Venom allergen 5

Overview
NameVenom allergen 5
Smed IDSMED30005904
Length (bp)2067
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Venom allergen 5 (SMED30005904) t-SNE clustered cells

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30005904) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Venom allergen 5 (SMED30005904) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Venom allergen 5 (SMED30005904) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005904

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30005904h1SMcG0001552 dd_Smed_v4_11327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005904h1SMcG0001552 dd_Smed_v4_11327_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 83.5741 bits (205), Expect = 2.948e-18
Identity = 47/148 (31.76%), Postives = 82/148 (55.41%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F N +L+ HN+YR++H   PLK  + +N  AQ +++ +A+   + +S +  +G   GEN+      S      ++   WY E +N+ +  +P      GHF+ +VW  TK++G+G ++ S   S +V  YFP GN+  +G F +N+ P
Sbjct:    9 FHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAW---ASYDQTGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLP 151          

HSP 2 Score: 50.8322 bits (120), Expect = 3.248e-14
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            R  H  PPLKL   L  ++Q  S+ +A  R +K   + S    GEN ++++Y Q+G+E+  +WY E+  + F Q
Sbjct:   21 RQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQ 94          

HSP 3 Score: 48.521 bits (114), Expect = 3.248e-14
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GN+V  G F  NV
Sbjct:  102 GHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 149          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: GLIPR2 (GLI pathogenesis related 2 [Source:HGNC Symbol;Acc:HGNC:18007])

HSP 1 Score: 65.4698 bits (158), Expect = 3.363e-12
Identity = 43/148 (29.05%), Postives = 73/148 (49.32%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F N +L+ HN+YR++H   PLK  + +N  AQ +++ +A+   + +S +  +G   GEN+                  W              + D  GHF+ +VW  TK++G+G ++ S   S +V  YFP GN+  +G F +N+ P
Sbjct:    9 FHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQ-CGENLA-----------------W-------------ASYDQTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLP 125          

HSP 2 Score: 45.0542 bits (105), Expect = 5.449e-9
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GN+V  G F  NV
Sbjct:   76 GHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 123          

HSP 3 Score: 36.5798 bits (83), Expect = 5.449e-9
Identity = 21/63 (33.33%), Postives = 33/63 (52.38%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKW 187
            R  H  PPLKL   L  ++Q  S+ +A  R +K   + S    GEN ++++Y Q+G    + W
Sbjct:   21 RQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGHFTAMVW 83          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 55.8398 bits (133), Expect = 6.357e-8
Identity = 40/140 (28.57%), Postives = 65/140 (46.43%), Query Frame = 1
Query: 1441 ILEIHNQYRRR-----HNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTT----SRYSVIVCFYFPPGN 1830
            I+  HN+ R+       N   ++ ++E+   AQ WA       Q      +      GEN+ +    S P+     + +WY E  +F YG+ PK+ + + GH++Q+VW  T ++G GI+      S     VC Y P GN
Sbjct:   40 IVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTL--QHSDPEDRKTSTRCGENLYM---SSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 55.8398 bits (133), Expect = 6.357e-8
Identity = 40/140 (28.57%), Postives = 65/140 (46.43%), Query Frame = 1
Query: 1441 ILEIHNQYRRR-----HNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTT----SRYSVIVCFYFPPGN 1830
            I+  HN+ R+       N   ++ ++E+   AQ WA       Q      +      GEN+ +    S P+     + +WY E  +F YG+ PK+ + + GH++Q+VW  T ++G GI+      S     VC Y P GN
Sbjct:   40 IVNKHNELRKAVSPPASNMLKMEWSREVTTNAQRWANKCTL--QHSDPEDRKTSTRCGENLYM---SSDPTSWSSAIQSWYDEILDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAGN 174          
BLAST of Venom allergen 5 vs. Ensembl Human
Match: PI16 (peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGNC:21245])

HSP 1 Score: 56.225 bits (134), Expect = 1.384e-7
Identity = 41/154 (26.62%), Postives = 71/154 (46.10%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIAT-----ANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTTSRYS--------VIVCFYFPPGNIKGE 1842
            D+ +  ++E+HN YR +    P  S+     L   W + +A      A Q  + + K +G   GEN+       +   +   +  W+ E+E++       +   + GH++QVVW KT+ IG G     +          ++VC Y PPGN+KG+
Sbjct:   30 DEEKRLMVELHNLYRAQ--VSPTASDM----LHMRWDEELAAFAKAYARQCVWGHNKERGRR-GENLFAITDEGM--DVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIELLVCNYEPPGNVKGK 174          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: C07A4.3 (pep chromosome:WBcel235:X:10174985:10175896:1 gene:WBGene00007398.1 transcript:C07A4.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07A4.3)

HSP 1 Score: 77.7962 bits (190), Expect = 4.080e-16
Identity = 45/150 (30.00%), Postives = 73/150 (48.67%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPS---FIDKMVFNWYQEKENFQYG-IEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR---YSVIVCF-YFPPGNIK 1836
            E +I D +  I+  HN+YR  H++  +  +  +  LAQ W+  +A   +     Q  K    GEN+        PS       ++  +Y E   F Y    P +   +GHF+Q++W  +++IG+G+S   R   Y V VC  Y PPGN++
Sbjct:   38 EYSIKDLKKWIVHFHNKYRAHHSSPAVTVDSNLTNLAQKWSDEMAFHKKCLVHEQPSK---YGENLTSFASSKFPSPKTCAAALIHGFYTEGYGFNYTRFNPGSWSKVGHFTQLLWKNSRKIGVGVSVAKRGTMYHVYVCIKYDPPGNMQ 184          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F09B9.5 (pep chromosome:WBcel235:X:10154821:10156856:1 gene:WBGene00008604.1 transcript:F09B9.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F09B9.5)

