELY--------------------RASGKFEL-------------LDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQ 1207          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Match: sp|E7F1C4|SMRDB_DANRE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio OX=7955 GN=smarcad1b PE=3 SV=1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 296/621 (47.67%), Postives = 419/621 (67.47%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +F  ++VD+L+ I GCS  KA +I + RP+KT  DL     + N +S +L+ GC E+L  ++ +  L+ KC +IS  L++ +  ++     D   G+    + QP  ++ +  LK YQLIG+NWL ++H+  L+GILADEMGLGKT+Q I+FL++L   G  GPH+I VP STL+NW REL+ WC + KV+VYYG+ D+R+ MRY I  Q   +N++++TYN++I +  DR    KL   Y VFDE H+LKNM S+RY++L     K +LLLTGTPLQNN++EL+SLL+F+MPN+F +    + K+F M  KS+ +QSSF  D+I+  K ++ PF LRR+KS+VL Q+P K  ++    +SE Q  LY   + ++K+  +   G K  L+ VM +LRK+SNH LL R  YT   L+ +S  ML +  H  ++  LI ED+  + DFE+H+ C +Y  A+ +Y+L  ++LL S K+  L + L    E GD++++FSQF M+LDI+E FL++ +  Y RLDGST   DR   IDQFN D DI VF+L+TRAGGLGINLTSANVVI+ DID NPYND+QAE R HR+GQ + VKVIKLISK +I++ +LRI   KLKLEQ
Sbjct:  322 ILCFFQSASVDELTLIAGCSLKKAQKITELRPFKTWKDLDDAMRRRNGLSAELLAGCREVLKEREVVKGLMSKCEEISVKLIQDVTQVM-----DKGPGS----MTQPEILSSTFQLKPYQLIGLNWLVLLHQNKLSGILADEMGLGKTIQAISFLAHLYQEGNHGPHLITVPASTLDNWVRELNLWCPSFKVLVYYGSADDRKYMRYEILNQIVEYNIIVSTYNLAIGNSSDRSLFCKLKLEYAVFDEGHLLKNMNSLRYRHLMAINAKYRLLLTGTPLQNNLLELMSLLNFIMPNMFSSSTSQIAKMFSM--KSSEEQSSFERDRITHAKLIMKPFILRRVKSEVLKQLPAKEEQVEFCAMSERQQELYSALLHKLKHSSN---GEKRELTNVMMQLRKMSNHPLLHRQFYTTEKLKAMSKLMLKEPSHRDADPALIKEDMEVLSDFELHRLCQQY-SALHEYQLNTDVLLDSGKLSLLTQLLNSLKEKGDRVVLFSQFTMMLDILEVFLRHHKHRYNRLDGSTPMSDRIGLIDQFNTDQDIFVFLLSTRAGGLGINLTSANVVILHDIDCNPYNDKQAEGRCHRVGQTKTVKVIKLISKDSIEDTMLRIGERKLKLEQ 927          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Match: sp|Q5FWR0|SMRCD_XENTR (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis OX=8364 GN=smarcad1 PE=2 SV=1)

