tRNA wybutosine-synthesizing protein 5

Overview
NametRNA wybutosine-synthesizing protein 5
Smed IDSMED30005921
Length (bp)1063
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA wybutosine-synthesizing protein 5 (SMED30005921) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA wybutosine-synthesizing protein 5 (SMED30005921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA wybutosine-synthesizing protein 5 (SMED30005921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA wybutosine-synthesizing protein 5 (SMED30005921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005921SMESG000010398.1 SmedASXL_011607SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30005921SMESG000010398.1 dd_Smed_v4_8202_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:HGNC Symbol;Acc:HGNC:26754])

HSP 1 Score: 264.233 bits (674), Expect = 3.686e-86
Identity = 128/284 (45.07%), Postives = 177/284 (62.32%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLV 981
            M+  + +R P++   +++G C  KW   DYL +      V +H+A   +MDF +KNF Y+ +  D  ++ AA +       SED  YYLR+LG D RK+ A    Q+P L  D++ P  F   ++FSSVFRISS   +LWTHYD MDN+LIQV G+K ++ +SP DA+YLYL+  KS +L  ++ DL +YPL S+A     +L  GDV+FIPALWFHNV +  F V VN+FW HL  E YD+ D YGNKDP   +R  Q +D  ++ L+ LPEEYR  Y   +V
Sbjct:   20 MQHLYPQRKPLVLEGIDLGPCTSKW-TVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMV 302          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 64.3142 bits (155), Expect = 9.239e-11
Identity = 60/231 (25.97%), Postives = 103/231 (44.59%), Query Frame = 1
Query:  178 PVIFRNL-NIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSP----------NEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            PVI + + +   C++KW + +Y+ E      V V + +     + ++ +    M +++FI    ++   +  YL          +    DQ P L +D+ IP   S           N +F     IS        H D   N L+QV G K I  YSP ++  LY  D      +  +  E+ DL ++P  ++A  L   LS G+++FIP  ++H V+A   S +V+ +W
Sbjct:  205 PVILKGVADHWPCMQKW-SLEYIQEIAGCRTVPVEVGSR----YTDEEWSQTLMTVNEFISKYIVNEPRDVGYL---------AQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISP------LHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 415          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Match: KDM8 (lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:25840])

HSP 1 Score: 63.929 bits (154), Expect = 1.227e-10
Identity = 60/231 (25.97%), Postives = 103/231 (44.59%), Query Frame = 1
Query:  178 PVIFRNL-NIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSP----------NEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            PVI + + +   C++KW + +Y+ E      V V + +     + ++ +    M +++FI    ++   +  YL          +    DQ P L +D+ IP   S           N +F     IS        H D   N L+QV G K I  YSP ++  LY  D      +  +  E+ DL ++P  ++A  L   LS G+++FIP  ++H V+A   S +V+ +W
Sbjct:  243 PVILKGVADHWPCMQKW-SLEYIQEIAGCRTVPVEVGSR----YTDEEWSQTLMTVNEFISKYIVNEPRDVGYL---------AQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISP------LHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWW 453          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Match: JMJD7 (jumonji domain containing 7 [Source:HGNC Symbol;Acc:HGNC:34397])

HSP 1 Score: 61.2326 bits (147), Expect = 2.210e-10
Identity = 47/170 (27.65%), Postives = 78/170 (45.88%), Query Frame = 1
Query:  415 VRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLK 837
            V+K+ ++ P + P L  DL+    ++ +E    +     F +         H D  +N+   V GEK  +F+ P D           A Y   E+G   +             L P + DL +YP  S+A  L   +  G+++++PALWFH+VQ +   +AVN FWY ++
Sbjct:   29 VQKQCSNLPSELPQLLPDLESHVPWA-SEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVN-FWYDME 196          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Match: JMJD7 (jumonji domain containing 7 [Source:HGNC Symbol;Acc:HGNC:34397])

HSP 1 Score: 61.2326 bits (147), Expect = 6.383e-10
Identity = 48/174 (27.59%), Postives = 75/174 (43.10%), Query Frame = 1
Query:  415 VRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWT---------HYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLK 837
            V+K+ ++ P + P L  DL+     S   + S            W          H D  +N+   V GEK  +F+ P D           A Y   E+G   +             L P + DL +YP  S+A  L   +  G+++++PALWFH+VQ +   +AVN FWY ++
Sbjct:  128 VQKQCSNLPSELPQLLPDLE-----SHVPWASEALGKMPDAVNFWLGEAAAVTSLHKDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVDEEAMEKVPWIPLDPLAPDLARYPSYSQAQALRCTVRAGEMLYLPALWFHHVQQSQGCIAVN-FWYDME 295          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Celegans
Match: jmjd-5 (JuMonJi (Transcription factor) Domain protein [Source:UniProtKB/TrEMBL;Acc:Q17765])

HSP 1 Score: 58.151 bits (139), Expect = 4.501e-9
Identity = 69/265 (26.04%), Postives = 115/265 (43.40%), Query Frame = 1
Query:   82 NKTMKEVEIINLENFKYLESIDVMKEN-FKKRV-------PVIFRNLNIGK-CVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVF----SPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDG---KSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWY 828
            N T     +I L N K ++  D   EN F+K +       P+I R  +     +EKW +  +L +   S    V +       + ++N+  K M   +FIR    +SE+   YL          +    DQ P+L  D+ IP V     S  E       I  ++     H D   N+ +QV G K     +P  +E +Y  DG    +  +  E+ DL  +P   +   L   ++ GD +FIP  W+H V++ + S++++ FW+
Sbjct:  332 NTTNTYPALIPLSNSKSIDECDEDDENSFEKLISAVQNNTPLIVRRHSSNMPAIEKW-SFPFLLQELHSRTFPVEIGTK----YSDENWSQKLMTFKEFIR----NSENERLYL---------AQHRLFDQVPHLKRDVIIPDVCFGESSNPENVDMNMWIGPQDTVSPLHTDPRKNMFVQVHGTKLFRMVAPESSESVYPFDGILSNTSQVDVENPDLKIFPNFEQVEVLDAVINPGDAIFIPEKWWHFVRSTSPSISIS-FWF 577          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Fly
Match: JMJD7 (gene:FBgn0036366 transcript:FBtr0075825)

HSP 1 Score: 56.225 bits (134), Expect = 1.337e-8
Identity = 66/284 (23.24%), Postives = 108/284 (38.03%), Query Frame = 1
Query:  139 SIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMD--FKNKNFEY------KNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSP-----------------------FDAEYLYLEDGKSPI-----LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVY 867
            +++  +E + K  PV+ R       + KW    YL E+     V V +      D        EY        M++ + +R    D     +Y       ++K+ ++     P LA DL++  +    + F+       F +  +      H D  +N+   + G K  +   P                       F  E L  E+G         + P S DL +YP  +RA PL   +  GD++++P  WFH+V  +   +AVN FWY L    YD R  Y
Sbjct:   33 ALEFCREFYSKNQPVVIRKALNWPAIGKW-TPKYLIEALGDRSVDVAITPNGYADGLATQNGQEYFVLPLETKMKLSEVVRRLD-DPTGAVHY-------IQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAVNFWLGDERAVTSMHKDPYENVYCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVDPLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHVSQSHKCIAVN-FWYDLD---YDSRYCY 303          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Fly
Match: JMJD5 (gene:FBgn0035166 transcript:FBtr0331402)

HSP 1 Score: 55.0694 bits (131), Expect = 4.633e-8
Identity = 42/136 (30.88%), Postives = 63/136 (46.32%), Query Frame = 1
Query:  445 QYPNLAEDLQIPPVFS-PNEYFSSVFRISSKNCRLWT----HYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            Q P L ED+ IP   +  NE       I +      T    HYD   N+L QV G K II  +P D + LY  D +    +  +     D   YPL+++       L  GD +++P  W+H V++ A S +V+ +W
Sbjct:  258 QIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 393          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Fly
Match: JMJD5 (gene:FBgn0035166 transcript:FBtr0300712)

HSP 1 Score: 54.6842 bits (130), Expect = 5.382e-8
Identity = 42/136 (30.88%), Postives = 63/136 (46.32%), Query Frame = 1
Query:  445 QYPNLAEDLQIPPVFS-PNEYFSSVFRISSKNCRLWT----HYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            Q P L ED+ IP   +  NE       I +      T    HYD   N+L QV G K II  +P D + LY  D +    +  +     D   YPL+++       L  GD +++P  W+H V++ A S +V+ +W
Sbjct:  265 QIPALKEDISIPDYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWW 400          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:557725])

HSP 1 Score: 256.529 bits (654), Expect = 3.555e-83
Identity = 136/303 (44.88%), Postives = 176/303 (58.09%), Query Frame = 1
Query:  145 DVMKENF-----KKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            DV KE F      +R P + + + IG CV  W    +L E      V VH++    MDF +KNF Y+ +  D+FI+ AA         SED  YYLR+LG D RKE A    Q+P LAED  +P  F P ++FSSVFRISS   +LWTHYD MDN+L QV G+K ++ YSP DA +LYL   KS +L  +S DL  YP   +A      L  GD++FIPALWFHN  A  F V VNVFW HL  E YD++D YGNKDP+   R  QS++  +  L  LP +YR  Y   +V ++  +   +KP
Sbjct:   14 DVDKETFLRDIYPQRRPAVLKRVPIGPCVRTWTVC-FLAEKGGDREVKVHVSPEPRMDFLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPADLRKQFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPEDALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECFLEPGDLLFIPALWFHNTLALQFGVGVNVFWRHLPSESYDKKDPYGNKDPVAATRALQSLERTLGILDELPPDYRDFYARRMVLRIQSRAYIRKP 315          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:557725])