HSP 1 Score: 75.0998 bits (183), Expect = 2.650e-15
Identity = 60/186 (32.26%), Postives = 85/186 (45.70%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK--MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI-----------------------STTSRYS----------VIVCFYFPPG--NIKGEFVKNI-KPTI 1869
            +F + +L  HN  R+ H+   L+ ++E++E+AQ WA  +A    I +S  +  G  +GENI        P  ID   +V +WYQE E ++Y   P       +F+QV+W  TKEIG+G                        S TS  S          VIV FY P G  N  G+F  N+ KP I
Sbjct:    9 EFVDQMLLEHNTRRKMHSAPNLECSEELSEMAQQWADKLAKQAHISFS--ELSG--IGENITF-----FPPDIDAESVVEHWYQEHEKYEYET-PGWQTGTNYFTQVIWRSTKEIGVGCAYVRKSHENDEDNTSCSNGSVCKSMTSLSSNGKLAAEGDKVIVAFYRPAGNNNRSGQFASNVLKPII 184          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: D2062.1 (pep chromosome:WBcel235:II:2631473:2633054:1 gene:WBGene00017055.1 transcript:D2062.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:D2062.1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.352e-14
Identity = 51/181 (28.18%), Postives = 92/181 (50.83%), Query Frame = 1
Query: 1372 LIDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSN-QKYKGHVVGENIVLQLK-GSLP---SFIDKMVFNWYQEKENFQY-GIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRY------SVIVCFYF-PPGNIKGE--FVKNI-KPT 1866
            L+ G  D++++    NI   +  I+  HN YR +H   PL ++  ++  A+ WA  +A +  I +   +KY     GEN+ +  + G  P   +    MV  +Y E   + Y   +P+ + + GHF+Q+VW  +++IG+GIS           ++  C  F PPGN+  +  ++ N+ +PT
Sbjct:   29 LVKGQADKQDLAG-YNIPKLKELIVAYHNLYRSKHGAPPLVADPVMDVAAKRWADEMAKSGWISHEKPRKY-----GENVAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELLKENGHFTQIVWKSSRKIGVGISIGKSSQPPYIPTMFHCVKFDPPGNVLAQQYYLSNVQRPT 203          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443484:-1 gene:WBGene00010192.1 transcript:F57B7.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 69.707 bits (169), Expect = 8.536e-13
Identity = 46/151 (30.46%), Postives = 80/151 (52.98%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQ---LKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIG--ISTTSRYSVIVCFYFPPG--NIKGEFVKNI 1857
            +F+ + L+ HN+ R+R+  + L  + E+ E+A  WA  +A   ++ Y   +  G  +GEN++L+    +  LP+   +++  W +E + F +  +P+       FSQVVW  T E+G     +T +    +VCFY P G  N  GEF  N+
Sbjct:  112 NFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYP--ELPG--IGENLILKEANEQSHLPTG-QEVIQEWEKEAQFFDFD-KPRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNV 256          
BLAST of Venom allergen 5 vs. Ensembl Celegans
Match: F57B7.2 (pep chromosome:WBcel235:V:11441925:11443603:-1 gene:WBGene00010192.1 transcript:F57B7.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B7.2)

HSP 1 Score: 69.3218 bits (168), Expect = 2.040e-12
Identity = 46/151 (30.46%), Postives = 80/151 (52.98%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQ---LKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIG--ISTTSRYSVIVCFYFPPG--NIKGEFVKNI 1857
            +F+ + L+ HN+ R+R+  + L  + E+ E+A  WA  +A   ++ Y   +  G  +GEN++L+    +  LP+   +++  W +E + F +  +P+       FSQVVW  T E+G     +T +    +VCFY P G  N  GEF  N+
Sbjct:  153 NFQRSCLDAHNECRQRYGNENLCWSTELAEMAHAWAVKLADRGRVLYP--ELPG--IGENLILKEANEQSHLPTG-QEVIQEWEKEAQFFDFD-KPRWNPKCQRFSQVVWKDTTELGAARYWNTANNCVAVVCFYRPAGNSNAPGEFASNV 297          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG34049 (gene:FBgn0054049 transcript:FBtr0302372)

HSP 1 Score: 92.4337 bits (228), Expect = 3.575e-20
Identity = 48/141 (34.04%), Postives = 81/141 (57.45%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +L   N+YRR HN  PLK ++++   AQ WA ++A  N++    +     + GENI+   +      +D+++  WYQEK N+ Y ++P      GHF+Q+VW +++ +G+G++       IVC Y PPGN+   F +N+ P
Sbjct:  149 VLRETNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKL----ETRPNPLYGENIMRVRRSKFS--VDQILKLWYQEKYNYDY-LKPGFNLYTGHFTQLVWRESEFLGVGVACDVSSIWIVCNYHPPGNVSEHFRENVLP 282          

HSP 2 Score: 42.3578 bits (98), Expect = 7.112e-7
Identity = 20/49 (40.82%), Postives = 26/49 (53.06%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHR 435
            GHF Q+VW+E+  +G G +      WIV   Y  PGN+   F  NV  R
Sbjct:  236 GHFTQLVWRESEFLGVGVACDVSSIWIV-CNYHPPGNVSEHFRENVLPR 283          

HSP 3 Score: 31.187 bits (69), Expect = 7.112e-7
Identity = 23/78 (29.49%), Postives = 42/78 (53.85%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN-KSFSNYKQSGEEITLKWYREVDEFKFSQERQNL 235
            R LH A PLK+  +L   +Q  +D++A  + +++ + + L+GEN       K S ++I   WY+E   + + +   NL
Sbjct:  157 RRLHNANPLKMDEKLCSYAQEWADHLA-DLNKLETRPNPLYGENIMRVRRSKFSVDQILKLWYQEKYNYDYLKPGFNL 233          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG16995 (gene:FBgn0031412 transcript:FBtr0077758)

HSP 1 Score: 78.1814 bits (191), Expect = 9.166e-17
Identity = 49/150 (32.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGY-SNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTI 1869
              F   +L+ HN YR +H  +PL  + ++N LA  WA Y+ + N++ +  N  Y     GENI +   G+L       V +WY+E   + +   P    + GHF+QVVW  + E+G+G + +     +VC Y PPGN    F +N+ P +
Sbjct:    4 QQFEQEVLQAHNLYRAKHGAQPLTLSPKLNRLATEWANYLLSRNRMEHRQNSGY-----GENIYMASGGNLKG--ADAVRSWYEEIRQYNWN-SPSFQGNTGHFTQVVWKSSTELGVGFAKSGSTIYVVCNYNPPGNYNNLFRENVAPPM 145          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077754)

HSP 1 Score: 77.0258 bits (188), Expect = 4.870e-16
Identity = 48/150 (32.00%), Postives = 77/150 (51.33%), Query Frame = 1
Query: 1417 NIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYS-NQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            N + F   +    N+YR  H    +  N  +N+LAQ WA ++   N + +  N KY     GENI L   G +    D  V  WY+E  ++ +  + + V   GHF+Q++W  + E+G G++  +  + +VC Y PPGN+ G F  N+ P
Sbjct:   27 NNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKY-----GENIFLS--GGMDVTGDLPVEMWYREINSYDFN-KAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVCNYNPPGNVVGLFKDNVPP 168          

HSP 2 Score: 45.8246 bits (107), Expect = 3.807e-7
Identity = 21/46 (45.65%), Postives = 30/46 (65.22%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNV 426
            GHF Q++WK + E+G G ++  D  W V+  Y  PGN+VG F +NV
Sbjct:  122 GHFTQLIWKSSVEMGSGVARKADRTW-VVCNYNPPGNVVGLFKDNV 166          