HSP 1 Score: 553.518 bits (1425), Expect = 0.000e+0
Identity = 284/637 (44.58%), Postives = 427/637 (67.03%), Query Frame = 2
Query:  284 SNSMKLDE---INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT 2167
            S   KL+E     IL +   +++D+L  I  CS  KA +I + RP+ + + L     K+N +S+ LI  C  ++  ++ +++L+ KC +IS  L +++  L       +  G     ++QP  ++ +L LK YQ IG+NWL ++H+  +N ILADEMGLGKTVQ IAFL++L  +G  GPH++VVP ST++NW RE ++WC ++ +++YYG+Q+ER+ +RY I  +   FNV++TTYN +ISS EDR   ++L   + VFDE HMLKNM +IRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    +K++F    KST +Q+ F  ++I+  K+++ PF LRR+KS+VL Q+P K  +I    +S+ Q  LY   + ++K   D         + +M LRK++NH LL R +YT   LR +S  ML +  H  +N +LIFED+  M DFE+H+ C ++   + +YKL +EL+L S K   L++ L    + GD++++FSQF M+LDI+E FL++ Q  Y+RLDG T   +R   ID+FN D DI +F+L+T+AGGLGINLTSAN+VI+ DID NPYND+QAEDR HR+GQ ++VKVIKLI KGTI+E +L+I+ +KL+LEQ   T
Sbjct:  352 SGDEKLEEEYKTKILSFLQDASLDELYLIPHCSHKKAQKITELRPFSSWESLFEKMTKSNGLSEDLIWDCQTLIKEREVVMKLMNKCEEISRTLTKQVTQL-------TEDGECGWNIEQPSIMSENLVLKPYQKIGLNWLALLHKHKVNMILADEMGLGKTVQAIAFLAHLYVTGDSGPHLVVVPASTMDNWIREFNQWCPSMNILLYYGSQEERKHLRYDILNKVVEFNVIVTTYNCAISSAEDRSLFRRLKLNFAVFDEGHMLKNMSAIRYQHLMTLNARSRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIKRLFSSKAKSTDEQTIFEKERIAHAKQIMKPFILRRVKSEVLKQLPPKQDKIKFCQMSKKQEQLYSDLLNKLKKSIDATEKNSELCNVMMHLRKMANHPLLHRQYYTADRLRTMSKLMLKEPTHCDANPDLIFEDMEVMTDFELHRLCNEFT-TLSQYKLEKELILDSGKFNILEKLLSDIKKKGDRVVLFSQFTMMLDIIEVFLRHHQHRYVRLDGKTQISERIHLIDEFNTDMDIFIFLLSTKAGGLGINLTSANIVILHDIDCNPYNDKQAEDRCHRVGQTKEVKVIKLIGKGTIEESMLKISQQKLRLEQDMTT 980          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Match: sp|E1B7X9|SMRCD_BOVIN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus OX=9913 GN=SMARCAD1 PE=3 SV=2)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 286/620 (46.13%), Postives = 414/620 (66.77%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +   +++ +L+ I  CS+ KA +I + RP+ + + L     K N +S+ LI  C  ++  +  +I+L+ KC  IS  L +++  L        + G  N   +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G KGPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++RY I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    K   +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLI +GTI+E +L+I  +KLKLEQ
Sbjct:  391 ILHFLQDASIGELTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIKLMNKCEDISNKLTKQVTMLT------GNGGGWNT--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNKGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRYNIHSRYEEYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKPADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYMNLFNRLKKSINNMEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLIGQGTIEESMLKINQQKLKLEQ 1001          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Match: sp|D3Z9Z9|SMRCD_RAT (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus OX=10116 GN=Smarcad1 PE=1 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 286/624 (45.83%), Postives = 414/624 (66.35%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQS-DSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT 2167
            IL +   +++ +L+ I  CS+ KA +I++ RP+   + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G KGPH+IVVP ST++NW RE++ WC  L V+ YYG+Q+ER+++R+ I    + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L     + +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    K   +QS +  ++I+  K+++ PF LRR+K +VL  +P K  +I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  Y+L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ   T
Sbjct:  387 ILHFLQDASIGELTLIPKCSQKKAQKIIELRPFNNWETLFTKMSKINGLSEDLIWNCKTVIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNI--EQPSLLNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLFQEGNKGPHLIVVPASTIDNWLREVNLWCPTLNVLCYYGSQEERKQIRFNIHNKYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINARNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKPADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKLLPPKKDQIELCAMSEKQEQLYSGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYQH-INSYQLDMDLILDSGKFRTLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTT 1001          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Match: sp|Q9H4L7|SMRCD_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens OX=9606 GN=SMARCAD1 PE=1 SV=2)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 286/620 (46.13%), Postives = 415/620 (66.94%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +   +++ +L+ I  CS+ KA +I + RP+ + + L     K N +S+ LI  C  ++  +  +I L+ KC  IS  L +++  L        + G  N+  +QP  +N SL LK YQ +G+NWL +VH+  LNGILADEMGLGKT+Q IAFL+YL   G  GPH+IVVP ST++NW RE++ WC  LKV+ YYG+Q+ER+++R+ I ++ + +NV++TTYN +ISS +DR   ++L   Y +FDE HMLKNM SIRY++L       +LLLTGTP+QNN++EL+SLL+FVMP++F +    ++++F    KS  +QS +  ++I+  K+++ PF LRR+K +VL Q+P K   I L  +SE Q  LY     R+K   ++        + +M+LRK++NH LL R +YT   L+++S  ML +  H  +N +LIFED+  M DFE+H  C +Y H +  ++L  +L+L S K + L   L    + GD++++FSQF M+LDI+E  LK+ Q  YLRLDG T   +R   ID+FN D DI VF+L+T+AGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ ++V VIKLIS+GTI+E +L+I  +KLKLEQ
Sbjct:  389 ILHFLQDASIGELTLIPQCSQKKAQKITELRPFNSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLT------GNGGGWNI--EQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLYQEGNNGPHLIVVPASTIDNWLREVNLWCPTLKVLCYYGSQEERKQIRFNIHSRYEDYNVIVTTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQNNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILRRVKEEVLKQLPPKKDRIELCAMSEKQEQLYLGLFNRLKKSINNLEKNTEMCNVMMQLRKMANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRH-INNFQLDMDLILDSGKFRVLGCILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLDGKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQ 999          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Match: A0A1I8JF11 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 299/658 (45.44%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  275 HEESNSMKLDE--INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEG---LKKIFQMSQKSTLK---------------QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTI----ERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE-ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +E  +S++ DE    +LD+FN + + +L  I   S+ KA  + K RP++  DDL        + +  L+ G  E+L +++ ++ L+ KC  I+  L  R+  LL SV +DS+  T  + L QP  +NP LHLK YQ++G+NWLR++HEENL+ IL D+MGLGKT+Q IAFL+ LL+ G +GPH+++VP+STL NWERE+ KWC  L+ + Y+G+ +ER+  R  I   ++ F+VLLTTYNI+  + EDR  +K LDF YG+FDEAHMLKN  S RYK L NF++KR++LLTGTPLQNN+VEL+SLLSFV+P++F    +    LKK+F +  +S                  ++++  ++I   K ++ PF LRR K+QVL+Q+P KT E+ L+P++E Q   Y++ +     R +   +     + A++ +++LRK +NH LL R  YTDS+LR+++  ML D  H+ +N + I+EDL+ M+DFE+H+ C  YP  + +++L E E LL S K+  LD  LP     G ++ +FSQF+M+LDIV+ +L+ + I +LR+DGST   +RQ  +D+F ED  I VF+L+TRAGGLGINLT+A+ VII DID+NPYND+QAEDR HRLGQ R V+VI+L+S  +++  + RIA EKL+LE+
Sbjct: 2325 YENKHSVQSDEDKAAVLDFFNTAALSELMHIPTVSKKKAEILYKMRPFEDFDDLLNRLESHRQFNSSLVQGAREVLHMRRMVVYLMNKCEVITQKLESRVASLLDSVTLDSAGDTGGITL-QPAALNPDLHLKPYQMVGLNWLRLLHEENLSAILGDQMGLGKTIQIIAFLAQLLEEGDRGPHLVIVPSSTLVNWEREIRKWCPQLQAVTYHGSMEERKAARQAIYSGETQFHVLLTTYNIATGTLEDRAMMKNLDFEYGIFDEAHMLKNCQSRRYKMLMNFRVKRRILLTGTPLQNNLVELMSLLSFVIPDVFSASRQCADLLKKMFNLFSRSATTDESSAGSAMPAAAADRTTYEMERIQHAKRLMRPFFLRRTKAQVLTQLPAKTEEVMLVPMTERQRHEYQELVASLRRRFEGAGERGSSGEVAVNYILQLRKAANHCLLHRRVYTDSLLRQMASKMLKDPGHLRANEDYIYEDLAAMNDFELHRTCQMYP-VLAEHQLDEAEHLLLSGKLVALDSLLPELTAAGHRVALFSQFVMMLDIVQAYLQLRAIRFLRVDGSTPVGERQALLDRFAEDSSIPVFLLSTRAGGLGINLTAADTVIIHDIDFNPYNDKQAEDRCHRLGQERPVRVIRLLSADSVEVGVHRIACEKLRLEK 2980          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Match: A0A1I8GQ42 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 299/658 (45.44%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  275 HEESNSMKLDE--INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEG---LKKIFQMSQKSTLK---------------QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTI----ERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE-ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +E  +S++ DE    +LD+FN + + +L  I   S+ KA  + K RP++  DDL        + +  L+ G  E+L +++ ++ L+ KC  I+  L  R+  LL SV +DS+  T  + L QP  +NP LHLK YQ++G+NWLR++HEENL+ IL D+MGLGKT+Q IAFL+ LL+ G +GPH+++VP+STL NWERE+ KWC  L+ + Y+G+ +ER+  R  I   ++ F+VLLTTYNI+  + EDR  +K LDF YG+FDEAHMLKN  S RYK L NF++KR++LLTGTPLQNN+VEL+SLLSFV+P++F    +    LKK+F +  +S                  ++++  ++I   K ++ PF LRR K+QVL+Q+P KT E+ L+P++E Q   Y++ +     R +   +     + A++ +++LRK +NH LL R  YTDS+LR+++  ML D  H+ +N + I+EDL+ M+DFE+H+ C  YP  + +++L E E LL S K+  LD  LP     G ++ +FSQF+M+LDIV+ +L+ + I +LR+DGST   +RQ  +D+F ED  I VF+L+TRAGGLGINLT+A+ VII DID+NPYND+QAEDR HRLGQ R V+VI+L+S  +++  + RIA EKL+LE+
Sbjct:  614 YENKHSVQSDEDKAAVLDFFNTAALSELMHIPTVSKKKAEILYKMRPFEDFDDLLNRLESHRQFNSSLVQGAREVLHMRRMVVYLMNKCEVITQKLESRVASLLDSVTLDSAGDTGGITL-QPAALNPDLHLKPYQMVGLNWLRLLHEENLSAILGDQMGLGKTIQIIAFLAQLLEEGDRGPHLVIVPSSTLVNWEREIRKWCPQLQAVTYHGSMEERKAARQAIYSGETQFHVLLTTYNIATGTLEDRAMMKNLDFEYGIFDEAHMLKNCQSRRYKMLMNFRVKRRILLTGTPLQNNLVELMSLLSFVIPDVFSASRQCADLLKKMFNLFSRSATTDESSAGSAMPAAAADRTTYEMERIQHAKRLMRPFFLRRTKAQVLTQLPAKTEEVMLVPMTERQRHEYQELVASLRRRFEGAGERGSSGEVAVNYILQLRKAANHCLLHRRVYTDSLLRQMASKMLKDPGHLRANEDYIYEDLAAMNDFELHRTCQMYP-VLAEHQLDEAEHLLLSGKLVALDSLLPELTAAGHRVALFSQFVMMLDIVQAYLQLRAIRFLRVDGSTPVGERQALLDRFAEDSSIPVFLLSTRAGGLGINLTAADTVIIHDIDFNPYNDKQAEDRCHRLGQERPVRVIRLLSADSVEVGVHRIACEKLRLEK 1269          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Match: A0A267EFE2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005593g2 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 299/658 (45.44%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  275 HEESNSMKLDE--INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEG---LKKIFQMSQKSTLK---------------QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTI----ERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE-ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +E  +S++ DE    +LD+FN + + +L  I   S+ KA  + K RP++  DDL        + +  L+ G  E+L +++ ++ L+ KC  I+  L  R+  LL SV +DS+  T  + L QP  +NP LHLK YQ++G+NWLR++HEENL+ IL D+MGLGKT+Q IAFL+ LL+ G +GPH+++VP+STL NWERE+ KWC  L+ + Y+G+ +ER+  R  I   ++ F+VLLTTYNI+  + EDR  +K LDF YG+FDEAHMLKN  S RYK L NF++KR++LLTGTPLQNN+VEL+SLLSFV+P++F    +    LKK+F +  +S                  ++++  ++I   K ++ PF LRR K+QVL+Q+P KT E+ L+P++E Q   Y++ +     R +   +     + A++ +++LRK +NH LL R  YTDS+LR+++  ML D  H+ +N + I+EDL+ M+DFE+H+ C  YP  + +++L E E LL S K+  LD  LP     G ++ +FSQF+M+LDIV+ +L+ + I +LR+DGST   +RQ  +D+F ED  I VF+L+TRAGGLGINLT+A+ VII DID+NPYND+QAEDR HRLGQ R V+VI+L+S  +++  + RIA EKL+LE+
Sbjct:  532 YENKHSVQSDEDKAAVLDFFNTAALSELMHIPTVSKKKAEILYKMRPFEDFDDLLNRLESHRQFNSSLVQGAREVLHMRRMVVYLMNKCEVITQKLESRVASLLDSVTLDSAGDTGGITL-QPAALNPDLHLKPYQMVGLNWLRLLHEENLSAILGDQMGLGKTIQIIAFLAQLLEEGDRGPHLVIVPSSTLVNWEREIRKWCPQLQAVTYHGSMEERKAARQAIYSGETQFHVLLTTYNIATGTLEDRAMMKNLDFEYGIFDEAHMLKNCQSRRYKMLMNFRVKRRILLTGTPLQNNLVELMSLLSFVIPDVFSASRQCADLLKKMFNLFSRSATTDESSAGSAMPAAAADRTTYEMERIQHAKRLMRPFFLRRTKAQVLTQLPAKTEEVMLVPMTERQRHEYQELVASLRRRFEGAGERGSSGEVAVNYILQLRKAANHCLLHRRVYTDSLLRQMASKMLKDPGHLRANEDYIYEDLAAMNDFELHRTCQMYP-VLAEHQLDEAEHLLLSGKLVALDSLLPELTAAGHRVALFSQFVMMLDIVQAYLQLRAIRFLRVDGSTPVGERQALLDRFAEDSSIPVFLLSTRAGGLGINLTAADTVIIHDIDFNPYNDKQAEDRCHRLGQERPVRVIRLLSADSVEVGVHRIACEKLRLEK 1187          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Match: A0A267EXG9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032428g1 PE=4 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 299/658 (45.44%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  275 HEESNSMKLDE--INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEG---LKKIFQMSQKSTLK---------------QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTI----ERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE-ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +E  +S++ DE    +LD+FN + + +L  I   S+ KA  + K RP++  DDL        + +  L+ G  E+L +++ ++ L+ KC  I+  L  R+  LL SV +DS+  T  + L QP  +NP LHLK YQ++G+NWLR++HEENL+ IL D+MGLGKT+Q IAFL+ LL+ G +GPH+++VP+STL NWERE+ KWC  L+ + Y+G+ +ER+  R  I   ++ F+VLLTTYNI+  + EDR  +K LDF YG+FDEAHMLKN  S RYK L NF++KR++LLTGTPLQNN+VEL+SLLSFV+P++F    +    LKK+F +  +S                  ++++  ++I   K ++ PF LRR K+QVL+Q+P KT E+ L+P++E Q   Y++ +     R +   +     + A++ +++LRK +NH LL R  YTDS+LR+++  ML D  H+ +N + I+EDL+ M+DFE+H+ C  YP  + +++L E E LL S K+  LD  LP     G ++ +FSQF+M+LDIV+ +L+ + I +LR+DGST   +RQ  +D+F ED  I VF+L+TRAGGLGINLT+A+ VII DID+NPYND+QAEDR HRLGQ R V+VI+L+S  +++  + RIA EKL+LE+
Sbjct:   54 YENKHSVQSDEDKAAVLDFFNTAALSELMHIPTVSKKKAEILYKMRPFEDFDDLLNRLESHRQFNSSLVQGAREVLHMRRMVVYLMNKCEVITQKLESRVASLLDSVTLDSAGDTGGITL-QPAALNPDLHLKPYQMVGLNWLRLLHEENLSAILGDQMGLGKTIQIIAFLAQLLEEGDRGPHLVIVPSSTLVNWEREIRKWCPQLQAVTYHGSMEERKAARQAIYSGETQFHVLLTTYNIATGTLEDRAMMKNLDFEYGIFDEAHMLKNCQSRRYKMLMNFRVKRRILLTGTPLQNNLVELMSLLSFVIPDVFSASRQCADLLKKMFNLFSRSATTDESSAGSAMPAAAADRTTYEMERIQHAKRLMRPFFLRRTKAQVLTQLPAKTEEVMLVPMTERQRHEYQELVASLRRRFEGAGERGSSGEVAVNYILQLRKAANHCLLHRRVYTDSLLRQMASKMLKDPGHLRANEDYIYEDLAAMNDFELHRTCQMYP-VLAEHQLDEAEHLLLSGKLVALDSLLPELTAAGHRVALFSQFVMMLDIVQAYLQLRAIRFLRVDGSTPVGERQALLDRFAEDSSIPVFLLSTRAGGLGINLTAADTVIIHDIDFNPYNDKQAEDRCHRLGQERPVRVIRLLSADSVEVGVHRIACEKLRLEK 709          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Match: A0A267FB37 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005593g1 PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 299/658 (45.44%), Postives = 443/658 (67.33%), Query Frame = 2
Query:  275 HEESNSMKLDE--INILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEG---LKKIFQMSQKSTLK---------------QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTI----ERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPE-ELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +E  +S++ DE    +LD+FN + + +L  I   S+ KA  + K RP++  DDL        + +  L+ G  E+L +++ ++ L+ KC  I+  L  R+  LL SV +DS+  T  + L QP  +NP LHLK YQ++G+NWLR++HEENL+ IL D+MGLGKT+Q IAFL+ LL+ G +GPH+++VP+STL NWERE+ KWC  L+ + Y+G+ +ER+  R  I   ++ F+VLLTTYNI+  + EDR  +K LDF YG+FDEAHMLKN  S RYK L NF++KR++LLTGTPLQNN+VEL+SLLSFV+P++F    +    LKK+F +  +S                  ++++  ++I   K ++ PF LRR K+QVL+Q+P KT E+ L+P++E Q   Y++ +     R +   +     + A++ +++LRK +NH LL R  YTDS+LR+++  ML D  H+ +N + I+EDL+ M+DFE+H+ C  YP  + +++L E E LL S K+  LD  LP     G ++ +FSQF+M+LDIV+ +L+ + I +LR+DGST   +RQ  +D+F ED  I VF+L+TRAGGLGINLT+A+ VII DID+NPYND+QAEDR HRLGQ R V+VI+L+S  +++  + RIA EKL+LE+
Sbjct:   48 YENKHSVQSDEDKAAVLDFFNTAALSELMHIPTVSKKKAEILYKMRPFEDFDDLLNRLESHRQFNSSLVQGAREVLHMRRMVVYLMNKCEVITQKLESRVASLLDSVTLDSAGDTGGITL-QPAALNPDLHLKPYQMVGLNWLRLLHEENLSAILGDQMGLGKTIQIIAFLAQLLEEGDRGPHLVIVPSSTLVNWEREIRKWCPQLQAVTYHGSMEERKAARQAIYSGETQFHVLLTTYNIATGTLEDRAMMKNLDFEYGIFDEAHMLKNCQSRRYKMLMNFRVKRRILLTGTPLQNNLVELMSLLSFVIPDVFSASRQCADLLKKMFNLFSRSATTDESSAGSAMPAAAADRTTYEMERIQHAKRLMRPFFLRRTKAQVLTQLPAKTEEVMLVPMTERQRHEYQELVASLRRRFEGAGERGSSGEVAVNYILQLRKAANHCLLHRRVYTDSLLRQMASKMLKDPGHLRANEDYIYEDLAAMNDFELHRTCQMYP-VLAEHQLDEAEHLLLSGKLVALDSLLPELTAAGHRVALFSQFVMMLDIVQAYLQLRAIRFLRIDGSTPVGERQVLLDRFAEDSSIPVFLLSTRAGGLGINLTAADTVIIHDIDFNPYNDKQAEDRCHRLGQERPVRVIRLLSADSVEVGVHRIACEKLRLEK 703          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Match: smarcad1b (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Source:NCBI gene;Acc:103041701])

HSP 1 Score: 584.719 bits (1506), Expect = 0.000e+0
Identity = 306/621 (49.28%), Postives = 427/621 (68.76%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI-AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL++F  +TVD+L+ I GCS  KA +I++ RPYKT +DL     + N +S +L+ GC E+L  ++ +  L+ KC  IS  + E ++            G  +++  QPH +N + HLK YQLIG+NWL ++H+  L+GILADEMGLGKT+Q I+FL++L   G  GPH+I VP+STL+NW REL+ WC +LKV+VYYG+ +ERR +RY I  +   +N++++TYN++I +  DR   +KL   Y VFDE HMLKNM S+RY++L     K +LLLTGTPLQNN++EL+SLL+F+MPN+F +    + K+F M  KS+ +QSSF  D+I+  K ++ PF LRR+KS+VL Q+P K  +I   P+SE Q  LY +   R+KN +++    K  L+ VM +LRK++NH LL R +YT   L  +S  ML +  H  S+  LI ED++ M DFE+H+ C +Y   + +++L  +LL  S K+Q L + L    E GD++++FSQF M+LDI+E  LK+ +  Y+RLDGST   DR   IDQFN D DI VF+L+TRAGGLGINLTSANVVI+ DID NPYND+QAEDR HR+GQ R VKVIKLISK +I++ +LRI   KLKLEQ
Sbjct:  297 ILNFFQNATVDELTLIAGCSLKKAQKIVELRPYKTWNDLDEVLHRGNGLSNELLAGCREVLREREVVQGLMGKCEDISRRMTEVVQK-----------GQGSMV--QPHILNSAFHLKPYQLIGLNWLVLLHQNELSGILADEMGLGKTIQAISFLAHLYQEGNPGPHLITVPSSTLDNWVRELNLWCPSLKVLVYYGSIEERRCVRYEILNEMVDYNIIVSTYNLAIGNASDRSLFRKLKLEYAVFDEGHMLKNMSSLRYRHLMAINAKYRLLLTGTPLQNNLLELMSLLNFIMPNMFSSSTSQIAKMFAM--KSSEEQSSFERDRIAHAKLIMKPFILRRIKSEVLKQLPAKEEQIEFCPMSEKQQQLYDELFNRLKNARNEE---KRELTNVMMQLRKMANHPLLHRQYYTSQRLAAMSRLMLKEPSHRESDPALIQEDMALMSDFELHRLCQQYTVLI-EHQLDMDLLQDSGKLQLLIQILKDLKEKGDRVVLFSQFTMMLDILEVLLKHHKHRYIRLDGSTPMGDRIVLIDQFNTDQDIFVFLLSTRAGGLGINLTSANVVILHDIDCNPYNDKQAEDRCHRVGQTRTVKVIKLISKDSIEDAMLRIGQRKLKLEQ 898          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Match: smarcad1a (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 a [Source:NCBI gene;Acc:557875])