HSP 1 Score: 256.529 bits (654), Expect = 3.555e-83
Identity = 136/303 (44.88%), Postives = 176/303 (58.09%), Query Frame = 1
Query:  145 DVMKENF-----KKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            DV KE F      +R P + + + IG CV  W    +L E      V VH++    MDF +KNF Y+ +  D+FI+ AA         SED  YYLR+LG D RKE A    Q+P LAED  +P  F P ++FSSVFRISS   +LWTHYD MDN+L QV G+K ++ YSP DA +LYL   KS +L  +S DL  YP   +A      L  GD++FIPALWFHN  A  F V VNVFW HL  E YD++D YGNKDP+   R  QS++  +  L  LP +YR  Y   +V ++  +   +KP
Sbjct:   14 DVDKETFLRDIYPQRRPAVLKRVPIGPCVRTWTVC-FLAEKGGDREVKVHVSPEPRMDFLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPADLRKQFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPEDALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECFLEPGDLLFIPALWFHNTLALQFGVGVNVFWRHLPSESYDKKDPYGNKDPVAATRALQSLERTLGILDELPPDYRDFYARRMVLRIQSRAYIRKP 315          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 58.151 bits (139), Expect = 5.423e-9
Identity = 57/212 (26.89%), Postives = 90/212 (42.45%), Query Frame = 1
Query:  235 DYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFI-RAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPV----------FSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            DYL        V + + +     + ++ +  K + ++DFI R      ED   YL          +    DQ P L ED++IP             + N +F     +S        H D   N L QV G K I  YSP + + LY  + +    +  +  E+ DL ++P  SRA+     L  GDV+FIP   +H V++   S +V+ +W
Sbjct:  213 DYLRTVAGCRTVPIEVGSK----YTDEEWSQKLITVNDFIDRYITGTEEDGVGYL---------AQHQLFDQVPELKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSP------LHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 405          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Match: kdm8 (lysine (K)-specific demethylase 8 [Source:NCBI gene;Acc:436936])

HSP 1 Score: 58.151 bits (139), Expect = 5.423e-9
Identity = 57/212 (26.89%), Postives = 90/212 (42.45%), Query Frame = 1
Query:  235 DYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFI-RAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPV----------FSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            DYL        V + + +     + ++ +  K + ++DFI R      ED   YL          +    DQ P L ED++IP             + N +F     +S        H D   N L QV G K I  YSP + + LY  + +    +  +  E+ DL ++P  SRA+     L  GDV+FIP   +H V++   S +V+ +W
Sbjct:  213 DYLRTVAGCRTVPIEVGSK----YTDEEWSQKLITVNDFIDRYITGTEEDGVGYL---------AQHQLFDQVPELKEDIRIPDYCCLGEGDEDDITINAWFGPGGTVSP------LHQDPQQNFLAQVVGRKYIRLYSPEETKSLYPHESQLLHNTSQVEVENPDLVKFPDFSRASYEECVLCPGDVLFIPLQHWHYVRSLELSFSVSFWW 405          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Match: jmjd7 (jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-050417-86])

HSP 1 Score: 53.9138 bits (128), Expect = 1.037e-7
Identity = 65/258 (25.19%), Postives = 104/258 (40.31%), Query Frame = 1
Query:  178 PVIFRN-LNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKN-FEYKNMRMDDF-----IRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQ--IPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLK 837
            P I RN  N    + KW N  YL E   S ++SV +      D  N N F     R   F     I    I S   +Y        V+K+ ++  ++ P L  D+Q  IP +   +E    +     F +  ++     H D  +N+   + G+K  +   P D           A Y   +DG   I             L P   D  ++P    A  L   +  G+++++P+LWFH+V+ +   +AVN FWY ++
Sbjct:   46 PCIIRNAFNDWPALSKW-NPTYLREKVGSKVISVAVTPNGFADAVNGNRFVMPEERQMSFSSLLDIVEGKIKSSAVFY--------VQKQCSNLMEEIPELTGDVQTHIPWM---SEALGKLPDAVNFWLGEESAVTSMHKDHYENLYCVISGQKEFVLLPPTDRPFIPYELYQPATYRQKDDGTFEIVDEENSPKVPWIPLDPLKPDFERFPSYRHAKALHCTVKAGEMLYLPSLWFHHVRQSHGCIAVN-FWYDME 290          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:100493826])

HSP 1 Score: 268.085 bits (684), Expect = 1.260e-87
Identity = 137/306 (44.77%), Postives = 187/306 (61.11%), Query Frame = 1
Query:  103 EIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            E  N++  ++L+ I      +  R PV+ + L++G C  KW   DY+ ++  S  V +H++   +MDF  KNF Y+ +  D F++ AA +       SE+  YYLR+LG D RK+ A    Q+P+LA D+QIP  F  +++FSSVFRISS   +LWTHYD MDN+LIQV G+K ++ YSP DA YLYL   KS +L  ++ DL +YPL S A      L  GDV+FIPALWFHN  A  F V VNVFW HL  + YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:   12 EYTNVDRDRFLQDI------YPLRKPVVVKGLHLGACSTKW-TVDYISKTGGSKEVKIHVSELPQMDFIRKNFLYRTLPFDIFVQRAAEEKHTAFFISENEKYYLRSLGEDPRKDIADISKQFPHLATDIQIPEFFEKDQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPRDAPYLYLSGDKSEVLDVDNTDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVAVGFGVGVNVFWKHLPSQCYDKTDTYGNKDPSAASRAMQILDRALKTLDELPEEYRDFYARRMVLRVQAK 310          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Match: TYW5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:100493826])

HSP 1 Score: 267.7 bits (683), Expect = 1.112e-86
Identity = 135/304 (44.41%), Postives = 187/304 (61.51%), Query Frame = 1
Query:  109 INLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            I+L  +  ++    +++ +  R PV+ + L++G C  KW   DY+ ++  S  V +H++   +MDF  KNF Y+ +  D F++ AA +       SE+  YYLR+LG D RK+ A    Q+P+LA D+QIP  F  +++FSSVFRISS   +LWTHYD MDN+LIQV G+K ++ YSP DA YLYL   KS +L  ++ DL +YPL S A      L  GDV+FIPALWFHN  A  F V VNVFW HL  + YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:   65 ISLPEYTNVDRDRFLQDIYPLRKPVVVKGLHLGACSTKW-TVDYISKTGGSKEVKIHVSELPQMDFIRKNFLYRTLPFDIFVQRAAEEKHTAFFISENEKYYLRSLGEDPRKDIADISKQFPHLATDIQIPEFFEKDQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLYSPRDAPYLYLSGDKSEVLDVDNTDLVKYPLFSHARRYECYLEAGDVLFIPALWFHNTVAVGFGVGVNVFWKHLPSQCYDKTDTYGNKDPSAASRAMQILDRALKTLDELPEEYRDFYARRMVLRVQAK 367          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:496732])

HSP 1 Score: 62.003 bits (149), Expect = 3.130e-10
Identity = 69/267 (25.84%), Postives = 107/267 (40.07%), Query Frame = 1
Query:  178 PVIFRN-LNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNF----EYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQ--IPPVFSPNEYFSSVFRISSKNCRLWT---------HYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPILCPESA-------------DLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRR 858
            P I RN       + KW    YL     S  VSV +      D   KN     E + M + DF+      S     +       ++K+ ++  +++P L ED++  IP       + S     S      W          H D  +N+   + GEK  I + P D           A Y   EDG   ++  ESA             DL +YP   +  PL   +  G+++++P+LWFH+V+ +   +AVN FWY ++   YD R
Sbjct:   50 PCIIRNAFTHWPALHKWTFG-YLRTHIGSKKVSVAVTPNGYADAVYKNRFVMPEERTMFLSDFLDIVEKKSNTPGVFY------IQKQCSNLTEEFPELVEDVENHIP-------WMSETLGKSPDAVNFWLGESAAITSLHKDHYENLYCVISGEKHFILHPPSDRPFIPYEMFQPATYHVYEDGSFKVVDHESAEKVPWIPLDPLEPDLIRYPSYKQTKPLHCTVRAGEMLYLPSLWFHHVRQSHGCIAVN-FWYDME---YDIR 298          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Match: ada.2 (adenosine deaminase, gene 2 [Source:Xenbase;Acc:XB-GENE-5929084])

