SMED30005911

Overview
NameSMED30005911
Smed IDSMED30005911
Length (bp)677
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005911 (SMED30005911) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005911 (SMED30005911) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005911 (SMED30005911) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005911 (SMED30005911) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005911

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30005911 dd_Smed_v4_12_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005911 dd_Smed_v4_12_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005911 dd_Smed_v4_12_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005911 dd_Smed_v4_12_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
progenitor cellSMED30005911 dd_Smed_v6_12_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005911 dd_Smed_v6_12_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30005911 dd_Smed_v6_12_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30005911 dd_Smed_v6_12_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005911 dd_Smed_v4_12_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005911 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.008154:10570..11300 -3037
Homology
BLAST of SMED30005911 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070639)

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-11
Identity = 35/69 (50.72%), Postives = 43/69 (62.32%), Query Frame = -2
Query:  122 IGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEK--GAPLKHVEVTEKVALPTKEDIEAEKQ 322
            I +FN+ +LKH E  EK+ LPD  A+ QEK+++     IE      LKH E  EK  LPTKE IEAEKQ
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30005911 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0070641)

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-11
Identity = 35/69 (50.72%), Postives = 43/69 (62.32%), Query Frame = -2
Query:  122 IGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEK--GAPLKHVEVTEKVALPTKEDIEAEKQ 322
            I +FN+ +LKH E  EK+ LPD  A+ QEK+++     IE      LKH E  EK  LPTKE IEAEKQ
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30005911 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0307206)

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-11
Identity = 35/69 (50.72%), Postives = 43/69 (62.32%), Query Frame = -2
Query:  122 IGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEK--GAPLKHVEVTEKVALPTKEDIEAEKQ 322
            I +FN+ +LKH E  EK+ LPD  A+ QEK+++     IE      LKH E  EK  LPTKE IEAEKQ
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30005911 vs. Ensembl Fly
Match: cib (gene:FBgn0026084 transcript:FBtr0343425)

HSP 1 Score: 58.9214 bits (141), Expect = 5.937e-11
Identity = 35/69 (50.72%), Postives = 43/69 (62.32%), Query Frame = -2
Query:  122 IGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEK--GAPLKHVEVTEKVALPTKEDIEAEKQ 322
            I +FN+ +LKH E  EK+ LPD  A+ QEK+++     IE      LKH E  EK  LPTKE IEAEKQ
Sbjct:   60 ITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFDAKKLKHTETNEKNVLPTKEVIEAEKQ 128          
BLAST of SMED30005911 vs. TrEMBL
Match: A0A3P7MQF8 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS15854 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.981e-10
Identity = 45/93 (48.39%), Postives = 57/93 (61.29%), Query Frame = -2
Query:  116 KMSDEVKIDVNEIGSFNKE-SLKHIEVQEKDSLPD-----------AAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEKQHA 358
            K  D+V  DV +   F+KE  LKH+EV EK  LPD             A+ +EK E  LR+EIE+G  LKHV+ TEK  LPTK+DIEAEK+ +
Sbjct:    5 KSGDKVLADVQK---FDKEKGLKHVEVTEKVVLPDKDGTPFYLIDIFLAIEKEKTEVSLRQEIEQGKDLKHVKTTEKNVLPTKQDIEAEKKSS 94          
BLAST of SMED30005911 vs. TrEMBL
Match: C1L942 (Putative beta thymosin OS=Schistosoma japonicum OX=6182 GN=EWB00_001724 PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.008e-9
Identity = 36/77 (46.75%), Postives = 50/77 (64.94%), Query Frame = -2
Query:  125 MSDEVKIDVNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEK 355
            M+D +K+ + +I  F+K+ L+H+E +EK  LPD   +A+EK E  L +EIE    LKH    EK  LPTK+DI AEK
Sbjct:    1 MADAIKV-LEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTEKQLLQEIETPPSLKHTSTKEKNPLPTKDDIVAEK 76          
BLAST of SMED30005911 vs. TrEMBL
Match: Q5BTJ4 (SJCHGC00690 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 1.242e-9
Identity = 36/77 (46.75%), Postives = 50/77 (64.94%), Query Frame = -2
Query:  125 MSDEVKIDVNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEK 355
            M+D +K+ + +I  F+K+ L+H+E +EK  LPD   +A+EK E  L +EIE    LKH    EK  LPTK+DI AEK
Sbjct:   13 MADAIKV-LEDIDGFDKQKLRHVETEEKVVLPDKEVIAKEKTEKQLLQEIETPPSLKHTSTKEKNPLPTKDDIVAEK 88          
BLAST of SMED30005911 vs. TrEMBL
Match: A0A0R3UPZ4 (WH2 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS9935 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.623e-9
Identity = 35/68 (51.47%), Postives = 42/68 (61.76%), Query Frame = -2
Query:  122 EIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEKQ 325
            E+G F K+ LKH+    K+ LP A  +  EK E  L  +IEKG  LK VE  EK  LPTKEDIE EK+
Sbjct:   11 EVGDFQKDKLKHVNPNIKNPLPTADDVKNEKAESQLMHDIEKGTNLKKVETVEKNPLPTKEDIEREKK 78          
BLAST of SMED30005911 vs. TrEMBL
Match: A0A267DFY6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016979g1 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.889e-9
Identity = 32/61 (52.46%), Postives = 41/61 (67.21%), Query Frame = -2
Query:  149 VNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPT 331
            ++++  FN E LK +E  +K  LP A  + QEK+E  LREEIEKG  LKHVEV EK  LP+
Sbjct:   12 LSDVSKFNTEKLKKVESLDKTVLPSAEQVEQEKREVSLREEIEKGTELKHVEVQEKTVLPS 72          
BLAST of SMED30005911 vs. Ensembl Nematostella
Match: EDO48924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW3])