HSP 1 Score: 562.377 bits (1448), Expect = 0.000e+0
Identity = 291/621 (46.86%), Postives = 419/621 (67.47%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSD-SFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            +L +  ++++D+L+ I+GCS  KA +I++ RPYK   DL     +AN +S  L+DGC  +L  +Q L +L+ +C  I+  +         + D+   +      + QP  +NP   L+ YQLIG+ WL ++H+ NL+GILADEMGLGKT+Q I+FL+YLL  G KGPH+I VP+STL+NW REL  WC +LKVIVYYG+ ++R+ +R+ I      FNV+++TYN++I ++ DR   +KL   Y VFDE HMLKNM S+RY++L +   + +LLLTGTPLQNN++ELISLL+F+MP++F +    + K+F  S KS+ ++SSF+ ++I+Q K ++ PF LRR+KS+VL Q+P K  +I + P+S+AQ  LY +  +R K+  +   G K  L  VM +LRK++NH LL R +YT   L  +S  ML +  H  +N  LI ED+  M DFE+H  C ++  ++  Y+L ++LLL S K   L   L    E GD++++FSQF MVLDIVE  +++    Y+RLDGS    +R   ID++N D ++ VF+L+TRAGG GINL SAN VII DID NP+ND+QAEDR HR+GQ R V+VIKL+SK TI+ C+LR+  EKLKLEQ
Sbjct:   80 VLKFLQEASLDELALISGCSLKKAQKIIEMRPYKRWQDLNEPFSRANGLSMDLVDGCKLVLKERQVLKQLMGRCESIAKKM---------TKDVAGVIKNGTCSMKQPSVLNPKFKLQQYQLIGLKWLILLHQHNLSGILADEMGLGKTIQAISFLAYLLQKGNKGPHLITVPSSTLDNWVRELELWCPSLKVIVYYGSVEDRKYLRHDILNGRVDFNVIVSTYNLTIGNENDRSLFRKLKLNYAVFDEGHMLKNMNSLRYRHLMSINAEHRLLLTGTPLQNNLLELISLLNFIMPSMFSSSTSQISKMF--STKSSEEESSFHKERIAQAKLIMKPFILRRVKSEVLKQLPAKFEKIEMCPMSDAQQQLYEELWKRAKS--NAVPGQKRDLCNVMMQLRKMANHPLLHRQYYTTEKLAAMSQAMLKEPTHFDANPALIQEDMEVMSDFELHNLCKEFS-SISSYQLDKKLLLDSGKFSLLTRLLAELKEKGDRVVLFSQFTMVLDIVEVLMEHLGHEYVRLDGSIPMAERIGLIDKYNTDPEVFVFLLSTRAGGQGINLASANTVIIHDIDCNPFNDKQAEDRCHRMGQTRSVQVIKLVSKDTIEACMLRVGQEKLKLEQ 686          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Match: hells (helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-GENE-030131-9923])

HSP 1 Score: 296.59 bits (758), Expect = 1.940e-89
Identity = 186/561 (33.16%), Postives = 308/561 (54.90%), Query Frame = 2
Query:  572 VDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDER----RRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQ--------IKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKN---CQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTD--SILRKISHDMLLDEDHITSNTELIFE-----DLSYMHDFEIHQNC------LKYPHAVG--KYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            +D + ++  + +   QP +    + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++   + +++Y+G Q ER    + +R          V++T++ I++  ++++    +  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P++F    + LK        ST+  S  ++  +++        + ++L PF LRRLKS V  ++P K   +   PL+  Q   YR  ++R       Q+    +  +       RK+ ++S    +   D    + K+  +M   E H  S  ++        +L   +   + + C      ++YP   G  ++K+ E+L+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   +   Y RLDGS    DR++ + +F+ D ++ +F+L+TRAGGLGINLT+A+ VIIFD D+NP  D QA+DR HR+GQ + V V +LI+  TIDE IL  A+ K KLE++ +
Sbjct:   58 LDPERTVNGQPVPSQQPKHFTGGV-MRWYQVEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMVEKKVMGPFLVVAPLSTLPNWISEFKRFTPEVSIMLYHGPQKERLNLIKNIRKPQGPLHMCPVVVTSFEIAMIDRKEK---NRYQWKYLIVDEGHRIKNLNCRLVRELKALPTDNKLLLTGTPLQNNLSELWSLLNFLLPDVF----DDLKSFESWFDISTISGSDSDNIVVNEREQNILNMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTAKQEAFYRAIVDRTIAKVLGQEKVRILTPSGRPKRRSRKVVDYSEKSSESPQDLEKYIEKLQKEM---ESHFASVVDVQMPLDAQVNLKLQNVLMLLKRCCNHAYLIEYPLVPGTEEFKIDEQLVEASGKFMILDRMLPELKKRGHKVLIFSQMTSILDILMDYCYLRGYEYSRLDGSMKYSDREENMQKFSTDPEVFLFLLSTRAGGLGINLTAADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLITANTIDEKILERASAKRKLEKMVI 607          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 298.13 bits (762), Expect = 6.316e-88
Identity = 186/522 (35.63%), Postives = 282/522 (54.02%), Query Frame = 2
Query:  614 DQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            + P Y+     L+ YQ+ G+NW+  ++E  +NGILADEMGLGKT+QTIA L YL     + GPH+++VP STL+NW  E  +W   LK +   G++D R      +     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + +  FK   +LLLTGTPLQNN+ EL SLL+F++P++F + ++     F  +       +   D K + ++  +L PF LRR+K +V   +P K      L LS+ Q   Y + + +  +  + A  +     L+ +M+LRK  NH  L               D        T++T L+                                   S K+  LD+ LP   E G ++LIFSQ   VLDI+E++  ++   Y RLDG+T  +DR+  ID FN  +  K +F+L+TRAGGLGINL +A+VVI++D D+NP  D QA DR+HR+GQ + V+V +LI++ T++E I+  A  KL+L+ I +
Sbjct:   49 ESPSYVKNGT-LRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWDVCVTSYEMVIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASD-FDSWFDTN-------NCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF--------------DGAEPGPPYTTDTHLV---------------------------------TNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVI 511          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Match: smarca1 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5-like [Source:NCBI gene;Acc:103034185])

HSP 1 Score: 297.745 bits (761), Expect = 6.716e-88
Identity = 186/522 (35.63%), Postives = 282/522 (54.02%), Query Frame = 2
Query:  614 DQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            + P Y+     L+ YQ+ G+NW+  ++E  +NGILADEMGLGKT+QTIA L YL     + GPH+++VP STL+NW  E  +W   LK +   G++D R      +     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + +  FK   +LLLTGTPLQNN+ EL SLL+F++P++F + ++     F  +       +   D K + ++  +L PF LRR+K +V   +P K      L LS+ Q   Y + + +  +  + A  +     L+ +M+LRK  NH  L               D        T++T L+                                   S K+  LD+ LP   E G ++LIFSQ   VLDI+E++  ++   Y RLDG+T  +DR+  ID FN  +  K +F+L+TRAGGLGINL +A+VVI++D D+NP  D QA DR+HR+GQ + V+V +LI++ T++E I+  A  KL+L+ I +
Sbjct:   49 ESPSYVKNGT-LRDYQIRGLNWMISLYENGINGILADEMGLGKTLQTIALLGYLKHYRNIPGPHMVLVPKSTLHNWMNEFKRWVPTLKAVCLIGDKDARAAFIRDVMMPGEWDVCVTSYEMVIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSASD-FDSWFDTN-------NCLGDQKLVERLHAVLRPFLLRRIKQEVEKSLPPKKEVKIYLGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF--------------DGAEPGPPYTTDTHLV---------------------------------TNSGKMLALDKLLPKVQEQGSRVLIFSQMTRVLDILEDYCMWRGYEYCRLDGNTPHEDREKAIDTFNAPNSSKFIFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKPVRVFRLITENTVEERIVERAEMKLRLDSIVI 511          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Match: smarcad1a (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 a [Source:NCBI gene;Acc:557875])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 282/628 (44.90%), Postives = 428/628 (68.15%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKANKISQK-LIDGCLE---ILVIKQNLIELLKKCVQISANL---LERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSD-SFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQ-KSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ-ITMT 2167
            +L +F  +T+++L+ + GCS  KA  I++ RP+ + DDL     ++K L D   E   +L  ++ ++ L+  C  ++  L   + R+R   ++ D       E+ +L QP  +NP+  +KSYQL+G+NWL ++H++++NGILADEMGLGKTVQ I+FL++L++ G K PH+IVVP+STL+NW REL KWC +LKV++YYG+Q+ERR +R  I      FNV++TTY  +I++ +DR   ++L     VFDE HMLKNM S+RY+ L     +R+LLLTGTP+QNN++EL+SLL+FVMP +F    + +++IF  S  K+  +QS F  ++I Q K+++ PF LRRLK  VL  +P K+  + L P+SE Q+ LY Q ++  K   D  F      + +M+LRK++NH L+ R  YTD  +R++S  +L +  H  ++  L+ ED+  ++D E+H+ CL+YP ++  + LP   +L S K+Q+L   LP    NGD++++FSQF M+LDI+ +FL +   +YLR+DGST   +R   ID+FNE+ +I VF+L+TRAGGLG+NLTSAN VI+ D D NPYND+QAEDR HR+GQ R V+VI+LIS GT++E I++++  KL+L+Q IT+T
Sbjct:  366 VLAFFCDATIEELTLVHGCSNKKADLIVELRPFTSWDDLMRKLTTKKGLSDLVWESNTVLKEREVVLRLMAGCSDVAGGLESCVNRLRRKELADD-----DKEHRMLRQPPILNPACKMKSYQLVGLNWLALLHKQDVNGILADEMGLGKTVQAISFLAHLVELGEKDPHVIVVPSSTLDNWTRELQKWCPDLKVLLYYGSQEERRHLRTDILHKQVDFNVIVTTYQCAITNVDDRSLFRRLRINCAVFDEGHMLKNMASLRYQNLMTINARRRLLLTGTPVQNNLLELMSLLNFVMPRMFSNSTQEIRRIFASSSTKNGQRQSKFERERIHQAKQIMKPFILRRLKIDVLQHLPRKSERMELCPMSERQASLYTQLVQSFKKSSDGVFKTTELCNVMMQLRKMANHPLMHRHLYTDDKIRQMSQLILKEPTHYDADPALVQEDMEVLNDLELHRLCLQYP-SLASHSLPRSAILSSGKLQFLSTLLPALRSNGDRVVMFSQFTMILDILVQFLDHHGYSYLRMDGSTRVAERIGLIDRFNEEPEIFVFLLSTRAGGLGLNLTSANTVILHDPDMNPYNDQQAEDRCHRVGQTRPVQVIRLISAGTVEEAIVQMSKHKLQLQQDITVT 987          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Match: hells (helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-GENE-030131-9923])

HSP 1 Score: 303.523 bits (776), Expect = 1.670e-91
Identity = 184/553 (33.27%), Postives = 305/553 (55.15%), Query Frame = 2
Query:  617 QPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEM----LAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDE-DHITSNTELIFEDLSYMHDFEIH---------------------QNCLKYPH-------AVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            QP      + ++SYQ+ G+ WLRI+ E  +NGILADEMGLGKTVQ IA ++ +++S + GP ++V P STL NW  E  ++   + V++Y+G+ DERR +R +IA+         V++T+Y I++    D  +++ + + Y + DE H +KN+     + L  +  + KLLLTGTPLQNN+ EL SLL+F++P +F  + +  +  F +S      +     ++  Q+  M    L PF LRRLK+ V   +P K   +   PL+ AQ  LY+  + +              + +V+  +++              I ++I++  L D  + I +  ELI         ++I                      + C  +P+       A  ++K+ E L+  S K+  LD  LP   + G K+LIFSQ +++L+I+ ++   ++  + RLDGS    +R++ + +FN D D+ +F+L+TRAGGLGINLT+A+ VII+D D+NP  D QA+DR HR+GQ R V V ++++  T+D+ I+  A EK +LE++ +
Sbjct:  202 QPRLFTGGI-MRSYQVEGMEWLRILWENGINGILADEMGLGKTVQCIATVALMVESSVMGPFLVVAPLSTLPNWISEFKRFTPKIPVMLYHGSADERRLLRPKIAKKQGELNICPVIVTSYEIAMI---DAKYLQTVYWKYLMLDEGHRIKNLNCRLIRELKRYHSENKLLLTGTPLQNNLAELWSLLNFLLPEVF-DDLKSFETWFDVSNLCGSVEEIVAKEQQEQVLHMLHQILTPFLLRRLKADVTIDVPPKREVLVYAPLTAAQDRLYKAIVNK-------------TIRSVLNPKEVQPEQKTPNGRPRRHIRKEINYAELNDSVNSIDNLEELIARQAQEEEQYKIKVDWAPQKSELNVQLSNILMMLRKCCNHPYLIEYPLTADREFKVDENLVKSSGKLLLLDRILPELRQRGHKVLIFSQMVVMLEILMDYCYLRKFHFSRLDGSMKYSEREENMHKFNTDPDVFIFLLSTRAGGLGINLTAADTVIIYDSDWNPQVDLQAQDRCHRIGQTRPVVVYRMVTANTVDQRIVERAGEKRRLEKLVI 736          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Match: SMARCA5 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5 [Source:HGNC Symbol;Acc:HGNC:11101])