HSP 1 Score: 62.003 bits (149), Expect = 4.514e-10
Identity = 56/219 (25.57%), Postives = 93/219 (42.47%), Query Frame = 1
Query:  211 CVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPV----------FSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            C++KW + +Y+        V V L +     + +  +  + M +++FI    +D ++   YL          +    +Q P L ED+ IP             + N +F     +S        H D   N L Q+ G K I  YS  + E LY  D      +  +  ES D  ++P  S+A+     LS G V+FIP  W+H ++A   S +V+ +W
Sbjct:  244 CLKKW-SVEYIQRVAGCRTVPVELGSR----YTDAEWSQRLMTVNEFITKYILDKQNGIGYL---------AQHQLFEQIPELKEDICIPDYCCLGEASEDEITINAWFGPAGTVSP------LHQDPQQNFLAQIVGRKYIRVYSVAETEKLYPFDSSILHNTSQVDVESPDQNKFPRFSQASYQECILSPGQVLFIPVKWWHYIRALDLSFSVSFWW 442          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Match: rbfox2 (RNA binding fox-1 homolog 2 [Source:Xenbase;Acc:XB-GENE-489991])

HSP 1 Score: 48.521 bits (114), Expect = 9.238e-6
Identity = 36/129 (27.91%), Postives = 60/129 (46.51%), Query Frame = 1
Query:  511 SVFRISSKNCRLWTHYDTMD-NILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCP--ESA----------DLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA-NAFSVAVNVFWYHLKEEFYDR 855
            S   + S       H D+   N+++QV+G K+   Y P D  ++Y      P   P  ES+          D +++PL SR +P +  L  G V+ +P  W+H VQ+ +  +V++N  W  L  +   R
Sbjct:  123 SSLWVGSSGANTPCHVDSYGCNLVLQVQGRKTWHLYPPGDTPHMY------PTRIPYEESSIFSKVNVVNPDRSRFPLFSRTSPHVVTLHPGQVLLVPRHWWHYVQSVDDMTVSINS-WIELDSDHESR 244          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Match: Tyw5 (tRNA-yW synthesizing protein 5 [Source:MGI Symbol;Acc:MGI:1915986])

HSP 1 Score: 260.381 bits (664), Expect = 7.954e-85
Identity = 129/290 (44.48%), Postives = 177/290 (61.03%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            M+  + +R P++   L++G C  KW   DYL +   +  V +H+A   +MDF +KNF Y+ +  +  ++ AA +       SED  YYLR+LG D RK+ A    Q+P+L  D+  P  F   ++FSSVFRISS   +LWTHYD MDN LIQV G+K I  ++P DA+YLYL   KS +L  +S DL +YPL  +A     +L  GDV+FIPALWFHNV +  F V VN+FW HL  E YD  D YGNKDP+  +R  Q +D  ++ L+ LPEEYR  Y   +V ++  K
Sbjct:   20 MEHLYPQRKPLVLEGLDLGSCTSKW-TVDYLSQVGGTKEVKIHVAAVPQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILDRALKTLAELPEEYRDFYARQMVLRIQDK 308          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Match: Tyw5 (tRNA-yW synthesizing protein 5 [Source:MGI Symbol;Acc:MGI:1915986])

HSP 1 Score: 179.874 bits (455), Expect = 3.126e-54
Identity = 97/250 (38.80%), Postives = 133/250 (53.20%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKN----------------KNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYD 852
            M+  + +R P++   L++G C  KW   DYL +   +  V +H+A   +MDF                  KN  ++ MR   +             +     AD+R+       Q+P+L  D+  P  F   ++FSSVFRISS   +LWTHYD MDN LIQV G+K I  ++P DA+YLYL   KS +L  +S DL +YPL  +A     +L  GDV+FIPALWFHNV +  F V VN+FW HL  E YD
Sbjct:   14 MEHLYPQRKPLVLEGLDLGSCTSKW-TVDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHLEKTQGSRKNSFTGKDVADIRQ-------QFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYD 255          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Match: Kdm8 (lysine (K)-specific demethylase 8 [Source:MGI Symbol;Acc:MGI:1924285])

HSP 1 Score: 63.5438 bits (153), Expect = 1.277e-10
Identity = 60/231 (25.97%), Postives = 101/231 (43.72%), Query Frame = 1
Query:  178 PVIFRNL-NIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPV----------FSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            PVI   + +   C++KW +  Y+ E      V V + +     + ++++    M +D+FI+   +    +  YL          +    DQ P L  D+ IP             + N +F     IS        H D   N L+QV G K I  YSP ++E +Y  +      +  +  E+ DL ++P  + A  L   LS GD +FIPA ++H V++   S +V+ +W
Sbjct:  203 PVILEGVADHWPCMKKW-SLQYIQEIAGCRTVPVEVGSR----YTDEDWSQTLMTVDEFIQKFILSEAKDVGYL---------AQHQLFDQIPELKRDISIPDYCCLGNGEEEEITINAWFGPQGTISP------LHQDPQQNFLVQVLGRKYIRLYSPQESEAVYPHETHILHNTSQVDVENPDLEKFPKFTEAPFLSCILSPGDTLFIPAKYWHYVRSLDLSFSVSFWW 413          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Match: Jmjd7 (jumonji domain containing 7 [Source:MGI Symbol;Acc:MGI:3845785])

HSP 1 Score: 61.6178 bits (148), Expect = 2.848e-10
Identity = 49/170 (28.82%), Postives = 80/170 (47.06%), Query Frame = 1
Query:  415 VRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDG-----------KSPI--LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLK 837
            V+K+ ++ P + P L  D++    ++ +E    +     F +   +     H D  +N+   V GEK  + + P D           A Y   E+G           K P   L P + DLTQYP  S+A  L   +  G+++++PALWFH+VQ +   +AVN FWY ++
Sbjct:  128 VQKQCSNLPTELPQLLSDIESHVPWA-SESLGKMPDAVNFWLGDASAVTSLHKDHYENLYCVVSGEKHFLLHPPSDRPFIPYNLYTPATYQLTEEGTFRVVDEEAMEKVPWIPLDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVN-FWYDME 295          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Match: Gm28042 (predicted gene, 28042 [Source:MGI Symbol;Acc:MGI:5547778])

HSP 1 Score: 55.4546 bits (132), Expect = 1.124e-9
Identity = 29/67 (43.28%), Postives = 43/67 (64.18%), Query Frame = 1
Query:  667 LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVY 867
            L P + DLTQYP  S+A  L   +  G+++++PALWFH+VQ +   +AVN FWY ++   YD +  Y
Sbjct:    4 LDPLAPDLTQYPSYSQAQALHCTVRAGEMLYLPALWFHHVQQSHGCIAVN-FWYDME---YDLKYSY 66          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Match: sp|E1C7T6|TYW5_CHICK (tRNA wybutosine-synthesizing protein 5 OS=Gallus gallus OX=9031 GN=TYW5 PE=3 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 5.443e-88
Identity = 133/290 (45.86%), Postives = 180/290 (62.07%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            +++ + +R PV+ + + +G C  KW   DYL ++  S  V +H++   +MDF +KNF Y+ +  D F+R AA         SED  YYLR++G DVRK+ A    Q+P LAED+QIP  F   ++FSSVFRISS   +LWTHYD MDN LIQV G K ++ YSP D  YLYL   KS +L  ++ D  +YPL ++A      L  GDV+FIPA+WFHNV +  F VA+NVFW HL  E YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:   23 LRDVYPRREPVVLKGMELGPCTTKW-TVDYLSQAAGSKEVKIHVSAVPQMDFLSKNFVYRTLPFDVFVRRAAEVKHKDYFLSEDEKYYLRSVGEDVRKDIADIRKQFPVLAEDVQIPEYFEKEQFFSSVFRISSAGLQLWTHYDVMDNFLIQVTGRKRVVLYSPRDVPYLYLSGTKSEVLDVDNPDFEKYPLFAKAKRYQCYLEAGDVLFIPAMWFHNVISEEFGVALNVFWKHLPAECYDKSDTYGNKDPTAASRAIQILDRALKTLEELPEEYRDFYARRMVLRIQEK 311          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Match: sp|A2RUC4|TYW5_HUMAN (tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.770e-85
Identity = 128/284 (45.07%), Postives = 177/284 (62.32%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLV 981
            M+  + +R P++   +++G C  KW   DYL +      V +H+A   +MDF +KNF Y+ +  D  ++ AA +       SED  YYLR+LG D RK+ A    Q+P L  D++ P  F   ++FSSVFRISS   +LWTHYD MDN+LIQV G+K ++ +SP DA+YLYL+  KS +L  ++ DL +YPL S+A     +L  GDV+FIPALWFHNV +  F V VN+FW HL  E YD+ D YGNKDP   +R  Q +D  ++ L+ LPEEYR  Y   +V
Sbjct:   20 MQHLYPQRKPLVLEGIDLGPCTSKW-TVDYLSQVGGKKEVKIHVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVADIRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLFSPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISEEFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARRMV 302          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Match: sp|A2RSX7|TYW5_MOUSE (tRNA wybutosine-synthesizing protein 5 OS=Mus musculus OX=10090 GN=Tyw5 PE=2 SV=2)