HSP 3 Score: 28.4906 bits (62), Expect = 3.807e-7
Identity = 16/73 (21.92%), Postives = 38/73 (52.05%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSN-YKQSGEEITLKWYREVDEFKFSQ 220
            R++H  P + ++  L + +Q  ++++ R    +  + +  +GEN   S     +G+     WYRE++ + F++
Sbjct:   43 RAMHGCPAVTINAALNKLAQEWANHL-RDQNTMAHRPNPKYGENIFLSGGMDVTGDLPVEMWYREINSYDFNK 114          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG31482 (gene:FBgn0051482 transcript:FBtr0081679)

HSP 1 Score: 74.3294 bits (181), Expect = 6.068e-15
Identity = 42/149 (28.19%), Postives = 81/149 (54.36%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNIKGEFVKNIKPTI 1869
            D + + L  HN+ R +H + PL  + E+ +  + +A+ +A   ++ +S+    G   GEN+ ++ +  L     + V +WY E  ++ +  +P+     GHF+ +VW   K++GIG +   + Y  +V  Y+PP N+ G+F +N+ P I
Sbjct:   21 DLQEDHLNEHNRLREKHGSPPLTLDDELTKGCEEYAKVLANNEKLEHSSSA--GQNYGENLCMRSQTPL-----QCVQDWYDEIADYDFE-KPQFAMSTGHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPI 161          

HSP 2 Score: 48.521 bits (114), Expect = 4.256e-6
Identity = 22/52 (42.31%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIG 444
            GHF  +VWK   ++G G++K   G + V+ARY  P N+ G+F  NV   I G
Sbjct:  112 GHFTALVWKNAKKMGIGQAKDKKGYYWVVARYYPPVNVNGQFEENVLPPIKG 163          
BLAST of Venom allergen 5 vs. Ensembl Fly
Match: CG4270 (gene:FBgn0031407 transcript:FBtr0077755)

HSP 1 Score: 59.6918 bits (143), Expect = 2.800e-10
Identity = 36/118 (30.51%), Postives = 59/118 (50.00%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGY-SNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGIS 1779
            F   +    N+YR  H    +  N  +N+LAQ WA ++   N + +  N KY     GENI L   G +    D  V  WY+E  ++ +  + + V   GHF+Q++W  + E+G G++
Sbjct:   31 FLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNPKY-----GENIFLS--GGMDVTGDLPVEMWYREINSYDFN-KAQFVPTAGHFTQLIWKSSVEMGSGVA 140          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33044681:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000180085.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 93.2041 bits (230), Expect = 1.382e-21
Identity = 50/150 (33.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID-KMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKPT 1866
             F    L++HN YR++H   PL  N+ +   AQ WA+++ +   + +SN+ Y     GEN+      +       + V +WY E +++ +   P      GHF+QVVW  TKE+G+G++T      +V  Y P GNI   G F KN+ PT
Sbjct:    4 SFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGHEAVDSWYGEIKDYNFS-RPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAGYFEKNVLPT 147          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: AL929549.2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:33037880:-1 gene:ENSDARG00000113959.1 transcript:ENSDART00000189171.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929549.2)

HSP 1 Score: 92.0485 bits (227), Expect = 2.792e-21
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFI-DKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKPT 1866
             L++HN YR++H   PL  N+ +   AQ WA+++ +   + +SN+ Y     GEN+      +      ++ V +WY E +++ +   P      GHF+QVVW  TKE+G+G++T      +V  Y P GNI   G F KN+ PT
Sbjct:    6 FLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGNEAVDSWYGEIKDYNFS-RPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAGYFEKNVLPT 144          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: CR855258.3 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33047654:-1 gene:ENSDARG00000113775.1 transcript:ENSDART00000179830.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855258.3)

HSP 1 Score: 88.1965 bits (217), Expect = 5.010e-20
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 1450 IHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID-KMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKPT 1866
            +HN YR++H   PL  N+ +   AQ WA+++ +   + +SN+ Y     GEN+      +       + V +WY E +++ +   P      GHF+QVVW  TKE+G+G++T      +V  Y P GNI   G F KN+ PT
Sbjct:    6 VHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGHEAVDSWYGEIKDYNFS-RPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAGYFEKNVLPT 141          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr2 (GLI pathogenesis-related 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4424])

HSP 1 Score: 93.9745 bits (232), Expect = 1.449e-19
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID-KMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKPT 1866
              F    L++HN YR++H   PL  N+ +   AQ WA+++ +   + +SN+ Y     GEN+      +       + V +WY E +++ +   P      GHF+QVVW  TKE+G+G++T      +V  Y P GNI   G F KN+ PT
Sbjct:    3 SSFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGHEAVDSWYGEIKDYNFS-RPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAGYFEKNVLPT 147          

HSP 2 Score: 84.7297 bits (208), Expect = 1.102e-16
Identity = 47/150 (31.33%), Postives = 74/150 (49.33%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKP 1863
              F    L+ HN YR+ H   PL  N  ++  AQ WA+++ +   + +SN  +     GEN+      +      +  V +WY E + + +   P      GHF+QVVW  +KE+G+G++T    S +V  Y P GNI   G F +N+ P
Sbjct:  194 SSFEAEFLQTHNAYRKHHGAPPLTININLSRSAQKWAEHLLSIRTLMHSNGDH-----GENVYYAYNSANKKLTGREAVESWYNEIKEYNFS-RPGFSSKTGHFTQVVWKDSKELGVGLATDGSTSFVVGQYLPGGNITNAGYFERNVLP 337          

HSP 3 Score: 79.7221 bits (195), Expect = 4.732e-15
Identity = 45/150 (30.00%), Postives = 82/150 (54.67%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSL-PSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVI-VCFYFPPGNIK--GEFVKNIKPT 1866
            FR ++L+  N YRR+H  KPL     +++ AQ+WA ++A+   +  S + Y     GE +  +   S+ P    ++  NWY++   + + I P      G+F+Q++W  ++++G+G+ +  +   I V FY P GNI   G F  N++P+
Sbjct:  397 FRQSLLKAVNDYRRQHGAKPLSLCPVLSKEAQDWAAHLASIGALQNSRKGY-----GETLSYKWTSSMVPPTGKEVAENWYKDNVKYNFAI-PGFQKGTGNFTQMIWRSSEQVGVGLGSDGKGMFITVAFYNPSGNITNPGFFQDNVRPS 540          
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Match: glipr2 (GLI pathogenesis-related 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4424])

HSP 1 Score: 93.5893 bits (231), Expect = 1.494e-19
Identity = 50/151 (33.11%), Postives = 78/151 (51.66%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID-KMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKPT 1866
              F    L++HN YR++H   PL  N+ +   AQ WA+++ +   + +SN+ Y     GEN+      +       + V +WY E +++ +   P      GHF+QVVW  TKE+G+G++T      +V  Y P GNI   G F KN+ PT
Sbjct:    4 SSFEAEFLQVHNAYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSNKGY-----GENLYYAWSSANKKLTGHEAVDSWYGEIKDYNFS-RPGFSSKTGHFTQVVWKDTKELGVGLATDGNTIFVVGQYLPAGNIANAGYFEKNVLPT 148          