HSP 1 Score: 288.886 bits (738), Expect = 9.840e-88
Identity = 180/522 (34.48%), Postives = 280/522 (53.64%), Query Frame = 2
Query:  614 DQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK-ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA--LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            + P Y+     ++ YQ+ G+NWL  ++E  +NGILADEMGLGKT+QTI+ L Y+     + GPH+++VP STL+NW  E  +W  +L+ +   G++D R      I     ++V +T+Y + I  K      KK ++ Y V DEAH +KN  S   + +  FK   +LLLTGTPLQNN+ EL SLL+F++P++F    +     F  +       + F D + + ++  +L PF LRR+K+ V   +P K      + LS+ Q   Y + + +  +  + A  +     L+ +M+LRK  NH  L               D        T++T ++                                 + S K+  LD+ LP   E G ++LIFSQ   ++DI+E++  ++   Y RLDG T  +DRQ  I  FN  D  K VF+L+TRAGGLGINL +A+VVI++D D+NP  D QA DR+HR+GQ + V+V + I++ T+++ I+  A  KL+L+ I +
Sbjct:  102 ESPSYVKCGT-MRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWMAEFERWVPSLRAVCLIGDKDHRVSASQPIVPPIEWDVCVTSYEMIIREKS---VFKKFNWRYLVIDEAHRIKNEKSKLSEIVREFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVF-NSADTFTSWFDTN-------NCFGDQQLVERLHMVLRPFLLRRIKADVEKSLPPKKECKIYIGLSKMQREWYTKILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLF--------------DGAEPGPPYTTDTHIV---------------------------------INSGKMVVLDKLLPKLHEQGSRVLIFSQMTRMMDILEDYCMWRGYEYCRLDGQTPHEDRQVSIASFNAPDSSKFVFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAMDRAHRIGQKKVVRVFRFITESTVEDRIVERAEMKLRLDSIVI 564          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Match: SMARCA2 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 [Source:HGNC Symbol;Acc:HGNC:11098])

HSP 1 Score: 295.049 bits (754), Expect = 2.934e-85
Identity = 183/517 (35.40%), Postives = 291/517 (56.29%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-------LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQ+ G+ WL  ++  NLNGILADEMGLGKT+QTIA ++YL++   L GP +I+VP STL+NW  E  KW  ++  I Y G+   RR    ++ +S  FNVLLTTY   I   +D+  + KL + Y + DE H +KN      + L +++   R+LLLTGTPLQN + EL +LL+F++P IF + +   ++ F      T ++   N+++    I ++ ++L PF LRRLK +V SQ+P K   +    +S  Q +LYR    +     D +   K         ++T+++LRK++NH  +                                    + H  E     L +P+++ +     +L   S K + LD  LP    +  ++L+F Q   ++ I+E++  ++   YLRLDG+T ++DR + +  FNE +    +F+L+TRAGGLG+NL +A+ VIIFD D+NP+ D QA+DR+HR+GQ  +V+V++L +  +++E IL  A  KL ++Q
Sbjct:  736 LKMYQVQGLEWLVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPFLIIVPLSTLSNWMMEFDKWGPSVVKISYKGSPIARRAFMPQL-RSGKFNVLLTTYEYII---KDKHVLAKLRWKYMIVDEGHRMKNHHCKLTQVLNTHYIAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCST-FEQWFNAPFALTGEKVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKVLYRHMQAKGVLLTDGSEKDKKGKGGAKTLMNTIVQLRKIANHPYM------------------------------------FQHIEESFAEHLGFPNSIVQGA---DLFRASGKFELLDRILPKLRVSNHRVLLFCQMTSLMTIMEDYFAFRSFRYLRLDGTTKSEDRSNLLKTFNEPNSPYFIFLLSTRAGGLGLNLQAADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQ 1208          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004254.1 (pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 gene:ENSPMAG00000003871.1 transcript:ENSPMAT00000004254.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.559 bits (706), Expect = 2.311e-84
Identity = 174/493 (35.29%), Postives = 264/493 (53.55%), Query Frame = 2
Query:  713 ILADEMGLGKTVQTIAFLSYLLDS-GLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMR-----YRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER-MKNCQDDAFGVKYA-LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            ILADEMGLGKT+QTI+FLSY+  S  + GP ++VVP ST+ +W+RE   W   + V+VY G+   R  +R     ++  +   FN L+TTY I +   +D+  +  +++ +   DEAH LKN  S+ YK L  FK   +LL+TGTPLQN++ EL SLL F+MP+ F +  E    +            S +D+    + + L PF LRR+K  V   +P K  +I  + ++  Q   Y+  + R  K       G     L+ +MEL+K  NH  L++                L ED                               V K+   + L+  S K+  LD+ L    E G ++LIFSQ + +LDI+ ++L  K   + RLDGS   + R+  +D FN E  +   F+L+TRAGGLGINL SA+ V+IFD D+NP ND QA+ R+HR+GQ + V + +L+++GT++E I+  A +K+ L+ + +
Sbjct:    7 ILADEMGLGKTIQTISFLSYMFHSHQVYGPFLLVVPLSTVTSWQREFATWAPEMNVVVYLGDMSSRNVIREYEWIHQQTKKLKFNALVTTYEILL---KDKTVLGAVNWAFLGVDEAHRLKNDDSLLYKSLIEFKTNVRLLITGTPLQNSLKELWSLLHFIMPDKF-SAWEDFDAV----------HGSGSDNGYVSLHKELEPFLLRRVKKDVERSLPAKVEQILRVEMTPQQKHYYKWILTRNFKALSKGTRGSTSGFLNIMMELKKCCNHCYLIK----------------LPED-----------------------------ENVDKHDALQSLVRSSGKLILLDKLLCRLRETGHRVLIFSQMVRMLDILADYLAMKHFPFQRLDGSIKNEQRKQALDHFNAEGSEDFCFLLSTRAGGLGINLASADTVVIFDSDWNPQNDLQAQARAHRIGQKKQVNIYRLVTRGTVEEDIIERAKKKMVLDHLVI 440          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Match: FUN30 (Snf2p family member with ATP-dependent chromatin remodeling activity; has a role in silencing at the mating type locus, telomeres and centromeres; enriched at centromeres and is required for correct chromatin structure around centromeres, as well as at the boundary element of the silent HMR; recruited to DNA double-strand breaks (DSBs) where it promotes 5' strand resection of DSBs; potential Cdc28p substrate [Source:SGD;Acc:S000000017])

HSP 1 Score: 414.846 bits (1065), Expect = 1.226e-130
Identity = 232/534 (43.45%), Postives = 329/534 (61.61%), Query Frame = 2
Query:  617 QPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQ-SDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFN----DDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIE------RM---KNCQDDAFGVKYALST-----VMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHIT--SNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENL-PIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE 2152
            +P  ++P + LK YQ  GINWL ++++  ++ ILAD+MGLGKT Q I+F +YL      GPH++VVP+STL NW RE  K+   LK+  YYG+  ER  +R  + + +  ++V++TTYN++  +K D  F+K  +F   V+DE HMLKN  S R+  L   +   +LLLTGTPLQNN+ EL+SLL F+MPN+F+++ E    IF+   K+T    + N     + I++ K M+ PF LRR K QVL  +P K T I    L+  Q  +Y + I+      RM        DA       S+     +M LRK S H LL R+ Y D I+ K+S D +LDE       N E I ED+SYM DFE+H+ C  +P+ + KY+L  +  ++S KI  L + L  I ++  +K+LIFS F  VLDI+E  L      +LRLDGST  +DRQ  ID+F ED DI +FIL+T+AGG GINL  AN VIIFD  +NP++DRQA DR+HR+GQ ++V +  LI+K +I+E I ++A  KL L+
Sbjct:  562 KPRLLSPEISLKDYQQTGINWLNLLYQNKMSCILADDMGLGKTCQVISFFAYLKQINEPGPHLVVVPSSTLENWLREFQKFAPALKIEPYYGSLQEREELRDILERNAGKYDVIVTTYNLAAGNKYDVSFLKNRNFNVVVYDEGHMLKNSTSERFAKLMKIRANFRLLLTGTPLQNNLKELMSLLEFIMPNLFISKKESFDAIFKQRAKTTDDNKNHNPLLAQEAITRAKTMMKPFILRRRKDQVLKHLPPKHTHIQYCELNAIQKKIYDKEIQIVLEHKRMIKDGELPKDAKEKSKLQSSSSKNLIMALRKASLHPLLFRNIYNDKIITKMS-DAILDEPAYAENGNKEYIKEDMSYMTDFELHKLCCNFPNTLSKYQLHNDEWMQSGKIDALKKLLKTIIVDKQEKVLIFSLFTQVLDILEMVLSTLDYKFLRLDGSTQVNDRQLLIDKFYEDKDIPIFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRAHRVGQTKEVNITTLITKDSIEEKIHQLAKNKLALD 1094          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Match: ISW2 (ATP-dependent DNA translocase involved in chromatin remodeling; ATPase component that, with Itc1p, forms a complex required for repression of a-specific genes, INO1, and early meiotic genes during mitotic growth; the Isw2 complex exhibits basal levels of chromatin binding throughout the genome as well as target-specific chromatin interactions; targeted by Ume6p- and Sua7p-dependent DNA looping to many loci genome-wide [Source:SGD;Acc:S000005831])

HSP 1 Score: 308.916 bits (790), Expect = 1.324e-91
Identity = 192/529 (36.29%), Postives = 294/529 (55.58%), Query Frame = 2
Query:  605 LILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYL-LDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK---ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA----LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
             + + P ++  S  L+ YQ+ G+NWL  +HE  L+GILADEMGLGKT+QTI+FL YL     ++GP +I+VP STL+NW RE  KW  N+ V+V +G++D R  +   I     F+VL+T+Y + I  K     +K+L + Y V DEAH +KN  S   + +  F  K +LL+TGTPLQNN+ EL +LL+F++P+IF     G  ++F        +Q++   D+   I Q+  +L PF LRR+K+ V   +  K      + +++ Q   Y+  +E+  +  + A G +      L+ VM+LRK  NH  L                               FE                       Y   E L+  S K+  LD+ L    E G ++LIFSQ   +LDI+E++  ++   Y R+DGSTS ++R + ID++N+ +  K VF+LTTRAGGLGINL +A+ VI+FD D+NP  D QA DR+HR+GQ + V V + +++  I+E ++  A +KL+L+Q+ +
Sbjct:  171 FVSESPSFVK-SGKLRDYQVQGLNWLISLHENKLSGILADEMGLGKTLQTISFLGYLRYVKQIEGPFLIIVPKSTLDNWRREFLKWTPNVNVLVLHGDKDTRADIVRNIILEARFDVLITSYEMVIREKN---ALKRLAWQYIVIDEAHRIKNEQSALSQIIRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDIF-----GDSELFD----EWFEQNNSEQDQEIVIQQLHSVLNPFLLRRVKADVEKSLLPKIETNVYVGMTDMQIQWYKSLLEKDIDAVNGAVGKREGKTRLLNIVMQLRKCCNHPYL-------------------------------FEG----------------AEPGPPYTTDEHLIFNSGKMIILDKLLKRLKEKGSRVLIFSQMSRLLDILEDYCYFRDFEYCRIDGSTSHEERIEAIDEYNKPNSEKFVFLLTTRAGGLGINLVTADTVILFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTENAIEEKVIERAAQKLRLDQLVI 639          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Match: CHD1 (Chromatin remodeler that regulates various aspects of transcription; acts in in conjunction with Isw1b to regulate chromatin structure and maintain chromatin integrity during transcription elongation by RNAP II by preventing trans-histone exchange over coding regions; contains a chromo domain, a helicase domain and a DNA-binding domain; component of both the SAGA and SLIK complexes [Source:SGD;Acc:S000000966])