HSP 1 Score: 260.381 bits (664), Expect = 5.564e-84
Identity = 129/290 (44.48%), Postives = 177/290 (61.03%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            M+  + +R P++   L++G C  KW   DYL +   +  V +H+A   +MDF +KNF Y+ +  +  ++ AA +       SED  YYLR+LG D RK+ A    Q+P+L  D+  P  F   ++FSSVFRISS   +LWTHYD MDN LIQV G+K I  ++P DA+YLYL   KS +L  +S DL +YPL  +A     +L  GDV+FIPALWFHNV +  F V VN+FW HL  E YD  D YGNKDP+  +R  Q +D  ++ L+ LPEEYR  Y   +V ++  K
Sbjct:   20 MEHLYPQRKPLVLEGLDLGSCTSKW-TVDYLSQVGGTKEVKIHVAAVPQMDFISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILDRALKTLAELPEEYRDFYARQMVLRIQDK 308          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Match: sp|Q08BV2|TYW5_DANRE (tRNA wybutosine-synthesizing protein 5 OS=Danio rerio OX=7955 GN=tyw5 PE=2 SV=1)

HSP 1 Score: 256.529 bits (654), Expect = 2.408e-82
Identity = 136/303 (44.88%), Postives = 176/303 (58.09%), Query Frame = 1
Query:  145 DVMKENF-----KKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            DV KE F      +R P + + + IG CV  W    +L E      V VH++    MDF +KNF Y+ +  D+FI+ AA         SED  YYLR+LG D RKE A    Q+P LAED  +P  F P ++FSSVFRISS   +LWTHYD MDN+L QV G+K ++ YSP DA +LYL   KS +L  +S DL  YP   +A      L  GD++FIPALWFHN  A  F V VNVFW HL  E YD++D YGNKDP+   R  QS++  +  L  LP +YR  Y   +V ++  +   +KP
Sbjct:   14 DVDKETFLRDIYPQRRPAVLKRVPIGPCVRTWTVC-FLAEKGGDREVKVHVSPEPRMDFLHKNFVYRTLPFDEFIKRAAEAKHPEFFISEDESYYLRSLGEDARKEPADLRKQFPELAEDFHVPQFFEPEQFFSSVFRISSPGLQLWTHYDVMDNLLAQVTGKKRVVLYSPEDALHLYLTGDKSEVLDIDSPDLQLYPEFVKARRYECILEPGDLLFIPALWFHNTLALQFGVGVNVFWRHLPSESYDKKDPYGNKDPVAATRALQSLERTLGILDELPPDYRDFYARRMVLRIQSRAYIRKP 315          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Match: sp|Q4IER0|TYW4_GIBZE (tRNA wybutosine-synthesizing protein 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) OX=229533 GN=PPM2 PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.939e-40
Identity = 103/297 (34.68%), Postives = 152/297 (51.18%), Query Frame = 1
Query:  154 KENFKK----RVPVIFRNLNIGKCVEKWQNNDYLFES-NPSHIVSVH--LANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEK-AHFPDQYPNLAEDLQIPPVFSP--NEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQ-ANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQ 1011
            K +F+K    R PVI   L++G CVEKW N++Y+ +S   +  V VH    +T +MDF +KNF Y       F+  AA        YLRAL  +   E  A+  + +P LA+D ++P       +  FSSV RIS +   +W HYD M N+  Q++G K ++ + P D  +L    G S       + L  + L S   P    L+ GD++FIPA+WFH        SVAVNVF+  L+  +   RDVYGN+D     +  Q I    ++   LP E R  Y    +++L+ +LL +
Sbjct:  703 KSDFEKLVQNRKPVIIEGLDLGGCVEKW-NSEYVIQSVGETKEVVVHECQTSTGKMDFNSKNFRYVTESFSSFMTKAA---RGEALYLRALSEEKPTEAPANLAEDFPGLADDFRLPEELGSVKDRMFSSVLRISGR-ANMWLHYDVMANVYTQIQGSKRMVLFPPTDVSHLAFAPGASSSSLDIFSALDTHQLAS-TNPHEAFLNPGDLLFIPAMWFHTASPVTDLSVAVNVFFRDLESGYSTGRDVYGNRDLAAYEKGRQDISRITKSFDRLPSEIRQFY----LRRLADELLHE 989          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Match: A0A2I0UQG9 (Trna wybutosine-synthesizing protein 5 OS=Limosa lapponica baueri OX=1758121 GN=llap_1379 PE=4 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.826e-88
Identity = 138/309 (44.66%), Postives = 190/309 (61.49%), Query Frame = 1
Query:   94 KEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            +E  ++ +E    +     +++ + +R+PV+ + + +G C+ KW   DYL  +  S  V +H++   +MDF +KNF Y+ +  D F+R AA         SED  YYLR++GAD RK+ A    Q+P LAED+QIP  F   ++FSSVFRISS   +LWTHYD MDN LIQV G+K ++ YSP DA YLYL   KS +L  ++ DL +YPL  +A      L  GDV+FIPALWFHNV +  F VA+NVFW HL  E YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:    4 REQAVVPVEVLAAVTREQFLRDVYPRRMPVVLKGMELGTCITKW-TVDYLSNAEGSKEVKIHVSAVPQMDFLSKNFVYRTLPFDVFVRRAAEVKHKEYFLSEDEKYYLRSVGADARKDIADIRKQFPILAEDIQIPEYFEKEQFFSSVFRISSAGLQLWTHYDVMDNFLIQVTGKKRVVLYSPRDAPYLYLSGTKSEVLDVDNPDLEKYPLFVKAKRYQCFLEAGDVLFIPALWFHNVISEEFGVALNVFWKHLPAESYDKTDTYGNKDPTAASRAIQILDRALKTLEELPEEYRDFYARRMVLRIQEK 311          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Match: A0A210QRN3 (tRNA wybutosine-synthesizing protein 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24310 PE=4 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.051e-87
Identity = 136/296 (45.95%), Postives = 189/296 (63.85%), Query Frame = 1
Query:  154 KENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNW-------YYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLL-KQKP 1017
            +E + KR PVI R ++IG+CV+KW++ +YL        V +H++ T +MDF  KNF YK++   DF++ A+ D    +       YYLRALG D RK+KA    Q+P LA+D++ P  F P + FSSVFRI+SK  +LWTHYD MDN+L+QV G K +I +SP + + +YL   KS +L  ++ D  ++P   +A    G L  GD++FIPALWFHNV    + VAVNVFW HL +  YD RDVYGNKD +P +R  Q +D  ++ L  LPEEYR  YG  L+ ++  K+L K KP
Sbjct:   18 EEIYPKRQPVILRGVDIGQCVDKWRSVNYLTTQGGQMPVKIHVSATPQMDFIKKNFSYKSLPFSDFVQRASEDEHTEFFETKTENYYLRALGDDPRKDKADIHQQFPRLADDIKFPKFFPPEKLFSSVFRIASKGTQLWTHYDVMDNLLMQVVGRKRVILFSPAEVDKMYLNGDKSEVLDIDNPDPGKFPKFLKAHRHEGILEPGDILFIPALWFHNVIYKDYGVAVNVFWKHLDDSLYDHRDVYGNKDHVPYSRAQQILDRALKTLEELPEEYREFYGHRLISRIEKKVLQKDKP 313          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Match: C3YZ25 (JmjC domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_118314 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.906e-87
Identity = 134/295 (45.42%), Postives = 184/295 (62.37%), Query Frame = 1
Query:  151 MKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQK 1014
            + E + KRVP + R ++IG CV  W   DYLF+   S  V +H+  T +MDF NKNF Y+ +  D+F+  AA         S+D  YYLR+LG D RK+ A    Q+P LA+D+  P  F+P+++FSSVFRI S   +LWTHYD MDN+LIQV G K ++ +SP DA +LYL   KS +L  E+ DL ++P  S+A P    L  GD++F+PALWFHNV +  F VA+N+FW HL   FYD +D YGNKD L   R  Q +D  ++ L  LP EY+  YG  +V K+   +L ++
Sbjct:   22 LSEIYPKRVPAVLRGVDIGPCVNLW-TTDYLFQKGGSRQVKIHVCPTAQMDFINKNFAYRTLPFDEFVTRAAEEKHKDFFHSQDEKYYLRSLGEDPRKDIADIRTQFPELADDIIFPEFFAPSQFFSSVFRIGSPGVQLWTHYDIMDNLLIQVSGRKRVVLFSPRDATHLYLTGDKSAVLDLENPDLERFPQFSQARPYTCTLQPGDILFLPALWFHNVVSLDFGVAINIFWRHLDPGFYDNKDPYGNKDLLSGQRALQILDRALKTLDELPVEYKDFYGRRMVSKIQQTVLDKE 315          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Match: A0A091I1V0 (tRNA wybutosine-synthesizing protein 5 (Fragment) OS=Calypte anna OX=9244 GN=N300_06719 PE=4 SV=1)