HSP 2 Score: 84.7297 bits (208), Expect = 1.135e-16
Identity = 47/150 (31.33%), Postives = 74/150 (49.33%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNI--KGEFVKNIKP 1863
              F    L+ HN YR+ H   PL  N  ++  AQ WA+++ +   + +SN  +     GEN+      +      +  V +WY E + + +   P      GHF+QVVW  +KE+G+G++T    S +V  Y P GNI   G F +N+ P
Sbjct:  195 SSFEAEFLQTHNAYRKHHGAPPLTININLSRSAQKWAEHLLSIRTLMHSNGDH-----GENVYYAYNSANKKLTGREAVESWYNEIKEYNFS-RPGFSSKTGHFTQVVWKDSKELGVGLATDGSTSFVVGQYLPGGNITNAGYFERNVLP 338          

HSP 3 Score: 79.7221 bits (195), Expect = 4.745e-15
Identity = 45/150 (30.00%), Postives = 82/150 (54.67%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSL-PSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVI-VCFYFPPGNIK--GEFVKNIKPT 1866
            FR ++L+  N YRR+H  KPL     +++ AQ+WA ++A+   +  S + Y     GE +  +   S+ P    ++  NWY++   + + I P      G+F+Q++W  ++++G+G+ +  +   I V FY P GNI   G F  N++P+
Sbjct:  398 FRQSLLKAVNDYRRQHGAKPLSLCPVLSKEAQDWAAHLASIGALQNSRKGY-----GETLSYKWTSSMVPPTGKEVAENWYKDNVKYNFAI-PGFQKGTGNFTQMIWRSSEQVGVGLGSDGKGMFITVAFYNPSGNITNPGFFQDNVRPS 541          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: echdc1 (ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;Acc:XB-GENE-958554])

HSP 1 Score: 91.6633 bits (226), Expect = 3.057e-21
Identity = 49/140 (35.00%), Postives = 82/140 (58.57%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSV-IVCFYFPPGNIKGEFVKNI 1857
             LE HN+YR++HN  P++ N E+++ AQ WA ++ + N++ +S         GEN+      S  S  +  V  WY E +++ Y  +P      GHF+QVVW  +KE+G+G++T  + +  +V  Y PPGN+ G+F +N+
Sbjct:   11 FLEAHNKYRKKHNVPPMRLNAELSKSAQTWANHLLSINKMQHSGAG------GENLYY----SYSSRGNVAVDAWYNEVKDYDYN-KPGFKAATGHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVIGQFQENV 139          

HSP 2 Score: 54.6842 bits (130), Expect = 2.605e-8
Identity = 21/46 (45.65%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNV 426
            GHF Q+VWK++ E+G G +    G + V+ RY  PGN++G+F  NV
Sbjct:   94 GHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVIGQFQENV 139          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 86.6557 bits (213), Expect = 5.551e-17
Identity = 50/150 (33.33%), Postives = 88/150 (58.67%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKG-SLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCF-YFPPGNIK--GEFVKNIKP 1863
            +F    L+ +N YR RH  KPL+ N +I++ AQ WA+++     + +S+  +     GENI  +  G S+     ++  +WY+E++N+ +  +P    D GHF+Q+VW  +KE+G+G++++ +  +IV   Y P GNI   G + +NI P
Sbjct:  385 EFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTSH-----GENIWAKSGGPSITVTGQEVADSWYKEEKNYNFS-KPGYQADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNILP 528          

HSP 2 Score: 83.5741 bits (205), Expect = 4.976e-16
Identity = 51/156 (32.69%), Postives = 78/156 (50.00%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGEN-------IVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNIK--GEFVKNIKPT 1866
            F  + L  HN YRR+H   PL+ ++++   AQ WA ++ +   +     ++ G   GEN       +  +L G  P      V  WY E +N+ +G  P    + GHF+QVVW  +KE+G+G++T       +V  Y P GNI   G F KN+ P 
Sbjct:   18 FEQDFLAAHNTYRRKHGAPPLQLSRDLCRSAQQWADHLLSIRTL-----EHSGGNTGENLYYKYSSVARELPGQEP------VDAWYDEIKNYDFG-RPGFRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNVLPA 161          

HSP 3 Score: 80.8777 bits (198), Expect = 3.285e-15
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSL-PSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVI-VCFYFPPGNIK--GEFVKNIKPTIT 1872
            +     F    L+ HN+YRR+H    L+ ++E+ + +Q WA ++ + N + +SN        GEN+  +   S+  +   ++V  WY E +++ +G  P    + GHF+QVVW  ++E+G+  +   +  VI V  Y P GNI   G F KN+ P  T
Sbjct:  200 QAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNT-----ANGENLWYKWNSSMRDASGAEVVETWYNEIKDYSFG-RPGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNVLPKGT 351          

HSP 4 Score: 73.1738 bits (178), Expect = 8.005e-13
Identity = 46/156 (29.49%), Postives = 81/156 (51.92%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLK--GSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI--KGEFVKNIKP 1863
            E+ +  FR ++L  HNQYR+ H    L+ +  +++ AQ WA ++     +  S+  +     GEN+  +     SLP+   ++  +WY E   + +   P      G+F+Q++W  + ++G G+ST ++   + V FY P GNI  KG F  N+ P
Sbjct:  557 EKELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHH-----GENLWYRWGTNTSLPTG-KEVAESWYNENAKYSFAT-PGFQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVLP 705          

HSP 5 Score: 43.8986 bits (102), Expect = 2.252e-9
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNVQHR 435
            G+F Q++WK +S+VGFG S  + G +I +  Y   GNI   G F +NV  R
Sbjct:  656 GNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVLPR 706          

HSP 6 Score: 38.891 bits (89), Expect = 2.252e-9
Identity = 23/77 (29.87%), Postives = 39/77 (50.65%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSH------YLFGENKSFSNYKQSGEEITLKWYREVDEFKFS 217
            R LH A  L+LS+ L++D+Q  +D++  K       +H      Y +G N S      +G+E+   WY E  ++ F+
Sbjct:  575 RKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHHGENLWYRWGTNTSLP----TGKEVAESWYNENAKYSFA 647          

HSP 7 Score: 45.0542 bits (105), Expect = 6.287e-7
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV 405
            GHF Q+VWK + EVG G + +  G  IV+A+Y   GNI 
Sbjct:  479 GHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNIT 517          

HSP 8 Score: 29.6462 bits (65), Expect = 6.287e-7
Identity = 21/76 (27.63%), Postives = 42/76 (55.26%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN----KSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            RS H A PL+L+ ++++++Q  ++++   +K +K  S    GEN        +   +G+E+   WY+E   + FS+
Sbjct:  398 RSRHGAKPLQLNSKISQEAQRWAEHLL-NLKTLKH-SDTSHGENIWAKSGGPSITVTGQEVADSWYKEEKNYNFSK 471          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: trappc3 (trafficking protein particle complex 3 [Source:Xenbase;Acc:XB-GENE-1003911])