HSP 1 Score: 304.294 bits (778), Expect = 7.662e-89
Identity = 195/525 (37.14%), Postives = 287/525 (54.67%), Query Frame = 2
Query:  617 QPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLK-GPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMR---------YRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNC-QDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE 2152
            QP +I     L+ +QL GINW+  +  +  NGILADEMGLGKTVQT+AF+S+L+ +  + GPHIIVVP ST+  W     KW  +L  I Y GNQ  R  +R          +  ++  FNVLLTTY   +   +DR  +  + + +   DEAH LKN  S  Y+ L++FK+  ++L+TGTPLQNN+ EL +L++F+MP  F  + E     F+        Q    ++ I  +   + PF LRRLK  V   +P KT  I  + LS+ Q+  Y+  + +  +     A G  ++L  +M EL+K SNH  L  D+  + +L+K     +  E                        N L+             L++ S K+  LD+ L    ++G ++LIFSQ + +LDI+ ++L  K I + RLDG+  +  R+  ID FN  D    VF+L+TRAGGLGINL +A+ V+IFD D+NP  D QA  R+HR+GQ   V V +L+SK T++E +L  A +K+ LE
Sbjct:  367 QPPFIKGG-ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYIL---KDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPLQNNIKELAALVNFLMPGRFTIDQE---IDFE-------NQDEEQEEYIHDLHRRIQPFILRRLKKDVEKSLPSKTERILRVELSDVQTEYYKNILTKNYSALTAGAKGGHFSLLNIMNELKKASNHPYLF-DNAEERVLQKFGDGKMTRE------------------------NVLR------------GLIMSSGKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLSIKGINFQRLDGTVPSAQRRISIDHFNSPDSNDFVFLLSTRAGGLGINLMTADTVVIFDSDWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILE 840          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Match: SNF2 (Catalytic subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; contains DNA-stimulated ATPase activity; functions interdependently in transcriptional activation with Snf5p and Snf6p [Source:SGD;Acc:S000005816])

HSP 1 Score: 300.827 bits (769), Expect = 2.277e-87
Identity = 180/522 (34.48%), Postives = 293/522 (56.13%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMS-IRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLT------------ENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMK-----NCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE 2152
            LK YQ+ G+ W+  +   +LNGILADEMGLGKT+QTI+ L+YL +   ++GP++++VP STL+NW  E  KW   L+ I + G+ +ER+  + +I ++  F+V+LTT+   I   ++R  + K+ + + + DE H +KN  S +     +++    +L+LTGTPLQNN+ EL +LL+FV+P IF +             N G +   ++S++ TL         I ++ ++L PF LRRLK  V  ++P K  ++    +S  Q I+Y+Q ++  +            G++   + +M+L+K+ NH  +  +                 ED I    E   +D+  +                GK++L             LD  LP     G ++LIF Q   ++DI+E+FL+Y  I YLRLDG T +D+R + +  FN  D +   FIL+TRAGGLG+NL +A+ VIIFD D+NP+ D QA+DR+HR+GQ  +V++++LI+  +++E IL  A +KL ++
Sbjct:  767 LKDYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIRGPYLVIVPLSTLSNWSSEFAKWAPTLRTISFKGSPNERKAKQAKI-RAGEFDVVLTTFEYII---KERALLSKVKWVHMIIDEGHRMKNAQSKLSLTLNTHYHADYRLILTGTPLQNNLPELWALLNFVLPKIFNSVKSFDEWFNTPFANTGGQDKIELSEEETLL-------VIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVVKCKMSALQQIMYQQMLKYRRLFIGDQNNKKMVGLRGFNNQIMQLKKICNHPFVFEEV----------------EDQINPTRE-TNDDIWRV---------------AGKFEL-------------LDRILPKLKATGHRVLIFFQMTQIMDIMEDFLRYINIKYLRLDGHTKSDERSELLRLFNAPDSEYLCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTNSVEEVILERAYKKLDID 1232          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Match: STH1 (ATPase component of the RSC chromatin remodeling complex; required for expression of early meiotic genes; promotes base excision repair in chromatin; essential helicase-related protein homologous to Snf2p [Source:SGD;Acc:S000001388])

HSP 1 Score: 293.893 bits (751), Expect = 2.353e-85
Identity = 182/517 (35.20%), Postives = 294/517 (56.87%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLK-GPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMS-IRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK------ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER----MKNCQDDAF--GVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNE-DDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE 2152
            LK YQL G+ W+  ++  +LNGILADEMGLGKT+Q+I+ ++YL +     GP +++VP ST+ NW  E  KW  +L  I+Y G  ++R  ++++I +  +F+VLLTTY   I   +D+  + K D+ + + DE H +KN  S + +     ++ + +L+LTGTPLQNN+ EL +LL+FV+P IF    +  +  F     +T  Q      +      I ++ ++L PF LRRLK +V   +P K  ++    LS  Q  LY+Q ++     +    + A   G+K   + +M+LRK+ NH  +      D +   ++            N++L+F                      GK++L             LD  LP F  +G ++L+F Q   V+DI+E+FL+ K + Y+RLDGST T++R + ++ FN  D D   F+L+TRAGGLG+NL +A+ VIIFD D+NP+ D QA+DR+HR+GQ  +V++++LI+  +++E IL  A +KL ++
Sbjct:  470 LKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQI-RVGNFDVLLTTYEYII---KDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIF-NSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVF-----DEVEGVVNPSR--------GNSDLLF-------------------RVAGKFEL-------------LDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDID 936          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Match: EDO41059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5B2])

HSP 1 Score: 505.368 bits (1300), Expect = 8.840e-171
Identity = 270/620 (43.55%), Postives = 405/620 (65.32%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKT----IDDLKANK-ISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS-FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +F   ++ +LS I  CS  KA +I+  +P+K+    ++ L++ K ++ +++  C  +L  + ++ +L++ C +IS  + E    LL  V +   L T    +    +I     LK YQL G+NWL ++HE+ +NGILADEMGLGKTVQ I+F+++L++ G  GPH+I+VP+STLNNW +E  +WC  ++  +YYG+Q+ER  +R  I    S F V++TTYN++    ED  F+++L  +Y VFDE HMLKNM S RY  L+  + KR+LLLTGTP+QN+++EL+SLLSFVMP IF    +GLK +F   +      S +  ++  Q K+++ PF LRRLK  VL ++P K   +    LS +Q  L+ + + +  N   DA   +   + +M LR +SNH LL+R++Y D  LR+++     D ++  S  +L+ ED++ M DFE+H+ CL+   ++  Y L EELL  S K + L+  LP   +NGD++L+FSQF +V+DI+E +L++    Y RLDG T   +RQ  ID FN D DI +F+L+T+AGGLGINLTSANVVI+ DID+NPYND+QAEDR HR+GQ RDV V +LI+K T+++ +L+ AN KLKLE+
Sbjct:    4 ILSFFQTCSLSELSTIPECSRKKAQKILSLKPFKSWHNMVNKLESTKGLTSQILWNCDLLLKERTSVDKLMQNCNKISLKIQEL---LLEPVGLGGRLTTS---IPMAIFIRAK-SLKPYQLTGLNWLILMHEQGVNGILADEMGLGKTVQAISFIAHLIEKGDDGPHLIIVPSSTLNNWVKEFKQWCPTIRFTLYYGSQEERTYLREEILDEHSDFKVIITTYNMATGGFEDTSFLRQLRPHYVVFDEGHMLKNMQSQRYLKLTRIRAKRRLLLTGTPMQNDLLELMSLLSFVMPTIFDGRTDGLKLLFGNKKLDRDADSGYIKERAEQAKKIMKPFVLRRLKKDVLQELPQKHEHVIHCELSTSQKDLHSKLMLKCYNEYRDASKSRDYKNILMALRMMSNHPLLLRNYYKDETLREMAVKYCRDIENRGSEVDLVCEDMTVMSDFELHRLCLE-QRSLSSYVLGEELLYDSGKFERLNAMLPEMKDNGDRVLLFSQFTLVMDIIEVYLQHCGYRYFRLDGQTPVVERQPMIDNFNSDPDIFLFLLSTKAGGLGINLTSANVVILHDIDFNPYNDKQAEDRCHRVGQTRDVHVYRLIAKDTVEDNMLKCANSKLKLEK 615          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Match: EDO46669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD7])

HSP 1 Score: 306.22 bits (783), Expect = 1.774e-91
Identity = 189/546 (34.62%), Postives = 306/546 (56.04%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQ------SDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKE---------MLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERM--------KNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDL-SYMHDFEI--------------HQNCLKYP--HAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            L+SYQL G+ WL+ ++E  +NGILADEMGLGKT+Q I  +SYL++ G++GP ++  P STL NW  E  ++   + VI+Y+G+  ER  +R +I +       ++  V++T+Y I+++   D+  + +L + + + DE H +KN+     + L ++    +LLLTGTPLQNN+ EL SLL+F++P+IF   N   ++ F     S +     N+  I+Q KE         +L PF LRRLK+ V   +P K   +   PL+  Q+  YR  +++         K+ ++D   +        + R+  N+ +   D    SI  +++ ++   E    S  E+      S  +D  I              H   L+YP      +YK+ EEL+  S K+  LD+ +P     G KILIFSQ   +LDI++++   +   Y RLDGS   +DR++ ID F  D +  +F+L+TRAGGLG+NL++A+ VII+D D+NP +D QA+DR HR+GQ + + V +L++  T+D+ I+  A  K KLE++ +
Sbjct:  298 LRSYQLEGVEWLKGLYENGVNGILADEMGLGKTIQCIGLVSYLIEMGVRGPFLVAAPLSTLPNWVSEFRRFSPQIPVILYHGSIQERTSLRRKITKLKKAGPFETMPVVVTSYEIAMN---DQKHLFQLMWKHMIVDEGHRIKNLNCRLIRELKSYNSANRLLLTGTPLQNNLAELWSLLNFLLPDIFDDLN-SFQRWFDF---SAINDEGGNEKIIAQEKEHQVLERLHSILTPFLLRRLKTDVELSLPPKKEVLVRAPLTSKQTEFYRAALDKTILDIVGDNKDKKEDKVEISSTGRKKRKGRRNINYKIF--DDENGSI-EELAEELATLE---KSRREICTPSQKSSTYDISIKITNILMLLRKCCNHPYLLEYPLDPVTQQYKIDEELVRCSGKMLLLDQMVPALKRRGHKILIFSQMTKMLDILQDYCYLRGYQYSRLDGSMKVEDRREEIDAFASDPEKFIFLLSTRAGGLGLNLSAADTVIIYDSDWNPQSDLQAQDRCHRIGQTKPILVYRLVTSNTVDQKIVERAASKRKLEKMVI 830          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Match: EDO48116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK66])

HSP 1 Score: 304.294 bits (778), Expect = 3.351e-88
Identity = 187/530 (35.28%), Postives = 296/530 (55.85%), Query Frame = 2
Query:  608 ILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-------LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFN-EDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            I +QP  +     LK YQL G+ W+  +H  NLNGILADEMGLGKT+QTIA  SYL++   L GP +++VP STL+NW+ E  KW  +  V+ Y G+ + RR     + ++  FNV+LTTY   +    D+  + K+ + Y V DE H +KN      + L +++  + ++LLTGTPLQN + EL +LL+F++P IF + +   ++ F      T ++   N+++    I ++ ++L PF LRRLK +V SQ+P K   +    +S  Q ILY    ++     D +   K         ++T+M+LRK+ NH  + +                    HI    E I E L +      H   +  P          ++   S K + LD  LP    N  ++L+F Q   ++ I+E++  +K   YLRLDG+T ++DR   +  FN +D    VF+L+TRAGGLG+NL +A+ V+IFD D+NP+ D QA+DR+HR+GQ ++V+V++L++  +++E IL  A  KL +++
Sbjct:  634 ITEQPSMLV-GGRLKEYQLAGLEWMVSLHNNNLNGILADEMGLGKTIQTIALFSYLIEKKRLNGPFLVIVPLSTLSNWQLEFEKWAPSAIVVSYKGSPNMRRSAGA-VLRTGKFNVVLTTYEYVM---RDKAILAKVRWKYMVVDEGHRMKNHHCKLTQVLNTHYAAQHRILLTGTPLQNRLPELWALLNFLLPTIFKSVST-FEQWFNAPFAMTGEKVELNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPDKVEYVVKCDMSILQRILYNHMYKKGVLLTDGSEKDKKGKGGTKTLMNTIMQLRKICNHPFMFQ--------------------HI---EESIAEHLGF------HGGIVTGP----------DIYRASGKFELLDRILPKLKRNKHRVLMFCQMTSLMTILEDYFNWKGFPYLRLDGTTKSEDRGQLLSLFNAKDSPYFVFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQEKEVRVLRLMTVNSVEEKILAAARYKLNVDE 1118          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Match: EDO40761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S667])

HSP 1 Score: 288.5 bits (737), Expect = 2.907e-84
Identity = 185/540 (34.26%), Postives = 290/540 (53.70%), Query Frame = 2
Query:  578 IDSSLGTENLIL---DQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQ-MPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-----LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            ++ + G +  IL   + P+YI     ++ YQ+ G+NWL  ++E  +NGILADEMGLGKT+QTI+ L Y+ +   + GPH+++ P STL NW  E  +WC +++ +   GNQ++R            ++V +T+Y + I  K      KK  + Y V DEAH +KN  S   + +   +   +LLLTGTPLQNN+ EL +LL+F++P++F + ++     F  +     KQ       + ++  +L PF LRRLKS V  + +P K T++    L++ Q   Y + +  MK+  D   G         L+ +M+LRK  NH  L                                        F+  +    Y   V        L+  S K++ LD+ L    + G ++LIFSQ   +LDI+E++  ++Q  Y RLDG T  ++RQ YI+ FN     K +F+L+TRAGGLGINL +A++VI++D D+NP  D QA DR+HR+GQ + VKV + IS+ T++E I+  A  KL+L+ + +
Sbjct:  119 LNQTKGAQTSILHFEESPNYIKGG-EMRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKNFRNVPGPHMVICPKSTLANWMAEFERWCPSIRAVCLIGNQEQRTAFIRDTMLPGEWDVCVTSYEMVIREK---AVFKKFAWRYIVIDEAHRIKNEKSKLSEIVRELRSANRLLLTGTPLQNNLHELWALLNFLLPDVFSSSDD-FDAWFNSNNLVEEKQL------VERLHSVLRPFLLRRLKSDVEKRLLPKKETKV-YTGLTKMQRSWYTKIL--MKDI-DVVNGAGKTDKMRLLNILMQLRKCCNHPYL----------------------------------------FDGAEPGPPYTTDV-------HLIENSGKMRVLDKLLARLKQEGSRVLIFSQMTRLLDILEDYCLWRQYDYCRLDGQTPHEERQAYINSFNMPGSTKFIFMLSTRAGGLGINLATADIVILYDSDWNPQVDLQAMDRAHRIGQKKQVKVFRFISESTVEERIIERAEMKLRLDAVVI 596          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Match: EDO39585 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9J4])