HSP 1 Score: 51.2174 bits (121), Expect = 7.266e-8
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = -2
Query:  110 MSDEVKIDVNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKK--EHCLREEIEK--GAPLKHVEVTEKVALPTKEDIEAEKQHA*F 355
            MS   K DV+E+  F+  +LKH++ +EK++LP    + QE +  E   R E++    + L+HVE  EK  LPTK+ I  EK+ A F
Sbjct:    1 MSQGSKPDVSEVAKFDAANLKHVQTKEKNTLPSDETIKQELQPDEFPDRAEVKSFEKSKLQHVETKEKNTLPTKDTIADEKRTAPF 86          

HSP 2 Score: 49.6766 bits (117), Expect = 2.644e-7
Identity = 32/66 (48.48%), Postives = 39/66 (59.09%), Query Frame = -2
Query:  128 FNKESLKHIEVQEKDSLPDAAALAQEKKEHCL--REEIEK--GAPLKHVEVTEKVALPTKEDIEAE 313
            F K  LKH+E  EK+ LPDA  +  E     L  R E+ K   + LKHVE  EKV +PTK+ IEAE
Sbjct:   92 FQKNKLKHVETLEKNPLPDAQNIRAEMMPEVLPDRSEVAKFDTSKLKHVETKEKVVMPTKDVIEAE 157          

HSP 3 Score: 45.8246 bits (107), Expect = 4.613e-6
Identity = 30/77 (38.96%), Postives = 40/77 (51.95%), Query Frame = -2
Query:  125 MSDEVKIDVNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEK 355
            M  EV  DV+ + SF+   LKH+EVQEK+ LP    +  E  E     +    + LKHV+  EK  LP  + I  EK
Sbjct:  270 MRPEVLPDVSAVASFDASKLKHVEVQEKNPLPTKDDITTESTETRAEVKTFDHSKLKHVQTEEKNPLPDAKTIAQEK 346          
BLAST of SMED30005911 vs. Planmine SMEST
Match: SMESG000016237.1 (SMESG000016237.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.550e-18
Identity = 44/80 (55.00%), Postives = 54/80 (67.50%), Query Frame = -2
Query:  116 MSDEVKIDVNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEKQHA 355
            MSD  K+ ++EI SF+K+ LKH+E  EK+ LPDA    + K    L  EIEKG  LKHVE  EK  LPTKE+IEAEK +A
Sbjct:    1 MSDSTKVPIDEIESFDKDKLKHVETVEKEVLPDAEEFNKIKTGKELHSEIEKGTALKHVETEEKSKLPTKEEIEAEKLNA 80          
BLAST of SMED30005911 vs. Planmine SMEST
Match: SMESG000025889.1 (SMESG000025889.1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.146e-18
Identity = 41/70 (58.57%), Postives = 49/70 (70.00%), Query Frame = -2
Query:  122 VNEIGSFNKESLKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEKQ 331
            VNE+  F K+ LKH+E  EK  LPD   + QEK E  L++EIEKGA LKHVE TEK  LP K+DI+ EKQ
Sbjct:   15 VNEVHDFPKDKLKHVEALEKVVLPDNDTIKQEKTEQELKDEIEKGAKLKHVETTEKTVLPNKDDIKKEKQ 84          
BLAST of SMED30005911 vs. Planmine SMEST
Match: SMESG000025888.1 (SMESG000025888.1)