HSP 1 Score: 274.248 bits (700), Expect = 2.935e-87
Identity = 137/286 (47.90%), Postives = 177/286 (61.89%), Query Frame = 1
Query:  163 FKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            F +R PV+   L +G C  KW   DYL ++  S  V +H++   +MDF +KNF Y+ +  D F+R AA         SED  YYLR++G D RK+ A    Q+P LAED+QIP  F   ++FSSVFRISS   +LWTHYD MDN LIQV G+K ++ YSP DA YLYL   KS +L  ++ DL +YPL  +A      L  GDV+FIPALWFHNV +  F VA+NVFW HL  E YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:    2 FPQRKPVVLTGLELGPCTTKW-TVDYLSQAEGSKAVKIHVSGVPQMDFLSKNFVYRTLPFDVFVRRAAEVKHKEYFLSEDEKYYLRSVGEDARKDIADIRKQFPVLAEDVQIPEYFEKEQFFSSVFRISSAGLQLWTHYDVMDNFLIQVTGKKRVVLYSPRDAPYLYLSGSKSEVLDVDNPDLEKYPLFGKAKRYQCLLEAGDVLFIPALWFHNVISEEFGVALNVFWKHLPAESYDKSDTYGNKDPTAASRAIQILDRALKTLEELPEEYRDFYARRMVLRIQEK 286          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Match: A0A1V4L0I7 (tRNA wybutosine-synthesizing protein 5 OS=Patagioenas fasciata monilis OX=372326 GN=TYW5 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.433e-87
Identity = 134/305 (43.93%), Postives = 188/305 (61.64%), Query Frame = 1
Query:  106 IINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAA-------IDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            ++ +E  + +     +++ + +R PV+ + + +G C  KW   DYL ++  S  V +H++   +MDF +KNF Y+ +  D F+R AA         SED  YYLR++G D RK+ A    Q+P LA+D+QIP  F  +++FSSVFRISS   +LWTHYD MDN LIQV G+K ++ YSP DA YLYL   KS +L  ++ DL +YPL  +A      L  GD++FIPALWFHNV +  F VA+NVFW HL  E YD+ D YGNKDP   +R  Q +D  ++ L  LPEEYR  Y   +V ++  K
Sbjct:    3 VVPVERLEGVTRERFLRDIYPRRKPVVLKGMELGTCTTKW-TVDYLSQAEGSKEVKIHVSAVPQMDFLSKNFVYRTLPFDTFVRRAAEVKHKEYFLSEDEKYYLRSVGEDARKDIADISKQFPVLAQDVQIPEYFEKDQFFSSVFRISSAGLQLWTHYDVMDNFLIQVTGKKRVVLYSPRDAPYLYLSGTKSEVLDVDNPDLEKYPLFVKAKRYQCFLEAGDILFIPALWFHNVISEEFGVALNVFWKHLPAESYDKTDTYGNKDPTAASRALQILDRALKTLEDLPEEYRDFYARRMVLRIQQK 306          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:103030415])

HSP 1 Score: 259.996 bits (663), Expect = 1.127e-84
Identity = 132/303 (43.56%), Postives = 186/303 (61.39%), Query Frame = 1
Query:  145 DVMKENFKKRV-----PVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFI-RAAAID------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            DV KE F K++     P + R + +G C+EKW   DYL E      V +H+++  +MDF +KNF Y+ +   +F+ RAAA++      S+   YYLR+LG D RKE A+   Q+P+LAED  IPP F  +++FSSVFRISS   +LWTHYD MDN+L QV G K ++ YSP DA +LYL   KS +L  +S +L +YP   +A      L  GD+++IP+LWFHN  A  F V VNVFW HL  + YD++D YGNKDPL  +R  Q ++  +  L  LPE+Y+  Y   +V+ +  +    +P
Sbjct:   14 DVDKERFLKKIYPLRKPAVLRGVPLGPCLEKW-TVDYLSERGGHREVKIHVSSLPQMDFLHKNFVYRTLPFAEFVQRAAAVEHPEFFISKHESYYLRSLGEDARKEPANLKKQFPDLAEDFHIPPFFQSDQFFSSVFRISSSGLQLWTHYDVMDNLLAQVSGRKRVVLYSPQDALHLYLSGDKSEVLDIDSPNLERYPDFVKACRYECVLEPGDLLYIPSLWFHNTLALQFGVGVNVFWRHLSMDSYDKKDPYGNKDPLAASRALQCVERALAGLEELPEDYQDFYARRMVQLIQSRAYAAQP 315          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:103030415])

HSP 1 Score: 240.736 bits (613), Expect = 2.443e-77
Identity = 123/297 (41.41%), Postives = 178/297 (59.93%), Query Frame = 1
Query:  145 DVMKENFKKRV-----PVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFI-RAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            DV KE F K++     P + R + +G C+EKW   DYL E      V +H+++  +MDF +KNF Y+ +   +F+ RAAA++  + +         + KE A+   Q+P+LAED  IPP F  +++FSSVFRISS   +LWTHYD MDN+L QV G K ++ YSP DA +LYL   KS +L  +S +L +YP   +A      L  GD+++IP+LWFHN  A  F V VNVFW HL  + YD++D YGNKDPL  +R  Q ++  +  L  LPE+Y+  Y   +V+ +  +    +P
Sbjct:   14 DVDKERFLKKIYPLRKPAVLRGVPLGPCLEKW-TVDYLSERGGHREVKIHVSSLPQMDFLHKNFVYRTLPFAEFVQRAAAVEHPEFF---------ISKEPANLKKQFPDLAEDFHIPPFFQSDQFFSSVFRISSSGLQLWTHYDVMDNLLAQVSGRKRVVLYSPQDALHLYLSGDKSEVLDIDSPNLERYPDFVKACRYECVLEPGDLLYIPSLWFHNTLALQFGVGVNVFWRHLSMDSYDKKDPYGNKDPLAASRALQCVERALAGLEELPEDYQDFYARRMVQLIQSRAYAAQP 300          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:103030415])

HSP 1 Score: 236.884 bits (603), Expect = 6.498e-76
Identity = 118/283 (41.70%), Postives = 171/283 (60.42%), Query Frame = 1
Query:  172 RVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFI-RAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKP 1017
            R P + R + +G C+EKW   DYL E      V +H+++  +MDF +KNF Y+ +   +F+ RAAA++  + +         + KE A+   Q+P+LAED  IPP F  +++FSSVFRISS   +LWTHYD MDN+L QV G K ++ YSP DA +LYL   KS +L  +S +L +YP   +A      L  GD+++IP+LWFHN  A  F V VNVFW HL  + YD++D YGNKDPL  +R  Q ++  +  L  LPE+Y+  Y   +V+ +  +    +P
Sbjct:   19 RKPAVLRGVPLGPCLEKW-TVDYLSERGGHREVKIHVSSLPQMDFLHKNFVYRTLPFAEFVQRAAAVEHPEFF---------ISKEPANLKKQFPDLAEDFHIPPFFQSDQFFSSVFRISSSGLQLWTHYDVMDNLLAQVSGRKRVVLYSPQDALHLYLSGDKSEVLDIDSPNLERYPDFVKACRYECVLEPGDLLYIPSLWFHNTLALQFGVGVNVFWRHLSMDSYDKKDPYGNKDPLAASRALQCVERALAGLEELPEDYQDFYARRMVQLIQSRAYAAQP 291          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 56.9954 bits (136), Expect = 8.502e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  178 PVIFRN-LNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNF----EYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQ--IPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHL 834
            P I RN  +    + KW N  YL +   S ++SV +      D  N +     E + M     +       + N  +       V+K+ ++  ++ P L  D+Q  IP +   +E    +     F +  ++     H D  +N+   + GEK  I   P D           A Y   +DG   I             L P + DL +YP    A PL   +  G+++++P+LWFH+V+ +   +AVN FWY +
Sbjct:   46 PCIIRNAFSDWPALSKW-NPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFY------VQKQCSNLTEELPELTGDVQTHIPWM---SEALGKLPDAVNFWLGEEHAVTSMHKDHYENLYCVISGEKRFILIPPTDRPFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLERYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVRQSHGCIAVN-FWYDM 289          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:103032045])

HSP 1 Score: 56.9954 bits (136), Expect = 8.502e-9
Identity = 63/255 (24.71%), Postives = 105/255 (41.18%), Query Frame = 1
Query:  178 PVIFRN-LNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNF----EYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQ--IPPVFSPNEYFSSV-----FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHL 834
            P I RN  +    + KW N  YL +   S ++SV +      D  N +     E + M     +       + N  +       V+K+ ++  ++ P L  D+Q  IP +   +E    +     F +  ++     H D  +N+   + GEK  I   P D           A Y   +DG   I             L P + DL +YP    A PL   +  G+++++P+LWFH+V+ +   +AVN FWY +
Sbjct:   46 PCIIRNAFSDWPALSKW-NPAYLRDVVGSKVISVAVTPNGYADAVNGDRFVIPEERQMTFSSLLDIIEGKEKSNGVFY------VQKQCSNLTEELPELTGDVQTHIPWM---SEALGKLPDAVNFWLGEEHAVTSMHKDHYENLYCVISGEKRFILIPPTDRPFIPYELYQPATYKQKQDGSFEIVDEEDSEKVPWIPLDPLNPDLERYPSYRLAQPLYCTVKAGEMLYLPSLWFHHVRQSHGCIAVN-FWYDM 289          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Sea Lamprey
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:557725])