HSP 1 Score: 282.722 bits (722), Expect = 1.821e-83
Identity = 192/550 (34.91%), Postives = 283/550 (51.45%), Query Frame = 2
Query:  617 QPHYINPSL-HLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMR-----------------YRIAQSDS--FNVLLTTYN-ISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMP------NIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYA-----LSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            QP Y++ +   L  YQ  G+NWLR    +  N ILADEMGLGKT+QTI+FL  L+  G  +GP ++  P STL NWERE   W  ++ V+ Y G+++ R  +R                 Y++ +     F+VLLT+Y  +SI S      ++ +D+   V DEAH LKN  S  ++ LS++ I  KLLLTGTPLQNN+ EL +LL F+ P      N FLTE + + K                +D+I ++ ++L P  LRRLK+ VL  +P K+  I  + LS  Q   Y+  + R      +A   K A     L+ +MEL+K  NH  L              H   L+     S                            G Y+ P  L   S K+  L + L    E G ++LIFSQ   +LD++E+FL+     Y R+DGS +   RQ+ ID+FN        F+L+TRAGGLGINL +A+ V I+D D+NP+ND QA  R+HR+GQ   V + + +++ +++E I ++A +K+ L  + +
Sbjct:  247 QPAYLDETGGKLHEYQREGLNWLRFSWAQGTNTILADEMGLGKTIQTISFLYSLMKEGHSQGPFLVSAPLSTLVNWEREFEFWAPDMYVVTYAGDKESRATIRNFDFSFDEDAFKSGLKAYKLKKDSPVKFHVLLTSYELVSIDSAS----LQSIDWAMLVVDEAHRLKNNQSKFFRTLSDYNIGYKLLLTGTPLQNNLEELWNLLFFLDPVEFNNKNNFLTEFDNVAK----------------EDQIKKLHDILGPHMLRRLKADVLKGIPSKSELIVRVELSPMQKKYYKWILTR----NFEALNTKGAQQVSLLNVMMELKKCCNHPYLF-------------HAAALEAKRTQS----------------------------GGYE-PNSLTEASGKLMLLVKMLKKLREQGHRVLIFSQMTRMLDLLEDFLEGHGYKYERIDGSVNGAARQEAIDRFNAPTSQAFCFLLSTRAGGLGINLATADTVFIYDSDWNPHNDIQAFSRAHRIGQNNKVMIYRFVTRSSVEERITQVAKKKMMLTHLVV 730          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Match: smarcad1a (SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1 [Source:NCBI gene;Acc:101169787])

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 297/621 (47.83%), Postives = 423/621 (68.12%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDL-----KANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQS-DSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVM-ELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            IL +F  +++D+L+ I+GCS  KA RI++ RP+   + L     K N +S++L+ GC  +L  ++ ++ L+ KC  IS  +++++  ++ +       GT ++   QP  +N    LK YQLIG+ WL ++HE NL+GILADEMGLGKT+Q IAFL+ L ++G+ GPH+I+VP STL+NW REL  WC +L+V++YYG+ DERR +++ I  +   FNV++TTYN++I +  DR   +KL   Y VFDE HMLKNM S+RY++L +   K +LLLTGTPLQNN++EL+SLL+F+MP++F +    L K+F M  KS   QS F  D+ISQ K ++ PF LRR+KS+VL Q+P K   +   P+SE Q  LY+   +++K       G K  LS VM +LRK++NH LL R +YT   L+ +S  ML +  H  ++  LI ED+  M DFE+H+ C ++  ++  Y+L   L+L S K  +L + L      GD++++FSQF M+LDIVE  LK+ Q  Y+RLDGST   DR   ID++N D DI VF+L+TRAGGLGINLT+ANVVI+ DID NPYND+QAEDR HR+GQ R V+VIKLISK TI++CIL++  +KLKLEQ
Sbjct:  420 ILQFFQDASIDELTLISGCSIKKAQRIVELRPFDNWEMLCDVFHKGNGLSEELLLGCKVVLKERKVVLGLMSKCQSISKRMVKQVTEVMEN-------GTASM--HQPSVLNNQFKLKPYQLIGLKWLLLLHEHNLSGILADEMGLGKTIQAIAFLAKLFETGIDGPHLIIVPASTLDNWVRELKLWCPSLEVLIYYGSVDERRYLKHEILNNYVQFNVIVTTYNLAIGNDSDRSLFRKLPLVYAVFDEGHMLKNMNSLRYRHLMSINAKHRLLLTGTPLQNNLLELMSLLNFIMPSMFSSSTSQLSKMFSM--KSHEDQSRFERDRISQAKRIMKPFILRRVKSEVLQQLPAKEETVEFCPMSEKQIPLYQNLFKKLKTA---VIGEKRELSNVMMQLRKMANHPLLHRQYYTKEKLKAMSKLMLKEPTHFDADAALIQEDMEVMSDFELHRLCQQF-SSISSYQLDIGLVLDSGKFHHLTKLLATLKSKGDRVVLFSQFTMMLDIVEVLLKHLQHRYVRLDGSTPIADRIVLIDEYNTDPDIFVFLLSTRAGGLGINLTTANVVILHDIDCNPYNDKQAEDRCHRVGQTRTVQVIKLISKDTIEDCILQLGQKKLKLEQ 1025          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Match: hells (helicase, lymphoid specific [Source:NCBI gene;Acc:101164497])

HSP 1 Score: 322.783 bits (826), Expect = 3.298e-98
Identity = 188/552 (34.06%), Postives = 310/552 (56.16%), Query Frame = 2
Query:  581 DSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIF--LTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILY----RQTIERMKNCQDDAFGV------KYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPH--------AVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            D  +  + + + QP      + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++  ++ V++Y+G Q ER ++  +I +         V++T++ IS+    DR F+++  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P +F  L   E    I  + +  +LK S    + +S + ++L PF LRRLKS V  ++P K   +   PL+  Q + Y     ++I +M   +     +      K     V++ R   + +    + Y + + ++        ++ I  ++++   +L   +   + + C  +P+        A  ++K+ EEL+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   + + Y RLDGS S  +R + I +F++D ++ +F+L+TRAGGLGINLT+A+ VIIFD D+NP  D QA+DR HR+GQ + V V +L++  TID+ IL  A  K KLEQ+ +
Sbjct:  166 DRKVDGQPVPVQQPQLFTGGI-MRWYQIEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMIEKTVMGPFLVVAPLSTLPNWINEFKRFTPDVSVLLYHGPQPERAKLLKQIRRPQGPLNMCPVVITSFEISMI---DRKFLQRFQWKYLIVDEGHRIKNLNCRLVRELKTLPTDNKLLLTGTPLQNNLAELWSLLNFLLPEVFDDLKSFESWFDINSLGEPESLKVSEREQNILSMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTPKQELFYTAVVNKSIAKMLGQEKAPVALTPSGRPKRRSRRVVDYRDTHDDTPFALEKYLERVQKEAEQRSASSKNTIPLDSQI---NLKLQNVLMLLKRCCNHPYLVEYPLDPATQEFKIDEELVQSSGKFLILDRLLPELKKRGHKVLIFSQMTSILDILMDYCYLRSLQYSRLDGSMSYAERDENISKFSKDPEVFLFLLSTRAGGLGINLTAADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLVTANTIDQKILERATAKRKLEQMVI 710          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Match: hells (helicase, lymphoid specific [Source:NCBI gene;Acc:101164497])

HSP 1 Score: 323.553 bits (828), Expect = 5.414e-98
Identity = 190/552 (34.42%), Postives = 308/552 (55.80%), Query Frame = 2
Query:  581 DSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDS----FNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIF--LTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER--MKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFE--------DLSYMHDFEIHQNCLKYPH--------AVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            D  +  + + + QP      + ++ YQ+ GI WLR++ E  +NGILADEMGLGKT+Q IA ++ +++  + GP ++V P STL NW  E  ++  ++ V++Y+G Q ER ++  +I +         V++T++ IS+    DR F+++  + Y + DE H +KN+     + L       KLLLTGTPLQNN+ EL SLL+F++P +F  L   E    I  + +  +LK S    + +S + ++L PF LRRLKS V  ++P K   +   PL+  Q + Y   + +   K    +      AL+     ++ S   +  RD + D+      +   + ++   S+T ++          +L   +   + + C  +P+        A  ++K+ EEL+  S K   LD  LP   + G K+LIFSQ   +LDI+ ++   + + Y RLDGS S  +R + I +F++D ++ +F+L+TRAGGLGINLT+A+ VIIFD D+NP  D QA+DR HR+GQ + V V +L++  TID+ IL  A  K KLEQ+ +
Sbjct:  218 DRKVDGQPVPVQQPQLFTGGI-MRWYQIEGIEWLRMLWENGINGILADEMGLGKTIQCIAHIAMMIEKTVMGPFLVVAPLSTLPNWINEFKRFTPDVSVLLYHGPQPERAKLLKQIRRPQGPLNMCPVVITSFEISMI---DRKFLQRFQWKYLIVDEGHRIKNLNCRLVRELKTLPTDNKLLLTGTPLQNNLAELWSLLNFLLPEVFDDLKSFESWFDINSLGEPESLKVSEREQNILSMLHQILTPFLLRRLKSDVTLEVPPKKEIVVYAPLTPKQELFYTAVVNKSIAKMLGQEKTEAPVALTPSGRPKRRSRRVVDYRDTHDDTPFALEKYLERVQKEAEQSSTPVLNAQSPLDSQINLKLQNVLMLLKRCCNHPYLVEYPLDPATQEFKIDEELVQSSGKFLILDRLLPELKKRGHKVLIFSQMTSILDILMDYCYLRSLQYSRLDGSMSYAERDENISKFSKDPEVFLFLLSTRAGGLGINLTAADTVIIFDSDWNPQADLQAQDRCHRIGQTKPVVVYRLVTANTIDQKILERATAKRKLEQMVI 765          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Match: ENSORLT00000025786.2 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 303.908 bits (777), Expect = 5.097e-88
Identity = 185/516 (35.85%), Postives = 291/516 (56.40%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQT------IERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQ+ G+ W+  ++  NLNGILADEMGLGKT+QTIA ++YL++   L GP++I+VP STL+NW  EL KW  ++  I Y G    RR +  ++ +S  FNVLLTTY   I   +D+  + K+ + Y + DE H +KN      + L +++   R+LLLTGTPLQN + EL +LL+F++P IF + +   ++ F      T ++   N+++    I ++ ++L PF LRRLK +V SQ+P K   +    +S  Q +LYR         +  +  +    G K  ++T+M+L+K+ NH  +                                    + H  E     L YP+ +       +L   S K + LD  LP     G ++L+F Q   ++ I+E++  Y+   YLRLDG+T ++DR   + +FNE+     +F+L+TRAGGLG+NL +A+ V+IFD D+NP+ D QA+DR+HR+GQ  +V+V++L S  +++E IL  A  KL ++Q
Sbjct:  676 LKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQL-RSGKFNVLLTTYEYII---KDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCST-FEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYM------------------------------------FQHIEESFAEHLGYPNGIISGP---DLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQ 1147          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Match: ENSORLT00000039803.1 (probable global transcription activator SNF2L2 [Source:NCBI gene;Acc:101161713])

HSP 1 Score: 303.523 bits (776), Expect = 1.899e-87
Identity = 186/516 (36.05%), Postives = 292/516 (56.59%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSG-LKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYL-SNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQT------IERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQ+ G+ W+  ++  NLNGILADEMGLGKT+QTIA ++YL++   L GP++I+VP STL+NW  EL KW  ++  I Y G    RR +  ++ +S  FNVLLTTY   I   +D+  + K+ + Y + DE H +KN      + L +++   R+LLLTGTPLQN + EL +LL+F++P IF + +   ++ F      T ++   N+++    I ++ ++L PF LRRLK +V SQ+P K   +    +S  Q +LYR         +  +  +    G K  ++T+M+L+K+ NH  +                                    + H  E     L YP+ +     P +L   S K + LD  LP     G ++L+F Q   ++ I+E++  Y+   YLRLDG+T ++DR   + +FNE+     +F+L+TRAGGLG+NL +A+ V+IFD D+NP+ D QA+DR+HR+GQ  +V+V++L S  +++E IL  A  KL ++Q
Sbjct:  738 LKHYQIQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWVYELDKWAPSVVKIAYKGTPALRRGLVPQL-RSGKFNVLLTTYEYII---KDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCST-FEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSAIQKVLYRHMQKGILLTDGSEKDKKGKGGAKTLMNTIMQLKKICNHPYM------------------------------------FQHIEESFAEHLGYPNGI--ISGP-DLYRASGKFELLDRILPKLHATGHRVLLFCQMTTLMTIMEDYFGYRNFLYLRLDGTTKSEDRAALLKKFNEEGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCSVNSVEEKILAAAKYKLNVDQ 1209          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Match: SMESG000061650.1 (SMESG000061650.1)