HSP 1 Score: 54.6842 bits (130), Expect = 2.419e-9
Identity = 30/61 (49.18%), Postives = 37/61 (60.66%), Query Frame = -2
Query:  116 LKHIEVQEKDSLPDAAALAQEKKEHCLREEIEKGAPLKHVEVTEKVALPTKEDIEAEKQHA 298
            LK    +EK  LP+   + QEK E  LR+EIEKG PLKH    EKV LP + DI  EK+ +
Sbjct:   50 LKQTNTKEKIILPNQDMIEQEKTEIQLRDEIEKGKPLKHTNTMEKVVLPNQHDIAKEKRES 110          
The following BLAST results are available for this feature:
BLAST of SMED30005911 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cib5.937e-1150.72gene:FBgn0026084 transcript:FBtr0070639[more]
cib5.937e-1150.72gene:FBgn0026084 transcript:FBtr0070641[more]
cib5.937e-1150.72gene:FBgn0026084 transcript:FBtr0307206[more]
cib5.937e-1150.72gene:FBgn0026084 transcript:FBtr0343425[more]
back to top
BLAST of SMED30005911 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P7MQF84.981e-1048.39Uncharacterized protein OS=Dibothriocephalus latus... [more]
C1L9421.008e-946.75Putative beta thymosin OS=Schistosoma japonicum OX... [more]
Q5BTJ41.242e-946.75SJCHGC00690 protein (Fragment) OS=Schistosoma japo... [more]
A0A0R3UPZ42.623e-951.47WH2 domain-containing protein OS=Mesocestoides cor... [more]
A0A267DFY62.889e-952.46Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30005911 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO489247.266e-839.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30005911 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005911 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016237.11.550e-1855.00SMESG000016237.1[more]
SMESG000025889.15.146e-1858.57SMESG000025889.1[more]
SMESG000025888.12.419e-949.18SMESG000025888.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005911 ID=SMED30005911|Name=SMED30005911|organism=Schmidtea mediterranea sexual|type=transcript|length=677bp
AAAAAAAAAAAAAAAAAAAAAATGTTTTTTTTTTTTTTTTTTTTTTCGAA
AATAACAAAAATTTATTATTGTTAATAAACTGTATAATTAACATTCCAAA
GAGTCAAACGAATCATGCATGTTGCTTTTCAGCTTCAATATCTTCTTTGG
TTGGCAAGGCTACTTTCTCGGTAACTTCAACGTGCTTCAGTGGAGCACCT
TTTTCAATCTCTTCTCTAAGACAATGCTCTTTCTTTTCCTGTGCCAAGGC
AGCAGCATCAGGTAAACTGTCTTTCTCTTGCACCTCAATGTGCTTTAGAG
ATTCTTTGTTGAAACTTCCGATTTCATTAACGTCGATTTTAACTTCGTCA
GACATTTTGTTATNCTGATTTNTTTTNAACGAATTTTATACCAATCAAGG
TGGCATGCATGTATTGCTGTCTCATGATTTCCGAATCGGTGTGCAGCTAT
TCCTCTCACTCTCTGGCACACACACTCACATGCATGCACACACACTCACA
CTTACACTCATGTGTACACACACACATGCGCGCGCGAATTAGGTCTAGTT
TTATTGCAAATGCGAATGTATCATATCTGATAAGGCATTCTTATTCACGT
AATAAAGGATGTTTACTTGTTTTGTTTAATATTTGTACACAATGCGAAAT
TAATAAATAATATTATCAATATTTCCA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000120progenitor cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001152Beta-thymosin
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
Vocabulary: molecular function
TermDefinition
GO:0003785actin monomer binding