HSP 1 Score: 249.595 bits (636), Expect = 3.592e-81
Identity = 126/286 (44.06%), Postives = 179/286 (62.59%), Query Frame = 1
Query:  172 RVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDG-KSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLL 1005
            R P + R +++G C+ +W + +YL  +  +  V VH + +  MDF +KNF YK +  D+FI+  A +        E+  YYLRALG D RK+ A    Q+P LA+D+ +P  +   ++FSSVFRISS   +LWTHYD MDN+LIQV G K ++ +SP D  +LYL  G KS +L  +S DL  +P  S+AT     L  GDV+FIPALWFHNV +  F VAVNVFW HL  + YDR D YGNKDP+  AR  Q ++  +++L+ LP +Y+  YG  ++  +  K++
Sbjct:   28 RRPAVLRGVDLGPCLSRW-DAEYLRAAGGTRPVRVHASPSPRMDFIHKNFAYKTLPFDEFIQRTAEEKHSKFFFCENEKYYLRALGNDPRKDVADIRKQFPELAKDVILPEFYEEEQFFSSVFRISSPGIQLWTHYDVMDNMLIQVVGRKRVVLFSPSDVPFLYLNAGDKSEVLDIDSPDLKTFPEFSKATWHECVLEAGDVLFIPALWFHNVTSLEFGVAVNVFWRHLPLDAYDRTDTYGNKDPVAAARAMQVLERALKSLAELPPDYQRFYGQRMILTVQKKII 312          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Sea Lamprey
Match: jmjd7 (jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-050417-86])

HSP 1 Score: 57.3806 bits (137), Expect = 1.111e-9
Identity = 38/131 (29.01%), Postives = 58/131 (44.27%), Query Frame = 1
Query:  517 FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPIL-------------CPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLK 837
            F I  K      H D  +N+   + GEK    + P D           A Y   EDG+  ++              P   DL++YP  S A  +   L  G+ +++P+LWFH+VQ +   +AVN FWY ++
Sbjct:  166 FWIGEKEAITSLHKDHYENLYCVISGEKEFTLFPPTDRPFIPYEFYQPATYRQREDGEFEVVDEKYAEKVPWIPVNPLQPDLSRYPEFSGACAIHVTLRAGETLYLPSLWFHHVQQSHGCIAVN-FWYDME 295          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Sea Lamprey
Match: hif1an (hypoxia inducible factor 1 subunit alpha inhibitor [Source:NCBI gene;Acc:373126])

HSP 1 Score: 50.0618 bits (118), Expect = 8.983e-8
Identity = 33/107 (30.84%), Postives = 50/107 (46.73%), Query Frame = 1
Query:  550 THYDTMDNILIQVRGEKSIIFYSP--FDAEYLYLEDGKSPILCP---------ESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA---NAFSVAVNVFWY 828
             HYD   N   QV+G K  I + P  FD  Y Y      PI  P         E+ D  ++P   +A      +  GDV++IP  W+H++++      +++VN FWY
Sbjct:    6 CHYDEQQNFFAQVKGYKRCILFPPEQFDCLYPY------PIHHPCDRQSQVDFENPDYERFPNFRKAIGYETVVGPGDVLYIPMYWWHHIESLLDGGITISVN-FWY 105          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Match: EDO42971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S078])

HSP 1 Score: 254.988 bits (650), Expect = 4.805e-83
Identity = 131/313 (41.85%), Postives = 186/313 (59.42%), Query Frame = 1
Query:   82 NKTMKEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSE-------DNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMK 999
            N ++++++ + ++ F  L   + + + + KR P + R L+IG  V KW    YL E     +V VH+ + K MDF NKNF YK +  + F+  A+  ++       +  YYLR+LG D RK+ +   + +PNLA DLQ+P  +   ++FSSVFRI+S   +LWTHYD MDN+LIQV+G K  + +SP DA+ LYL   KS +L  +  D  +YP    A      L  GDV+FIPALWFHNV +  F VAVNVFW HL  E YD +DVYGNKD LP  R  Q +D  ++ L  LP+ Y+  Y   ++ KL  +
Sbjct:    7 NHSLRKIQRVPVKIFHGLSREEFLSDVYSKREPAVLRGLDIGAAVTKWTPK-YLAEVGGEKLVKVHVCSEKGMDFINKNFVYKTLPFNQFVMRASHSTQTDPFLAPEERYYLRSLGDDPRKDISDIEEHFPNLARDLQMPEFYPKEQFFSSVFRIASAGSQLWTHYDIMDNLLIQVKGCKRAVLFSPKDAKNLYLNGDKSDVLDIDCPDPAKYPKFYSAVQHEALLEPGDVLFIPALWFHNVVSLDFGVAVNVFWRHLPAEMYDNKDVYGNKDLLPATRAMQIVDRAVKLLQELPDGYKDFYARRIICKLEQR 318          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Match: EDO49037 (Jumonji-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU2])

HSP 1 Score: 57.3806 bits (137), Expect = 2.041e-9
Identity = 68/276 (24.64%), Postives = 115/276 (41.67%), Query Frame = 1
Query:  127 KYLESI--DVMKENFKKRVPVIFRN-LNIGKCVEKWQN---NDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDS------EDNWYYLRALGADVRKEKAHFPDQYPN-LAEDLQIPPVF---SP-------------NEYFSSVFRISSKNCRLWT---------HYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDG---KSPI--LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            K LESI  D+    F+ R PV+F+  +   K  + W        L E+     +SV +++  E    N +F  + M   + +  A  +S      E+   Y R+         +  P    N +  D Q+  +F   SP              ++ S++FR      +LW          HYD    +L+Q+RG+K II +S  D  +LY   G   KS I  +     ++  +P      P    ++ GD+++IP  W+H+V +    V+V + W
Sbjct:   22 KVLESISPDIFNHFFRSRAPVVFKGFVKAWKPCQMWTPLYLKTRLGET--CQTLSVMVSHDNERFVDNNDFTSRKMLTAEEMINAVFESNLNNRPENQRLYFRS---------SSMPTALHNDICIDSQMRELFDKVSPIVATESGDDENNFEQFVSAIFR--QHTTQLWVGTAGNITPLHYDRNHGLLMQIRGQKKIILFSTEDTNFLYPFPGYSEKSHISKVNLRDVNVNVFPKFVETQPYCCLINKGDMLYIPPFWWHDVTSLDNCVSVTLSW 284          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Match: EDO34427 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPF2])

HSP 1 Score: 57.7658 bits (138), Expect = 2.994e-9
Identity = 44/167 (26.35%), Postives = 73/167 (43.71%), Query Frame = 1
Query:  424 EKAHFPDQYPNLAEDLQIPPVFSP--NEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLY----------------------LEDGKSPILCPE---SADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA-----NAFSVAVNVFWY 828
            E    P  +P L +D+Q  P  +   N    +++ +S  N     H+D  +N L Q+ G+K +I Y P D   LY                      L D  S ++ P      D  ++P       +   +++G+V+F+P+ W+H VQ+     N  ++AVN FWY
Sbjct:  322 EYTSIPSYFPELKQDIQEMPCAAGLLNRKHLNIW-LSDGNTLGKLHFDPFENFLCQISGKKQVILYEPHDNTRLYEAHIQESMLEYNHAHKEFRRKKLLDSTSMVMSPVDILKPDYERFPKFQGVRAMNCTINEGEVLFMPSFWWHEVQSYPSHINPRNLAVN-FWY 486          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Match: EDO37253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD8])

HSP 1 Score: 57.3806 bits (137), Expect = 3.237e-9
Identity = 43/181 (23.76%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  511 SVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYL-----EDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA-NAFSVAVNVFWYHLKEEFYDRRD----VYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLN-LVKKLSMKLLKQKPD 1020
            +V   SS   +   HYD+++NI     G K+ +     D +Y+ +     +DG    +  E  D+ +YP L +   +  ++ +GD ++IP  W H VQ+    ++AVN++W    +  +++ D    +Y +KD +P++      +  +R      +E+    G   L K++ +K L+++ +
Sbjct:  155 AVMWFSSGGTKSVLHYDSLENINCLFSGNKNFVM---IDKKYMNMTHIDRKDGSFSNVDVERVDMQKYPGLGKVPWMNASMEEGDCMYIPWRWVHQVQSFGPRNLAVNIWWARFTQ--FNQTDCDTSIYKDKDLVPLSAFELKPNEVVR------QEFLEKTGRKPLTKEIWLKALREQAE 324          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Match: EDO44978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUA1])

HSP 1 Score: 55.4546 bits (132), Expect = 4.553e-9
Identity = 57/228 (25.00%), Postives = 104/228 (45.61%), Query Frame = 1
Query:  172 RVPVIFRNL-NIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRK-EKAHFPDQYP--NLAEDLQIPPVFSPNEYFSSVFRI----SSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKS-PILCP---ESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA-NAFSVAVN 816
            R PV+ R   N     EKW+N  YL + + +   +V   +T++  F  K    K + + +F+                   D+ K E  +    +P   L  DL +PP+ +  E  S++ ++    S+ N     H+D  DN+++ + G K  I      ++ +Y +D K  P + P   E  D   +P L++       L +GD+++IP  W+H V++  + ++AVN
Sbjct:   21 RQPVVIRGAANHWPAKEKWKNETYLRQKSGTEAFTV---DTRK-KFDGKVSVRKPLTISEFL-------------------DIYKTEPVYLDSPFPPSKLLHDLYLPPILNCEELSSTISQMTLLFSNGNTTSAFHHDGYDNVIVLLSGTKHFILIDSKYSDDVYADDAKLFPGVLPFDPEKIDFKAFPKLAKVPFYEITLYEGDMIYIPQYWWHIVRSYGSPNIAVN 225          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Medaka
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:101166925])