HSP 1 Score: 1404.81 bits (3635), Expect = 0.000e+0
Identity = 726/731 (99.32%), Postives = 728/731 (99.59%), Query Frame = 2
Query:   68 MTKNDSSNYSKTFKRTCIMDDFVIKRPRLENKDNDENVLDDSYISDKVIAKKRANLLXXXXXXXXXXQYHEESNSMKLDEINILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMTYXXXXXXXXXXXXXXXXXXXFGSLLKQAMDI 2260
            MTKNDSSNYSKTFKRTCI+DDFVIKRPRLENKDNDENVLDDSYISDKVIAKKRANLLDSSDSEVSDDQYHEESNSMKLDEINILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWC NLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKI+QIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQS LYRQTIERMKNCQDDAFG KYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMTYDIDNDDESKSSSSEPKDVDFGSLLKQAMDI
Sbjct:    1 MTKNDSSNYSKTFKRTCILDDFVIKRPRLENKDNDENVLDDSYISDKVIAKKRANLLDSSDSEVSDDQYHEESNSMKLDEINILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLKANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCPNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKINQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSTLYRQTIERMKNCQDDAFGGKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMTYDIDNDDESKSSSSEPKDVDFGSLLKQAMDI 731          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Match: SMESG000061158.1 (SMESG000061158.1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 297/627 (47.37%), Postives = 440/627 (70.18%), Query Frame = 2
Query:  314 ILDYFNKSTVDDLSQITGCSEIKALRIMKDRPYKTIDDLK-----ANKISQKLIDGCLEILVIKQNLIELLKKCVQISANLLERIRPLLVS--VDIDSSLGTENLILDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRI--AQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLK----QSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKN-CQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLE 2152
             L +FN+ TV +LS + GCS   A +I    P+  I+DL      +N +++  I  C E+L ++    +L+ KC Q  + +   I   L +  +++ S++ ++NLI + P+ +NP+L LK +QL+G+NWL ++++E +NGIL+DE GLGKTVQTI+FL++LLD G +GPH+I+VP S++++WE EL  WC  +K+I+Y+G+QDER+ +R +I   Q   FN+LLTTYNIS  + EDR  +K+++F+YG+FD+A MLKNMMS RYK L NFK+KR+LLLTG P QNN++ELISLLSF+MP++FL   + LKKIFQM+ K   +     S F+++KI Q K +L PFC+RRL+  +L Q+  KTT+   L L++ Q +LY   +  ++    D+    +Y +  +M+LRKL NH LL+R+HYT+ +L+ IS+D+L D  H ++N E I EDLS M+DF+IH  C  Y HA+GK+ L E++L++SNK QYLD+ LP F+  G ++LIFSQ  M++D++E +L   + +YLRLD  T   DR+D  ++FN+DD IK+FIL+T+    GINL  A+ VII D+D+NP N+R AED  H LGQ ++V++IKLISK TI+E IL IAN K+K++
Sbjct:  448 FLKFFNQCTVHELSLMPGCSMKIAEKICSQGPFLNINDLNIKIKNSNIVNENFIQNCHEVLNMRNMFSKLIVKCEQFVSKVENTIDKHLENNYLELSSNVESKNLITEIPNNLNPNLKLKPFQLVGLNWLNLLYKEKINGILSDESGLGKTVQTISFLAHLLDLGDQGPHLIIVPNSSISHWESELKLWCPQMKLIIYHGSQDERKSIRLKIYDGQHSDFNILLTTYNISTGTMEDRAMMKRVNFHYGIFDDAQMLKNMMSNRYKNLINFKVKRRLLLTGLPFQNNLLELISLLSFLMPDMFLPHADFLKKIFQMNNKRKDEFGNILSEFDNEKIEQTKNLLKPFCIRRLRENILYQLSAKTTDYVFLNLTQYQKMLYTNVVTAIRQETSDERRNSQYQM--IMDLRKLCNHPLLLRNHYTNELLQSISNDLLQDTSHESANPESICEDLSTMNDFQIHITCQLYSHAIGKFSLGEQILVQSNKFQYLDKYLPDFMLQGHRVLIFSQIAMMIDVLEAYLNLNKYSYLRLDEQTPVCDRKDLAEKFNKDDSIKIFILSTKGECSGINLIGADTVIIHDVDFNPANNRLAEDMCHTLGQTKNVRIIKLISKDTIEETILSIANSKIKMD 1072          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Match: SMESG000076666.1 (SMESG000076666.1)

HSP 1 Score: 302.753 bits (774), Expect = 1.447e-87
Identity = 189/518 (36.49%), Postives = 299/518 (57.72%), Query Frame = 2
Query:  647 LKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKR-KLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDK----ISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIER---MKNCQDDAFGVKYAL--STVMELRKLSNHSLL---VRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNE-DDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQ 2155
            LK YQL G+ WL  ++  NLNGILADEMGLGKT+QTI  ++YL++   + GP +I+VP ST++NW  E  KW  ++K I+Y G+   R+ ++ ++  S  FNVLLTTY   I   +D+  + K+ + Y + DE H +KN      + L+ F I   +LLLTGTPLQN + EL +LL+F++PNIF + N   ++ F     S+ ++   N ++    I ++ ++L PF LRRLK +V +Q+P K   +    +S  Q  +Y     +   +K+   D  G    L  + +M+LRK+ NH  +   V   Y   +       M +   +   N  +  E    +H  ++++       A GK++L             LD  LP       ++L+F Q   ++D++E +L+Y+   YLRLDG+T ++DR D +  FN+ + +  +F+L+TRAGGLG+NL SA+ VIIFD D+NP+ D QA+DR+HR+GQ  +V+V++LI   +I+E IL  A  KL +++
Sbjct:  548 LKQYQLKGLEWLVSLYNNNLNGILADEMGLGKTIQTIGLITYLMERKKVNGPFLIIVPLSTMSNWAMEFEKWGPSVKKILYKGSPKIRKELQAQLKTS-KFNVLLTTYEYII---KDKSSLSKVKWKYMIIDEGHRMKNHHCKLTQILNTFYIAPYRLLLTGTPLQNKLPELWALLNFLLPNIFKSVN-TFEQWFNAPFASSGEKVELNQEETLLIIRRLHKVLRPFLLRRLKKEVENQLPEKVEYVIKCEMSALQRKVYSNIQSKRAILKSVDKDKKGRTERLWSNVLMQLRKICNHPYMFPEVEIEYAKHVF------MKMHNGNPPPNVPIPKE----IHGADLYR-------ASGKFEL-------------LDRILPKLKRAKHRVLMFCQMTHLMDLMEPYLEYRCFKYLRLDGTTKSEDRGDLLCAFNKPNSEFFIFMLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLIMINSIEEKILAAARFKLNVDE 1030          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Match: SMESG000013560.1 (SMESG000013560.1)

HSP 1 Score: 290.041 bits (741), Expect = 7.954e-85
Identity = 187/524 (35.69%), Postives = 293/524 (55.92%), Query Frame = 2
Query:  611 LDQPHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRR-MRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVK---YALSTVMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
             +Q  Y      ++ YQ+ G+NWL  ++  + NGILADEMGLGKT+QTI+ + YL     L GPH+I+ P STL NW  E  +W  ++K I   G+Q+ R R +R +I   D ++V++T+Y + I  K     +KK ++ Y   DEAH +KN  S   + +  FK + +LL+TGTPLQNN+ EL +LL+F+MP +F + +     +F +   ++L++ +     + ++  +L PF LRR+K+ V  ++P K      + LS  Q  LY + + +  +  + A G       L+ +M+LRK +NH  L                     D I            Y  D+ + +NC                     K+  LD+ L    E G +IL+FSQ   +LDI+E++  +++  Y RLDGST  D+RQ  ID++N+    K +F+L+TRAGGLGINL +A+VVI++D D+NP  D QA+DR+HR+GQ + V+V +LI++ T++E I+  A  KLKL+ I +
Sbjct:   75 FEQSPYFVIGGEMRDYQVRGLNWLIQLYLSSTNGILADEMGLGKTLQTISMIGYLKHYRNLPGPHLIITPKSTLQNWINEFTRWAPSVKPICLIGDQETRSRVIREQILPQD-WDVIVTSYEMCIKEKST---LKKFNYIYLAIDEAHRIKNEKSKLSEIVRTFKSQNRLLITGTPLQNNLHELWALLNFLMPEMFAS-SANFDDLFNI---NSLEEETL----VQRLHSVLKPFLLRRIKADVEKRLPPKKEIKIYIGLSILQRELYTKILMKDIDLVNGAGGKSDKVRLLNILMQLRKCTNHPYLF--------------------DGIEPGP-------PYTTDYHLVENC--------------------GKMVLLDKLLNKLKEQGSRILLFSQMTRMLDILEDYCLWRKYDYCRLDGSTPHDERQISIDEYNKPGSKKFLFMLSTRAGGLGINLATADVVILYDSDWNPQVDLQAQDRAHRIGQTKTVRVFRLITENTVEERIIARAEMKLKLDNIVI 539          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Match: SMESG000017699.1 (SMESG000017699.1)