HSP 1 Score: 86.6557 bits (213), Expect = 5.757e-17
Identity = 50/150 (33.33%), Postives = 88/150 (58.67%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKG-SLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCF-YFPPGNIK--GEFVKNIKP 1863
            +F    L+ +N YR RH  KPL+ N +I++ AQ WA+++     + +S+  +     GENI  +  G S+     ++  +WY+E++N+ +  +P    D GHF+Q+VW  +KE+G+G++++ +  +IV   Y P GNI   G + +NI P
Sbjct:  374 EFALEFLKANNVYRSRHGAKPLQLNSKISQEAQRWAEHLLNLKTLKHSDTSH-----GENIWAKSGGPSITVTGQEVADSWYKEEKNYNFS-KPGYQADTGHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNITNPGFYGRNILP 517          

HSP 2 Score: 80.8777 bits (198), Expect = 3.213e-15
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSL-PSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVI-VCFYFPPGNIK--GEFVKNIKPTIT 1872
            +     F    L+ HN+YRR+H    L+ ++E+ + +Q WA ++ + N + +SN        GEN+  +   S+  +   ++V  WY E +++ +G  P    + GHF+QVVW  ++E+G+  +   +  VI V  Y P GNI   G F KN+ P  T
Sbjct:  189 QAGAGSFEQEALDAHNKYRRQHGAPQLQLSRELCDSSQKWADHLLSINALQHSNT-----ANGENLWYKWNSSMRDASGAEVVETWYNEIKDYSFG-RPGFQSNTGHFTQVVWKDSREVGVAKAVDGKGMVIAVAQYSPAGNITNPGYFQKNVLPKGT 340          

HSP 3 Score: 74.3294 bits (181), Expect = 4.142e-13
Identity = 47/145 (32.41%), Postives = 73/145 (50.34%), Query Frame = 1
Query: 1462 YRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGEN-------IVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNIK--GEFVKNIKPT 1866
            YRR+H   PL+ ++++   AQ WA ++ +   +     ++ G   GEN       +  +L G  P      V  WY E +N+ +G  P    + GHF+QVVW  +KE+G+G++T       +V  Y P GNI   G F KN+ P 
Sbjct:    1 YRRKHGAPPLQLSRDLCRSAQQWADHLLSIRTL-----EHSGGNTGENLYYKYSSVARELPGQEP------VDAWYDEIKNYDFG-RPGFRSNTGHFTQVVWKDSKEVGVGVATDGNGLYFVVGQYNPAGNITNPGYFEKNVLPA 133          

HSP 4 Score: 73.1738 bits (178), Expect = 7.847e-13
Identity = 46/156 (29.49%), Postives = 81/156 (51.92%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLK--GSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI--KGEFVKNIKP 1863
            E+ +  FR ++L  HNQYR+ H    L+ +  +++ AQ WA ++     +  S+  +     GEN+  +     SLP+   ++  +WY E   + +   P      G+F+Q++W  + ++G G+ST ++   + V FY P GNI  KG F  N+ P
Sbjct:  546 EKELKSFRKDLLSEHNQYRKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHH-----GENLWYRWGTNTSLPTG-KEVAESWYNENAKYSFAT-PGFQSGSGNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVLP 694          

HSP 5 Score: 43.5134 bits (101), Expect = 2.827e-9
Identity = 22/51 (43.14%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNVQHR 435
            G+F Q++WK +S+VGFG S  + G +I +  Y   GNI   G F +NV  R
Sbjct:  645 GNFTQMIWKSSSQVGFGLSTDNKGMYIAVGFYDPAGNIANKGYFEDNVLPR 695          

HSP 6 Score: 38.891 bits (89), Expect = 2.827e-9
Identity = 23/77 (29.87%), Postives = 39/77 (50.65%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSH------YLFGENKSFSNYKQSGEEITLKWYREVDEFKFS 217
            R LH A  L+LS+ L++D+Q  +D++  K       +H      Y +G N S      +G+E+   WY E  ++ F+
Sbjct:  564 RKLHGAGALQLSVALSQDAQKWADHLVGKRALQNSDTHHGENLWYRWGTNTSLP----TGKEVAESWYNENAKYSFA 636          

HSP 7 Score: 44.669 bits (104), Expect = 7.635e-7
Identity = 19/39 (48.72%), Postives = 25/39 (64.10%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV 405
            GHF Q+VWK + EVG G + +  G  IV+A+Y   GNI 
Sbjct:  468 GHFTQMVWKASKEVGVGLASSGKGMLIVVAQYNPSGNIT 506          

HSP 8 Score: 29.6462 bits (65), Expect = 7.635e-7
Identity = 21/76 (27.63%), Postives = 42/76 (55.26%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN----KSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            RS H A PL+L+ ++++++Q  ++++   +K +K  S    GEN        +   +G+E+   WY+E   + FS+
Sbjct:  387 RSRHGAKPLQLNSKISQEAQRWAEHLL-NLKTLKH-SDTSHGENIWAKSGGPSITVTGQEVADSWYKEEKNYNFSK 460          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 64.6994 bits (156), Expect = 6.175e-11
Identity = 50/150 (33.33%), Postives = 73/150 (48.67%), Query Frame = 1
Query: 1432 RNNILEIHNQYRRRHNTKPLKSNQ-------EINELAQNWAQYIATANQIGYSNQKYKGHV----VGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVD-DIGHFSQVVWDKTKEIGIGISTTSRYSV-----IVCFYFPPGN 1830
            R  I++IHN YRR  N  P  SN        E    A+NWA    T NQ  Y +Q     +     GEN+ +    S P+  ++++ + + E +NF+YG+  K V   IGH++QV+W K+  IG   +      V      VC Y+P GN
Sbjct:   34 RQKIVDIHNAYRRSAN--PTASNMLKMSWSIEAENNAKNWA---TTCNQ--YHSQPAARQIANITCGENLFMS---SYPASWEEVIQSLHSEYDNFEYGVGAKAVGLVIGHYTQVMWYKSYRIGCYCTECPNDGVRLKYYYVCQYYPAGN 173          
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Match: stn1 (STN1, CST complex subunit [Source:Xenbase;Acc:XB-GENE-988862])

HSP 1 Score: 63.5438 bits (153), Expect = 1.378e-10
Identity = 43/137 (31.39%), Postives = 63/137 (45.99%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKPLKSNQ----EINELAQNWAQYIAT--ANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGN 1830
            I+  HN YRR  N  P   N          A N A + AT  A     S +   G   GENI +    S P+   + +  W  E + FQYG+ P + + + GH++Q+VW  +  +G  +S  +   + VC Y P GN
Sbjct:   38 IINAHNNYRR--NASPSARNMLKMMWSEAAASNAATWSATCPAAHSPTSQRTISGVTCGENIFI---ASYPASWQEAITAWNSESQYFQYGVGPTSSNQVTGHYTQLVWYNSYMVGCAVSNCNNQYIYVCQYCPMGN 169          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr2 (GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:MGI:1917770])