HSP 1 Score: 261.151 bits (666), Expect = 4.549e-85
Identity = 134/312 (42.95%), Postives = 190/312 (60.90%), Query Frame = 1
Query:   91 MKEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLL 1005
            MK+ EI ++  F  ++    ++E + +R P I R + +G C + W   +YL        V +H++   +MDF  KNF Y+ +  ++F++ A+          E+  YYLR+LG DVRKE A    Q+P+LAED  IPP F P+++FSSVFRISS   +LWTHYD MDN+L QV G K ++ +SP DA +LYL   KS +L  +  DL ++P   RA+     L  GD++FIPALWFHN +A  F V VNVFW HL    YDR+D YGNKDP   AR  Q++D  +RAL  LP +YR  YG  +++++  + L
Sbjct:    1 MKQQEIKSVPIFTGVDRETFLQEIYPERRPAILRGVPLGPCQQLW-TTEYLARRGGDKEVKIHVSTVPQMDFLRKNFVYRTLPFNEFVKRASEKKHSDFFLCEEESYYLRSLGEDVRKEPADLRKQFPDLAEDFLIPPFFEPDQFFSSVFRISSCGLQLWTHYDVMDNLLAQVSGTKRVVLFSPQDALHLYLSGDKSEVLDIDRPDLQRFPDFVRASRHECELQPGDLLFIPALWFHNTRALQFGVGVNVFWRHLPANSYDRKDPYGNKDPQAAARALQALDRGLRALEELPADYRDFYGRRMIQRIQQRAL 311          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Medaka
Match: tyw5 (tRNA-yW synthesizing protein 5 [Source:NCBI gene;Acc:101166925])

HSP 1 Score: 261.151 bits (666), Expect = 4.549e-85
Identity = 134/312 (42.95%), Postives = 190/312 (60.90%), Query Frame = 1
Query:   91 MKEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAID-------SEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLL 1005
            MK+ EI ++  F  ++    ++E + +R P I R + +G C + W   +YL        V +H++   +MDF  KNF Y+ +  ++F++ A+          E+  YYLR+LG DVRKE A    Q+P+LAED  IPP F P+++FSSVFRISS   +LWTHYD MDN+L QV G K ++ +SP DA +LYL   KS +L  +  DL ++P   RA+     L  GD++FIPALWFHN +A  F V VNVFW HL    YDR+D YGNKDP   AR  Q++D  +RAL  LP +YR  YG  +++++  + L
Sbjct:    1 MKQQEIKSVPIFTGVDRETFLQEIYPERRPAILRGVPLGPCQQLW-TTEYLARRGGDKEVKIHVSTVPQMDFLRKNFVYRTLPFNEFVKRASEKKHSDFFLCEEESYYLRSLGEDVRKEPADLRKQFPDLAEDFLIPPFFEPDQFFSSVFRISSCGLQLWTHYDVMDNLLAQVSGTKRVVLFSPQDALHLYLSGDKSEVLDIDRPDLQRFPDFVRASRHECELQPGDLLFIPALWFHNTRALQFGVGVNVFWRHLPANSYDRKDPYGNKDPQAAARALQALDRGLRALEELPADYRDFYGRRMIQRIQQRAL 311          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Medaka
Match: kdm8 (lysine demethylase 8 [Source:NCBI gene;Acc:101171915])

HSP 1 Score: 53.1434 bits (126), Expect = 1.920e-7
Identity = 46/165 (27.88%), Postives = 70/165 (42.42%), Query Frame = 1
Query:  388 YYLRALGADVRKEKAHFP-----DQYPNLAEDLQIPPV----------FSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGK----SPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            Y L  +  D  K + +       DQ P L ED++IP             + N +F     +S        H D   N L QV G K I  +SP D + LY    +    +  +  E+ +   +P  S+A  L   L  GDV+FIP   +H V++   S +V+ +W
Sbjct:  250 YILNEISQDGGKSRGYLAQHQLFDQIPELKEDIRIPDYCCLGEGDEDDITINAWFGPAGTVSP------LHQDPQQNFLAQVVGSKYIRLFSPEDTDKLYPHQSQLLHNTSQVEVENPNAELFPEFSKAPYLECVLEPGDVLFIPVKHWHYVRSLQVSFSVSFWW 408          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Medaka
Match: jmjd7 (jumonji domain containing 7 [Source:NCBI gene;Acc:101158565])

HSP 1 Score: 52.373 bits (124), Expect = 2.937e-7
Identity = 36/130 (27.69%), Postives = 58/130 (44.62%), Query Frame = 1
Query:  517 FRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFD-----------AEYLYLEDGKSPI-------------LCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHL 834
            F +   N     H D  +N+   V GEK  +   P D           A Y   +DG+  I             L P   DL ++P    A P+  ++  G+++++P+LWFH+V+ +   +AVN FWY +
Sbjct:  161 FWLGDGNAVTSMHKDPYENLYCVVSGEKRFVLLPPTDRPFIPYDMYQPAIYHLRDDGEFEIVDQGDSKKVPWIPLDPLDPDLERFPQYRWARPVCCSVKAGEMLYLPSLWFHHVRQSHGCIAVN-FWYDM 289          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Match: SMESG000010398.1 (SMESG000010398.1)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 309/310 (99.68%), Postives = 310/310 (100.00%), Query Frame = 1
Query:   91 MKEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKPD 1020
            MKEVEIINLENFKYLESIDVMKENFKKRVPVIF+NLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKPD
Sbjct:    1 MKEVEIINLENFKYLESIDVMKENFKKRVPVIFQNLNIGKCVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKLSMKLLKQKPD 310          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.450e-10
Identity = 59/219 (26.94%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  211 CVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNK-NFEYKNMRMD--DFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSP--FDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYD 852
             +EKW +++Y    N    +S +  NT  ++ K K N   KNM M+  DFI++      D+  Y+     +   E  HFP  +P L  DL     F  N  F  +   SS N     H D M+NI   +RG K+ +   P     +    ++G    +  +  D ++Y  +     ++  +  GD ++IP LW H V++   ++A+N+ W+ + E F++
Sbjct:   71 AMEKW-DDEYFLNLN----LSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSY----NDSDIYMVNNLPNFLNEDIHFP--WP-LQCDL-----FDEN-IFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVPEMFFE 270          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Match: SMESG000008562.1 (SMESG000008562.1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.418e-10
Identity = 59/219 (26.94%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  211 CVEKWQNNDYLFESNPSHIVSVHLANTKEMDFKNK-NFEYKNMRMD--DFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSP--FDAEYLYLEDGKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKEEFYD 852
             +EKW +++Y    N    +S +  NT  ++ K K N   KNM M+  DFI++      D+  Y+     +   E  HFP  +P L  DL     F  N  F  +   SS N     H D M+NI   +RG K+ +   P     +    ++G    +  +  D ++Y  +     ++  +  GD ++IP LW H V++   ++A+N+ W+ + E F++
Sbjct:   71 AMEKW-DDEYFLNLN----LSKYYPNTVNIETKKKENRTLKNMEMNFKDFIKSY----NDSDIYMVNNLPNFLNEDIHFP--WP-LQCDL-----FDEN-IFQVIMWFSSGNTSSVVHTDDMENINCLIRGTKTFVLVDPEKHGDKIPMKKEGAYSDIDVDRVDFSKYKKMENVDFIIAEMEAGDCLYIPKLWIHQVRSFHRNIAINI-WFRVPEMFFE 270          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Match: SMESG000053282.1 (SMESG000053282.1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.412e-9
Identity = 36/101 (35.64%), Postives = 55/101 (54.46%), Query Frame = 1
Query:  511 SVFRISSKNCRLWTHYDTMD-NILIQVRGEKSIIFYSPFDAEYLY---LEDGKSPILCP---ESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQA 792
            SVF + S       HYDT   N++ Q+RG K  + + P D +YLY   +   +S +       + DL ++P L +ATP +  LS GDV+F+P  W+H V+ 
Sbjct:   93 SVFWMGSLGSFTDCHYDTYGCNLVCQLRGTKKWLLFPPEDTKYLYPTRIPYEESSVFSSIDFNNPDLNRFPNLMKATPHVIKLSPGDVLFVPPHWWHFVKT 193          
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Match: SMESG000065343.1 (SMESG000065343.1)