HSP 1 Score: 288.115 bits (736), Expect = 3.234e-84
Identity = 186/522 (35.63%), Postives = 284/522 (54.41%), Query Frame = 2
Query:  620 PHYINPSLHLKSYQLIGINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLD-SGLKGPHIIVVPTSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTYNISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLLLTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFNDDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQTIERMKNCQDDAFGVKYALST-----VMELRKLSNHSLLVRDHYTDSILRKISHDMLLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKSNKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGSTSTDDRQDYIDQFNEDDDIK-VFILTTRAGGLGINLTSANVVIIFDIDYNPYNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITM 2164
            P Y++    ++ YQ+ G+NW+  ++  N NGILADEMGLGKT+QTI+ + YL   SG KG  I++ P STL NW  E+++W  +L  I   G+Q  R  + +++ Q+  ++VL+TTY + I  K     IKK ++ Y   DEAH +KN  S   + +  F  + +LL+TGTPLQNN+ EL +LL+F+MP+ F + ++   ++F   + +   Q       + ++  +L P+ LRRLK  V  ++P K      + LS  Q  LY + +  MK+        K    T     +M+LRK +NH  L                     D I            Y  D+ +  NC                     K+  LD+ L      G ++L+F+Q   +LDI+E++ +++   Y RLDG T   DRQ  ID +N  +  K +F+L+TRAGGLGINLTSA+VVII+D D+NP  D QA+DR+HR+GQ + V+V +LI++ T++E I+  A  KLKL+ I +
Sbjct:   67 PWYVSGG-EMRDYQIRGLNWMIQLYLSNNNGILADEMGLGKTLQTISMIGYLKHFSGKKGHFIVITPKSTLQNWVNEINRWAPSLTSISLIGDQQARHEIIHQL-QTKQWDVLVTTYEMCIKEKS---AIKKYNYVYLAIDEAHRIKNENSKLSEIVREFNSEHRLLITGTPLQNNLHELWALLNFLMPDEF-SSSDNFDELFNNDKMAEQNQ-------VQKLHSILKPYLLRRLKIDVEKKLPPKKEIKVYIGLSAIQRELYTKIL--MKDLDTLNSTAKKVEKTRLQNILMQLRKCTNHPYLF--------------------DGIEPGP-------PYTTDYHLVANC--------------------GKMILLDKLLSRLKAEGSRVLVFTQMTRMLDILEDYCRWRGHEYCRLDGQTQHSDRQISIDDYNSPNSTKFLFMLSTRAGGLGINLTSADVVIIYDSDWNPQVDLQAQDRAHRIGQKKTVRVFRLITENTVEERIIGRAEMKLKLDNIVI 526          
The following BLAST results are available for this feature:
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCAD10.000e+046.13SWI/SNF-related, matrix-associated actin-dependent... [more]
SMARCAD10.000e+046.14SWI/SNF-related, matrix-associated actin-dependent... [more]
SMARCAD10.000e+046.14SWI/SNF-related, matrix-associated actin-dependent... [more]
SMARCAD10.000e+047.57SWI/SNF-related, matrix-associated actin-dependent... [more]
HELLS8.167e-9133.64helicase, lymphoid specific [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
M03C11.83.400e-14841.08SWI/SNF-related matrix-associated actin-dependent ... [more]
swsn-48.397e-9736.92SWI/SNF nucleosome remodeling complex component; S... [more]
pqn-153.489e-9036.73Prion-like-(Q/N-rich)-domain-bearing protein [Sou... [more]
isw-12.587e-8836.12Chromatin-remodeling complex ATPase chain isw-1 [... [more]
chd-11.278e-8535.59Chromodomain and Helicase Domain protein [Source:... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Etl14.694e-16842.16gene:FBgn0032157 transcript:FBtr0079901[more]
Iswi1.548e-9136.54gene:FBgn0011604 transcript:FBtr0087841[more]
Iswi1.548e-9136.54gene:FBgn0011604 transcript:FBtr0087842[more]
Iswi1.548e-9136.54gene:FBgn0011604 transcript:FBtr0087843[more]
brm1.150e-8635.20gene:FBgn0000212 transcript:FBtr0075524[more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcad1b0.000e+047.67Danio rerio SWI/SNF-related, matrix-associated act... [more]
smarcad1a3.434e-17945.09SWI/SNF-related, matrix-associated actin-dependent... [more]
hells3.320e-9133.81helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-G... [more]
hells3.423e-9133.81helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-G... [more]
hells3.423e-9133.81helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
larp4b0.000e+044.58La ribonucleoprotein domain family member 4B [Sour... [more]
larp4b0.000e+044.74La ribonucleoprotein domain family member 4B [Sour... [more]
larp4b0.000e+044.87La ribonucleoprotein domain family member 4B [Sour... [more]
larp4b0.000e+045.02La ribonucleoprotein domain family member 4B [Sour... [more]
larp4b0.000e+044.87La ribonucleoprotein domain family member 4B [Sour... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smarcad10.000e+045.99SWI/SNF-related, matrix-associated actin-dependent... [more]
Hells4.531e-9033.70helicase, lymphoid specific [Source:MGI Symbol;Acc... [more]
Chd11.095e-8636.48chromodomain helicase DNA binding protein 1 [Sourc... [more]
Smarca56.484e-8636.02SWI/SNF related, matrix associated, actin dependen... [more]
Smarca21.284e-8535.40SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E7F1C4|SMRDB_DANRE0.000e+047.67SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q5FWR0|SMRCD_XENTR0.000e+044.58SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|E1B7X9|SMRCD_BOVIN0.000e+046.13SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|D3Z9Z9|SMRCD_RAT0.000e+045.83SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q9H4L7|SMRCD_HUMAN0.000e+046.13SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JF110.000e+045.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GQ420.000e+045.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EFE20.000e+045.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXG90.000e+045.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FB370.000e+045.44Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcad1b0.000e+049.28SWI/SNF-related matrix-associated actin-dependent ... [more]
smarcad1a0.000e+046.86SWI/SNF-related, matrix-associated actin-dependent... [more]
hells1.940e-8933.16helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-G... [more]
smarca16.316e-8835.63SWI/SNF-related matrix-associated actin-dependent ... [more]
smarca16.716e-8835.63SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcad1a0.000e+044.90SWI/SNF-related, matrix-associated actin-dependent... [more]
hells1.670e-9133.27helicase, lymphoid specific [Source:ZFIN;Acc:ZDB-G... [more]
SMARCA59.840e-8834.48SWI/SNF related, matrix associated, actin dependen... [more]
SMARCA22.934e-8535.40SWI/SNF related, matrix associated, actin dependen... [more]
ENSPMAT00000004254.12.311e-8435.29pep scaffold:Pmarinus_7.0:GL484668:1435:12215:1 ge... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FUN301.226e-13043.45Snf2p family member with ATP-dependent chromatin r... [more]
ISW21.324e-9136.29ATP-dependent DNA translocase involved in chromati... [more]
CHD17.662e-8937.14Chromatin remodeler that regulates various aspects... [more]
SNF22.277e-8734.48Catalytic subunit of the SWI/SNF chromatin remodel... [more]
STH12.353e-8535.20ATPase component of the RSC chromatin remodeling c... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO410598.840e-17143.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466691.774e-9134.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481163.351e-8835.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO407612.907e-8434.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395851.821e-8334.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcad1a0.000e+047.83SWI/SNF-related, matrix-associated actin-dependent... [more]
hells3.298e-9834.06helicase, lymphoid specific [Source:NCBI gene;Acc:... [more]
hells5.414e-9834.42helicase, lymphoid specific [Source:NCBI gene;Acc:... [more]
ENSORLT00000025786.25.097e-8835.85probable global transcription activator SNF2L2 [So... [more]
ENSORLT00000039803.11.899e-8736.05probable global transcription activator SNF2L2 [So... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061650.10.000e+099.32SMESG000061650.1[more]
SMESG000061158.10.000e+047.37SMESG000061158.1[more]
SMESG000076666.11.447e-8736.49SMESG000076666.1[more]
SMESG000013560.17.954e-8535.69SMESG000013560.1[more]
SMESG000017699.13.234e-8435.63SMESG000017699.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005925 ID=SMED30005925|Name=SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2316bp
GTGTGATAGTATTTTTTGCAATAAATCTTTTCATTTCAATTATTAAAATT
TTATTATATTAGTAAAAATGACGAAAAATGATAGCTCAAATTATTCAAAA
ACTTTTAAGCGCACCTGCATAATGGATGATTTTGTAATTAAGCGACCTCG
ATTAGAAAATAAAGATAATGACGAGAACGTTCTTGACGATTCTTATATCT
CTGATAAAGTTATTGCAAAAAAACGTGCAAATCTTTTGGATAGTTCAGAC
AGTGAAGTTTCGGATGATCAATATCACGAAGAATCAAATTCTATGAAATT
AGACGAAATAAACATTTTAGATTATTTTAATAAATCAACAGTTGATGATC
TCAGTCAAATCACCGGATGTTCGGAAATAAAAGCATTACGTATAATGAAA
GATAGACCTTATAAAACTATCGATGATTTAAAAGCCAACAAAATCAGTCA
AAAATTAATAGATGGCTGTTTGGAAATTTTAGTAATCAAACAAAATCTTA
TTGAACTGCTGAAGAAATGCGTGCAAATATCTGCTAATTTACTTGAAAGA
ATTCGACCACTGTTGGTTTCTGTTGATATTGATTCGTCTTTGGGAACCGA
GAATTTAATTTTAGATCAACCACATTATATTAATCCCAGTCTTCATTTGA
AATCTTATCAATTAATTGGAATCAATTGGCTTCGAATAGTCCACGAAGAA
AATCTGAATGGGATTTTGGCCGATGAAATGGGCCTTGGGAAAACCGTTCA
AACCATTGCCTTTCTATCGTATCTTTTGGACAGTGGACTGAAAGGTCCGC
ACATAATCGTCGTGCCGACTTCAACACTCAACAATTGGGAACGAGAACTT
CATAAATGGTGTCTGAATTTGAAGGTAATTGTCTATTATGGCAATCAAGA
CGAGAGGAGGCGCATGAGATACAGAATTGCTCAAAGCGATTCATTTAACG
TTTTATTAACTACCTACAATATCTCAATTTCAAGCAAAGAAGACAGATTA
TTCATCAAAAAGCTCGATTTTTACTACGGCGTATTTGACGAGGCTCATAT
GCTGAAAAATATGATGTCAATTAGATACAAATATCTGAGCAATTTTAAAA
TTAAACGGAAACTATTGCTAACTGGAACTCCTTTACAGAACAATATGGTC
GAATTGATATCATTGCTATCTTTCGTTATGCCAAATATTTTTCTAACAGA
AAATGAAGGGTTAAAAAAGATATTTCAAATGTCACAAAAATCTACACTAA
AACAATCATCTTTCAATGATGATAAAATTAGTCAAATCAAAGAAATGTTA
GCTCCGTTTTGTTTGCGTCGATTGAAAAGCCAAGTTTTATCTCAAATGCC
ACTAAAAACTACTGAAATTGCTCTTCTGCCCTTGTCAGAAGCCCAGTCGA
TACTTTACAGGCAAACTATAGAGAGAATGAAAAACTGTCAGGACGATGCT
TTTGGAGTCAAGTATGCACTGTCAACAGTTATGGAGTTAAGGAAATTGTC
TAACCATTCACTATTGGTGCGGGATCATTACACAGATTCTATCCTCAGGA
AAATATCTCATGACATGCTCCTCGACGAAGATCACATCACATCGAATACT
GAGTTGATTTTCGAGGACTTGTCTTACATGCATGATTTCGAAATCCACCA
GAATTGCTTGAAATACCCTCACGCTGTGGGCAAATACAAACTGCCCGAGG
AATTGCTGCTGAAATCTAACAAAATCCAATATCTCGATGAGAACCTGCCG
ATATTCATTGAAAACGGAGATAAAATATTGATTTTCAGCCAGTTCATCAT
GGTGCTCGACATAGTCGAGGAATTCCTCAAGTACAAACAGATTACCTACC
TGAGATTGGATGGATCGACTTCTACTGATGACCGACAGGATTATATCGAT
CAGTTCAATGAGGACGACGATATCAAAGTGTTCATTTTGACAACTCGCGC
AGGAGGTTTAGGCATCAATTTGACATCGGCAAATGTTGTAATCATATTCG
ATATTGATTATAATCCTTACAATGATCGGCAAGCAGAGGATCGAAGTCAT
AGACTGGGACAAATGAGAGATGTAAAAGTGATAAAATTGATTTCCAAAGG
AACAATTGATGAATGCATTTTGAGAATCGCCAACGAAAAATTAAAATTGG
AACAAATAACAATGACATACGACATTGACAATGACGATGAAAGTAAGAGT
AGTTCTTCAGAACCAAAAGATGTAGATTTCGGATCACTATTGAAACAAGC
GATGGATATTTAAAGATCAAATATTGCTGGCAGCATTAAATATTTAATAA
ATTTAAAAAATGTATT
back to top

protein sequence of SMED30005925-orf-1

>SMED30005925-orf-1 ID=SMED30005925-orf-1|Name=SMED30005925-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=732bp
MTKNDSSNYSKTFKRTCIMDDFVIKRPRLENKDNDENVLDDSYISDKVIA
KKRANLLDSSDSEVSDDQYHEESNSMKLDEINILDYFNKSTVDDLSQITG
CSEIKALRIMKDRPYKTIDDLKANKISQKLIDGCLEILVIKQNLIELLKK
CVQISANLLERIRPLLVSVDIDSSLGTENLILDQPHYINPSLHLKSYQLI
GINWLRIVHEENLNGILADEMGLGKTVQTIAFLSYLLDSGLKGPHIIVVP
TSTLNNWERELHKWCLNLKVIVYYGNQDERRRMRYRIAQSDSFNVLLTTY
NISISSKEDRLFIKKLDFYYGVFDEAHMLKNMMSIRYKYLSNFKIKRKLL
LTGTPLQNNMVELISLLSFVMPNIFLTENEGLKKIFQMSQKSTLKQSSFN
DDKISQIKEMLAPFCLRRLKSQVLSQMPLKTTEIALLPLSEAQSILYRQT
IERMKNCQDDAFGVKYALSTVMELRKLSNHSLLVRDHYTDSILRKISHDM
LLDEDHITSNTELIFEDLSYMHDFEIHQNCLKYPHAVGKYKLPEELLLKS
NKIQYLDENLPIFIENGDKILIFSQFIMVLDIVEEFLKYKQITYLRLDGS
TSTDDRQDYIDQFNEDDDIKVFILTTRAGGLGINLTSANVVIIFDIDYNP
YNDRQAEDRSHRLGQMRDVKVIKLISKGTIDECILRIANEKLKLEQITMT
YDIDNDDESKSSSSEPKDVDFGSLLKQAMDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0032508DNA duplex unwinding
GO:0043044ATP-dependent chromatin remodeling
GO:0000729DNA double-strand break processing
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0016569covalent chromatin modification
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR038718SNF2-like_sf
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR000330SNF2_N
IPR027417P-loop_NTPase
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005694chromosome
GO:0035861site of double-strand break
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 581..664
e-value: 4.7E-23
score: 92.6
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 552..664
e-value: 3.0E-20
score: 72.6
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 555..720
score: 15.588
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 190..386
e-value: 8.7E-30
score: 115.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 206..373
score: 23.436
NoneNo IPR availableGENE3DG3DSA:1.10.150.320coord: 69..138
e-value: 4.7E-5
score: 25.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 543..728
e-value: 4.0E-60
score: 204.9
NoneNo IPR availablePANTHERPTHR10799:SF964SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY A CONTAINING DEAD/H BOX 1coord: 51..708
NoneNo IPR availablePANTHERPTHR10799SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN SUBFAMILY-RELATEDcoord: 51..708
NoneNo IPR availableCDDcd17998DEXHc_SMARCAD1coord: 194..376
e-value: 1.23508E-95
score: 292.367
NoneNo IPR availableCDDcd18793SF2_C_SNFcoord: 550..675
e-value: 7.98132E-56
score: 184.988
NoneNo IPR availableSUPERFAMILYSSF81585PsbU/PolX domain-likecoord: 88..138
IPR038718SNF2-like, N-terminal domain superfamilyGENE3DG3DSA:3.40.50.10810coord: 172..441
e-value: 3.9E-83
score: 280.4
IPR000330SNF2-related, N-terminal domainPFAMPF00176SNF2_Ncoord: 210..483
e-value: 9.6E-53
score: 179.1
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 193..418
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 317..700