HSP 1 Score: 82.8037 bits (203), Expect = 4.601e-18
Identity = 48/148 (32.43%), Postives = 81/148 (54.73%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F N +L+ HN+YR +H   PLK  +++N  AQ +++ +A+   + +S +  +G   GEN+      S       +   WY E +++ +  +P      GHF+ +VW  TK+IG+G ++ S   S +V  YFP GNI  +G F +N+ P
Sbjct:    9 FNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAW---ASYDQTGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPP 151          

HSP 2 Score: 50.447 bits (119), Expect = 1.326e-14
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            R+ H  PPLKL  +L  ++Q  S+ +A  R +K   + S    GEN ++++Y Q+G+++  +WY E+  + F Q
Sbjct:   21 RAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKDVADRWYSEIKSYNFQQ 94          

HSP 3 Score: 49.2914 bits (116), Expect = 1.326e-14
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GNIV  G F  NV
Sbjct:  102 GHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV 149          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Glipr1l1 (GLI pathogenesis-related 1 like 1 [Source:MGI Symbol;Acc:MGI:1916536])

HSP 1 Score: 60.8474 bits (146), Expect = 8.684e-10
Identity = 54/182 (29.67%), Postives = 82/182 (45.05%), Query Frame = 1
Query: 1336 PKKVGSEYTDLDLIDGINDEEEVFNERNIDDFRNNILEIHNQYRRR-----HNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKG----HVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRY-----SVIVCFYFPPGNIKG 1839
            PK  G    DL  +  I D       + ID F N    IHN+ RR+      +   L  +Q++ +LA+ W +    A+      Q+Y+       +GENI L   G + +  + +V NWY E + F +     + +  GH++QVVW KT +IG  +S           + VC Y P GN  G
Sbjct:   23 PKAFGK---DLPRVPTITDP------KFIDAFLN----IHNELRRKVQPPAADMNQLFWDQQLAKLAKAWTRECKLAHNPCI-KQRYECLEDYDFIGENIYL---GRIETQPEDVVINWYNESKYFNFDFNTCS-EMCGHYTQVVWAKTVKIGCAVSNCPNLKGFSAGLFVCNYSPAGNFIG 186          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 59.6918 bits (143), Expect = 8.009e-9
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKP-----LKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTT--------SRYSVIVCFYFPPGNIKG 1839
             +D +  ++++HNQYR + +        ++ + E+   A+ +AQ         + + K +G   GEN+       +   +   V NW++E E + +     + + + GH++QVVW KT+ IG G            +   ++VC Y PPGN+KG
Sbjct:   31 TEDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCV------WGHNKERGRR-GENLFAITDEGM--DVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKG 175          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 57.7658 bits (138), Expect = 1.112e-8
Identity = 40/153 (26.14%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKP-----LKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTT--------SRYSVIVCFYFPPGNIKG 1839
            +D +  ++++HNQYR + +        ++ + E+   A+ +AQ         + + K +G   GEN+       +   +   V NW++E E + +     + + + GH++QVVW KT+ IG G            +   ++VC Y PPGN+KG
Sbjct:   32 EDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCV------WGHNKERGRR-GENLFAITDEGM--DVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKG 175          
BLAST of Venom allergen 5 vs. Ensembl Mouse
Match: Pi16 (peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:1921366])

HSP 1 Score: 57.7658 bits (138), Expect = 1.112e-8
Identity = 40/153 (26.14%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKP-----LKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDI-GHFSQVVWDKTKEIGIGISTT--------SRYSVIVCFYFPPGNIKG 1839
            +D +  ++++HNQYR + +        ++ + E+   A+ +AQ         + + K +G   GEN+       +   +   V NW++E E + +     + + + GH++QVVW KT+ IG G            +   ++VC Y PPGN+KG
Sbjct:   32 EDEKQTMVDLHNQYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCV------WGHNKERGRR-GENLFAITDEGM--DVPLAVGNWHEEHEYYNFSTATCDPNQMCGHYTQVVWSKTERIGCGSHFCETLQGVEEANIHLLVCNYEPPGNVKG 175          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9H4G4|GAPR1_HUMAN (Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens OX=9606 GN=GLIPR2 PE=1 SV=3)

HSP 1 Score: 83.5741 bits (205), Expect = 1.416e-17
Identity = 47/148 (31.76%), Postives = 82/148 (55.41%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F N +L+ HN+YR++H   PLK  + +N  AQ +++ +A+   + +S +  +G   GEN+      S      ++   WY E +N+ +  +P      GHF+ +VW  TK++G+G ++ S   S +V  YFP GN+  +G F +N+ P
Sbjct:    9 FHNEVLKAHNEYRQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAW---ASYDQTGKEVADRWYSEIKNYNF-QQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENVLP 151          

HSP 2 Score: 50.8322 bits (120), Expect = 1.437e-13
Identity = 26/74 (35.14%), Postives = 42/74 (56.76%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            R  H  PPLKL   L  ++Q  S+ +A  R +K   + S    GEN ++++Y Q+G+E+  +WY E+  + F Q
Sbjct:   21 RQKHGVPPLKLCKNLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKEVADRWYSEIKNYNFQQ 94          

HSP 3 Score: 48.521 bits (114), Expect = 1.437e-13
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GN+V  G F  NV
Sbjct:  102 GHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFEENV 149          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|Q9CYL5|GAPR1_MOUSE (Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus OX=10090 GN=Glipr2 PE=1 SV=3)

HSP 1 Score: 82.8037 bits (203), Expect = 3.218e-17
Identity = 48/148 (32.43%), Postives = 81/148 (54.73%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS-RYSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F N +L+ HN+YR +H   PLK  +++N  AQ +++ +A+   + +S +  +G   GEN+      S       +   WY E +++ +  +P      GHF+ +VW  TK+IG+G ++ S   S +V  YFP GNI  +G F +N+ P
Sbjct:    9 FNNEVLKAHNEYRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQ-CGENLAW---ASYDQTGKDVADRWYSEIKSYNF-QQPGFTSGTGHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENVPP 151          

HSP 2 Score: 50.447 bits (119), Expect = 8.106e-14
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            R+ H  PPLKL  +L  ++Q  S+ +A  R +K   + S    GEN ++++Y Q+G+++  +WY E+  + F Q
Sbjct:   21 RAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQCGENLAWASYDQTGKDVADRWYSEIKSYNFQQ 94          