HSP 1 Score: 49.2914 bits (116), Expect = 2.530e-6
Identity = 50/192 (26.04%), Postives = 75/192 (39.06%), Query Frame = 1
Query:  304 FKNKNFEYKNMRMDDFIRAAAIDSEDNWYYLRALGADVRKEKAHFPDQYPNLAEDLQIP-----------PVFSPNEYFSSVFRISSKNCRLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLED-------GKSPILCPESADLTQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFW 825
            +   N+  K M ++DFI       E+ +Y      +     + +   Q   L +D++IP           P    N +F     +S        H D   N L QV GEK +  Y      YLY           K  +L P   DL  +PL S A      L  G+++FIP   +H V + + S +VN +W
Sbjct:  234 YAESNWTQKLMTINDFI-------ENYFYQSSETDSKAYLAQHYLFSQIAELNDDIEIPDYCFMNSTDQKPEIDINGWFGPAGTVSP------LHQDPKQNFLCQVFGEKYVKLYHANQTNYLYPNSTTMLKNTSKIDVLSP---DLETFPLFSNAIGFDCFLKPGEILFIPPKCWHYVTSLSPSFSVNFWW 409          
The following BLAST results are available for this feature:
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYW53.686e-8645.07tRNA-yW synthesizing protein 5 [Source:HGNC Symbol... [more]
KDM89.239e-1125.97lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
KDM81.227e-1025.97lysine demethylase 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
JMJD72.210e-1027.65jumonji domain containing 7 [Source:HGNC Symbol;Ac... [more]
JMJD76.383e-1027.59jumonji domain containing 7 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jmjd-54.501e-926.04JuMonJi (Transcription factor) Domain protein [So... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
JMJD71.337e-823.24gene:FBgn0036366 transcript:FBtr0075825[more]
JMJD54.633e-830.88gene:FBgn0035166 transcript:FBtr0331402[more]
JMJD55.382e-830.88gene:FBgn0035166 transcript:FBtr0300712[more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyw53.555e-8344.88tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw53.555e-8344.88tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
kdm85.423e-926.89lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
kdm85.423e-926.89lysine (K)-specific demethylase 8 [Source:NCBI gen... [more]
jmjd71.037e-725.19jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TYW51.260e-8744.77tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
TYW51.112e-8644.41tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
jmjd73.130e-1025.84jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
ada.24.514e-1025.57adenosine deaminase, gene 2 [Source:Xenbase;Acc:XB... [more]
rbfox29.238e-627.91RNA binding fox-1 homolog 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tyw57.954e-8544.48tRNA-yW synthesizing protein 5 [Source:MGI Symbol;... [more]
Tyw53.126e-5438.80tRNA-yW synthesizing protein 5 [Source:MGI Symbol;... [more]
Kdm81.277e-1025.97lysine (K)-specific demethylase 8 [Source:MGI Symb... [more]
Jmjd72.848e-1028.82jumonji domain containing 7 [Source:MGI Symbol;Acc... [more]
Gm280421.124e-943.28predicted gene, 28042 [Source:MGI Symbol;Acc:MGI:5... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E1C7T6|TYW5_CHICK5.443e-8845.86tRNA wybutosine-synthesizing protein 5 OS=Gallus g... [more]
sp|A2RUC4|TYW5_HUMAN1.770e-8545.07tRNA wybutosine-synthesizing protein 5 OS=Homo sap... [more]
sp|A2RSX7|TYW5_MOUSE5.564e-8444.48tRNA wybutosine-synthesizing protein 5 OS=Mus musc... [more]
sp|Q08BV2|TYW5_DANRE2.408e-8244.88tRNA wybutosine-synthesizing protein 5 OS=Danio re... [more]
sp|Q4IER0|TYW4_GIBZE1.939e-4034.68tRNA wybutosine-synthesizing protein 4 OS=Gibberel... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I0UQG91.826e-8844.66Trna wybutosine-synthesizing protein 5 OS=Limosa l... [more]
A0A210QRN31.051e-8745.95tRNA wybutosine-synthesizing protein 5 OS=Mizuhope... [more]
C3YZ251.906e-8745.42JmjC domain-containing protein OS=Branchiostoma fl... [more]
A0A091I1V02.935e-8747.90tRNA wybutosine-synthesizing protein 5 (Fragment) ... [more]
A0A1V4L0I73.433e-8743.93tRNA wybutosine-synthesizing protein 5 OS=Patagioe... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyw51.127e-8443.56tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw52.443e-7741.41tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw56.498e-7641.70tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
jmjd78.502e-924.71jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
jmjd78.502e-924.71jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tyw53.592e-8144.06tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
jmjd71.111e-929.01jumonji domain containing 7 [Source:ZFIN;Acc:ZDB-G... [more]
hif1an8.983e-830.84hypoxia inducible factor 1 subunit alpha inhibitor... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429714.805e-8341.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490372.041e-924.64Jumonji-like protein; Predicted protein [Source:U... [more]
EDO344272.994e-926.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372533.237e-923.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449784.553e-925.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tyw54.549e-8542.95tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
tyw54.549e-8542.95tRNA-yW synthesizing protein 5 [Source:NCBI gene;A... [more]
kdm81.920e-727.88lysine demethylase 8 [Source:NCBI gene;Acc:1011719... [more]
jmjd72.937e-727.69jumonji domain containing 7 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of tRNA wybutosine-synthesizing protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010398.10.000e+099.68SMESG000010398.1[more]
SMESG000008562.14.450e-1026.94SMESG000008562.1[more]
SMESG000008562.15.418e-1026.94SMESG000008562.1[more]
SMESG000053282.14.412e-935.64SMESG000053282.1[more]
SMESG000065343.12.530e-626.04SMESG000065343.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005921 ID=SMED30005921|Name=tRNA wybutosine-synthesizing protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1063bp
ATAACATCAATAGATTTTAAAAACGTTAAAAGTTTTAACCTATTTTAATT
GACATTATTTTCATCCGTGTTTTAATTTTCCAATAAAACGATGAAAGAAG
TTGAAATTATAAATTTAGAAAACTTTAAATATTTAGAATCTATTGATGTT
ATGAAGGAAAATTTTAAAAAACGAGTTCCGGTAATTTTTCGAAATTTAAA
TATTGGTAAATGTGTGGAAAAATGGCAAAATAATGATTATTTATTCGAGA
GTAATCCAAGTCATATAGTATCAGTTCACTTAGCAAATACGAAGGAAATG
GATTTTAAGAATAAAAATTTCGAATATAAAAATATGCGAATGGACGACTT
CATTAGAGCGGCAGCAATTGATAGTGAAGATAATTGGTATTATCTGCGTG
CGCTCGGTGCCGATGTCCGCAAGGAAAAGGCTCATTTCCCCGATCAATAT
CCGAATTTGGCTGAAGATTTGCAAATTCCGCCAGTATTTTCTCCGAATGA
ATATTTTTCATCGGTTTTCAGAATTTCATCAAAGAATTGCCGATTGTGGA
CGCATTATGACACCATGGACAATATTCTCATTCAAGTTCGCGGAGAGAAA
TCGATAATTTTCTATTCCCCGTTCGATGCCGAATATTTATATCTTGAAGA
CGGGAAATCTCCAATTTTGTGTCCAGAATCGGCAGACTTGACTCAGTATC
CGCTCTTGTCGCGGGCAACTCCGTTGCTAGGAAACCTTAGCGACGGCGAT
GTCGTCTTCATTCCCGCTTTGTGGTTTCATAACGTGCAGGCCAATGCCTT
CTCTGTCGCGGTAAATGTGTTCTGGTACCATCTCAAGGAGGAGTTCTATG
ATAGGAGGGACGTTTATGGGAACAAAGATCCGCTGCCGGTGGCGAGAGTC
AATCAGAGCATTGACAGTTGCATTAGAGCTCTGTCTGGCCTGCCTGAGGA
ATATCGGCACCTTTACGGGCTGAATTTAGTCAAGAAGCTCTCGATGAAGC
TGCTGAAACAGAAGCCAGATTAAATCGATTTTTGGAATAAATTGTCGCGA
TCTTAAAAAAAAA
back to top

protein sequence of SMED30005921-orf-1

>SMED30005921-orf-1 ID=SMED30005921-orf-1|Name=SMED30005921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MKEVEIINLENFKYLESIDVMKENFKKRVPVIFRNLNIGKCVEKWQNNDY
LFESNPSHIVSVHLANTKEMDFKNKNFEYKNMRMDDFIRAAAIDSEDNWY
YLRALGADVRKEKAHFPDQYPNLAEDLQIPPVFSPNEYFSSVFRISSKNC
RLWTHYDTMDNILIQVRGEKSIIFYSPFDAEYLYLEDGKSPILCPESADL
TQYPLLSRATPLLGNLSDGDVVFIPALWFHNVQANAFSVAVNVFWYHLKE
EFYDRRDVYGNKDPLPVARVNQSIDSCIRALSGLPEEYRHLYGLNLVKKL
SMKLLKQKPD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041667Cupin_8
IPR003347JmjC_dom
Vocabulary: molecular function
TermDefinition
GO:0000049tRNA binding
GO:0005506iron ion binding
GO:0016491oxidoreductase activity
GO:0016706oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0008033tRNA processing
GO:0031591wybutosine biosynthetic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003347JmjC domainSMARTSM00558cupin_9coord: 109..257
e-value: 5.9E-4
score: 14.4
IPR003347JmjC domainPROSITEPS51184JMJCcoord: 118..262
score: 18.775
IPR041667Cupin-like domain 8PFAMPF13621Cupin_8coord: 20..248
e-value: 1.5E-38
score: 133.0
NoneNo IPR availableGENE3DG3DSA:2.60.120.650coord: 4..258
e-value: 9.9E-57
score: 194.6
NoneNo IPR availablePANTHERPTHR12461HYPOXIA-INDUCIBLE FACTOR 1 ALPHA INHIBITOR-RELATEDcoord: 23..246
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 15..267