HSP 3 Score: 49.2914 bits (116), Expect = 8.106e-14
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GNIV  G F  NV
Sbjct:  102 GHFTAMVWKNTKKIGVGKASASDGSSFVVARYFPAGNIVNQGFFEENV 149          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P47033|PRY3_YEAST (Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY3 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 4.785e-15
Identity = 51/150 (34.00%), Postives = 75/150 (50.00%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRH-NTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI--STTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +F +++L  HN++R  H +T PL  +  +   AQN+A     +  + +S+  Y     GEN+ L        + D   V  WY E   + Y   P   +  GHF+QVVW  T EIG G     T+  + IVC Y PPGN  GEF + ++P
Sbjct:   24 NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPY-----GENLAL-------GYTDTGAVDAWYGEISKYNYS-NPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEP 160          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P47032|PRY1_YEAST (Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.162e-13
Identity = 45/144 (31.25%), Postives = 70/144 (48.61%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKP-LKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTT--SRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +L  HN+ R  H   P L  +  +   AQ++A     +  + +S   Y     GEN+ L   G  P+ +D     WY E  N+ +   P    + GHF+QVVW  T ++G GI T   +    ++C Y P GN +GE+  N++P
Sbjct:  166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPY-----GENLALGYDG--PAAVDA----WYNEISNYDFS-NPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEP 297          
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Match: sp|P81657|VA5_VESMA (Venom allergen 5 OS=Vespa mandarinia OX=7446 PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.681e-12
Identity = 53/157 (33.76%), Postives = 76/157 (48.41%), Query Frame = 1
Query: 1441 ILEIHNQYR----RRHNTK-------PLKS------NQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSF--IDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIG----ISTTSRYSVIVCFYFPPGNIKGE 1842
            IL+ HN++R    R   T+       P KS      N E+ ++AQ WA      + +  +  KY    VG+NI  +   +  SF  +  MV  W  E +N+QYG     + ++GH++Q+VW KTKEIG G    I        +VC Y P GNI  E
Sbjct:   44 ILKQHNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWAGQCDYGHDVCRNTAKYS---VGQNIA-ENGSTAASFASVSNMVQMWADEVKNYQYGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGNE 196          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A5J4NM49 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003127 PE=3 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 6.287e-29
Identity = 61/172 (35.47%), Postives = 99/172 (57.56%), Query Frame = 1
Query: 1366 LDLIDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIV--LQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI--STTSRYSVIVCFYFPPGNIKGEFVKNIKPTI 1869
             ++   ++D+E +     ++ FR  +L  HN+YR  H    LK N  ++ +A  WAQ +     + YS  KY G ++GENI   L + G +      +V  WY+E + + Y  EP++   +GHF+Q++W KTKE+G+G   S T   + IVCFY PPGN+K E+++N+ P +
Sbjct:  307 FEICRSLHDKEAL-----LEAFRCEVLHTHNRYRTLHGVPVLKRNLRLDRMASEWAQKLKETGHLAYSGNKYNGQLMGENICDRLTVDGRITG--QTLVGKWYEEGKQYVYEHEPESTKTLGHFTQLIWRKTKELGVGFTASNTLERAFIVCFYHPPGNVKSEYMENVCPPL 471          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1B6GU91 (Uncharacterized protein OS=Cuerna arida OX=1464854 GN=g.37231 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 3.476e-25
Identity = 62/199 (31.16%), Postives = 111/199 (55.78%), Query Frame = 1
Query: 1300 NKINLKDEEIIQPKKVGSEYTDLDL--------IDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGY-SNQKYKGHVVGENIVLQLKGSLPSFIDK--MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +++NL+ E++  P  + +      L        I       +   + N ++F    LE HN+YR +H  +PLK N E++  AQ+WA ++A+  ++ +  N KY     GEN+ + +       ++    V +WYQE + +++G EPKN+D  GH +QV+W  ++ +G+G++ +  Y+ +VC Y PPGN KGE+ +N+ P
Sbjct:  135 SQVNLRSEKLKSPSNISTPLKTQSLPRQSSNASIKSTPRTPQKTKDINKEEFTKQCLERHNEYRAKHKVQPLKLNTELSAFAQDWADHLASTQKMVHRPNNKY-----GENLWMMMTTDRSYKVNGGDAVDSWYQELDKYKFGTEPKNLD-AGHLTQVLWSTSEYLGVGVAKSGDYTFVVCNYNPPGNYKGEYAENVPP 327          

HSP 2 Score: 90.1225 bits (222), Expect = 3.921e-15
Identity = 54/153 (35.29%), Postives = 79/153 (51.63%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGY-SNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDD----IGHFSQVVWDKTKEIGIGISTTSRYSVI-VCFYFPPGNIKGEFVKNIKP 1863
            + F    L IHN+YR +H    L  + EI++ AQ WA ++A  NQ  + +N  Y     GENI      S  +    M  +WY E+  + Y I+P          GHF+Q+VW ++K +GIG + T   ++I V  Y P GNI G+F  N+ P
Sbjct:  352 ETFTKEALRIHNEYRAKHGVPALSIDPEISKFAQAWADHLAEKNQFAHRTNNPY-----GENIFWS---SASASAKVMCDSWYGEEAGYNYDIDPFKSGGGGLRSGHFTQMVWKQSKSLGIGRAFTKSGTMIAVANYSPRGNIIGQFTANVLP 496          

HSP 3 Score: 48.1358 bits (113), Expect = 6.039e-8
Identity = 29/84 (34.52%), Postives = 50/84 (59.52%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN-----KSFSNYKQSGEEITLKWYREVDEFKFSQERQNLAA 241
            R+ HK  PLKL+ +L+  +Q  +D++A   K V + ++  +GEN      +  +YK +G +    WY+E+D++KF  E +NL A
Sbjct:  198 RAKHKVQPLKLNTELSAFAQDWADHLASTQKMVHRPNNK-YGENLWMMMTTDRSYKVNGGDAVDSWYQELDKYKFGTEPKNLDA 280          

HSP 4 Score: 39.6614 bits (91), Expect = 6.039e-8
Identity = 20/57 (35.09%), Postives = 30/57 (52.63%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYP 459
            GH  Q++W  +  +G G +K+ D    V+  Y  PGN  G++  NV   I GW+  P
Sbjct:  281 GHLTQVLWSTSEYLGVGVAKSGDYT-FVVCNYNPPGNYKGEYAENVP-PIGGWKDKP 335          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A0R3W1S1 (SCP domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS3707 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.418e-25
Identity = 59/170 (34.71%), Postives = 91/170 (53.53%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYK--GHVVGENIVLQLK-GSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGIST---------------TSRYSVIVCFYFPPGNIKGEFVKNIKPTITQKQ 1881
            +F   +L++HN+YRR H    L  N  +N +AQ WA ++   ++I  SN  +   G  +GENI  +   G L      +V NWYQE   F+YG EP ++  IG+F+Q+VW  ++ +G+G +                 S   V+VCFYFPPGN+   F  N+ P + +K+
Sbjct:  152 EFSEEMLKLHNRYRRLHGAPDLVLNSRLNTMAQEWADFLV--DEICLSNSGFTIDGVRLGENITSRWSNGELEESASDVVSNWYQESSRFKYGREPVSIQGIGNFTQMVWASSRNLGVGRAIRIARNDESTEKPPNPLSSKIVVVCFYFPPGNVATYFTDNVHPPLAEKE 319          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A4E0S1T5 (SCP domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_002411 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.129e-24
Identity = 54/152 (35.53%), Postives = 89/152 (58.55%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI--STTSRYSVIVCFYFPPGNIKGEFVKNIKPTI 1869
            ++ F+  +L   N+YR  H    LK N+E++ LAQ+WA+ +  A ++ YSN +Y    +GE +  + + +     + +V  WY E +++ Y  EP +    G F+Q+VW  ++E+G+G   S      +IVCFYFP GN+KG+FV N+ P I
Sbjct:  164 LEAFQIEVLHTQNRYRESHGVPSLKKNRELDRLAQSWAEELYNAEKLSYSNWEYNSRPLGEIVSCRTRKNSRISGEVLVSKWYHESQSYDYTREPDSSTRSGWFTQLVWKDSRELGVGFIPSREPDSVIIVCFYFPTGNVKGKFVDNVLPPI 315          
BLAST of Venom allergen 5 vs. TrEMBL
Match: A0A1B6IKP7 (SCP domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.44324 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.171e-24
Identity = 61/199 (30.65%), Postives = 110/199 (55.28%), Query Frame = 1
Query: 1300 NKINLKDEEIIQPKKVGSEYTDLDL--------IDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGY-SNQKYKGHVVGENIVLQLKGSLPSFIDK--MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +++NL+ E++  P  + +      L        I       +   + N ++F    LE HN+YR +H  + LK N E++  AQ+WA ++A+  ++ +  N KY     GEN+ + +       ++    V +WYQE + +++G EPKN+D  GH +QV+W  ++ +G+G++ +  Y+ +VC Y PPGN KGE+ +N+ P
Sbjct:  153 SQVNLRTEKLKSPSNISTPLKTQSLPRQSSNASIKSTPRTPQKTKDINKEEFAKQCLERHNEYRAKHKVQSLKLNTELSAFAQDWADHLASTQKMVHRPNNKY-----GENLWMMMTTDRSYKVNGGDAVDSWYQELDKYKFGTEPKNLD-AGHLTQVLWATSEYLGVGVAKSGDYTFVVCNYNPPGNYKGEYTENVPP 345          

HSP 2 Score: 44.2838 bits (103), Expect = 5.109e-7
Identity = 29/88 (32.95%), Postives = 51/88 (57.95%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN-----KSFSNYKQSGEEITLKWYREVDEFKFSQERQNLAAICLS 253
            R+ HK   LKL+ +L+  +Q  +D++A   K V + ++  +GEN      +  +YK +G +    WY+E+D++KF  E +NL A  L+
Sbjct:  216 RAKHKVQSLKLNTELSAFAQDWADHLASTQKMVHRPNNK-YGENLWMMMTTDRSYKVNGGDAVDSWYQELDKYKFGTEPKNLDAGHLT 302          

HSP 3 Score: 40.4318 bits (93), Expect = 5.109e-7
Identity = 20/57 (35.09%), Postives = 30/57 (52.63%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYP 459
            GH  Q++W  +  +G G +K+ D    V+  Y  PGN  G++  NV   I GW+  P
Sbjct:  299 GHLTQVLWATSEYLGVGVAKSGDYT-FVVCNYNPPGNYKGEYTENVPP-IGGWKDKP 353          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000037136.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:26526:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000037136.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 9.944e-23
Identity = 50/152 (32.89%), Postives = 81/152 (53.29%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKPTIT 1872
            +F    L+ HN YR++H   PL  +Q+++  A+ WA+++ +   + +SN++Y     GEN+         S   +  V +WY E +++ +   P      GHF+QVVW  TKE+G G++T  +   +V  Y PPGN    G F KN+ P  T
Sbjct:   21 NFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEIKDYNFS-RPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFVVGQYLPPGNFTNPGAFEKNVLPAGT 166          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000051775.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:28035:32028:1 gene:ENSAMXG00000030558.1 transcript:ENSAMXT00000051775.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 3.205e-22
Identity = 49/149 (32.89%), Postives = 79/149 (53.02%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNI 1857
             D F    L+ HN YR++H   PL  +Q+++  A+ WA+++ +   + +SN++Y     GEN+         S   +  V +WY E +++ +   P      GHF+QVVW  TKE+G G++T  +   +V  Y PPGN    G F KN+
Sbjct:    2 TDLFEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEVKDYNFS-RPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFVVGQYLPPGNFTNPGAFEKNV 144          

HSP 2 Score: 46.9802 bits (110), Expect = 9.717e-6
Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF Q+VWK+T EVG+G + TD     V+ +Y+ PGN    G F  NV
Sbjct:   98 GHFTQVVWKDTKEVGYGVA-TDGKTVFVVGQYLPPGNFTNPGAFEKNV 144          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000046499.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:22169:29035:1 gene:ENSAMXG00000037785.1 transcript:ENSAMXT00000046499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 2.035e-21
Identity = 50/151 (33.11%), Postives = 80/151 (52.98%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKPTIT 1872
            F    L+ HN YR++H   PL  +Q+++  A+ WA+++ +   + +SN++Y     GEN+         S   +  V +WY E +++ +   P      GHF+QVVW  TKE+G G++T  +   +V  Y PPGN    G F KN+ P  T
Sbjct:   16 FEEEFLQTHNTYRKKHGAPPLTISQDLSRSAKKWAEHLLSNKTLQHSNREY-----GENLYYAFSSGGKSLTGREAVDSWYNEIKDYNFS-RPGFSSGTGHFTQVVWKDTKEVGYGVATDGKTVFVVGQYLPPGNFTNPGAFEKNVLPAGT 160          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000045529.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:33202:35631:1 gene:ENSAMXG00000033350.1 transcript:ENSAMXT00000045529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 2.270e-21
Identity = 52/153 (33.99%), Postives = 79/153 (51.63%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFI-DKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKPTIT 1872
            D F    L+ HN YR +H   PL  +Q++   A++WA Y+ +   + +SN++Y     GEN+         S    + V +WY E +++ +   P      GHF+QVVW  TKE+G G++T  +   +V  Y PPGN    G F KN+ P  T
Sbjct:    4 DSFEVEFLQTHNTYRNKHGAPPLTISQDLCRSAKSWADYLLSIKTLQHSNKEY-----GENLYYAFSSGGKSLTGHEAVDSWYNEVKDYNFS-RPGFSSATGHFTQVVWKDTKEVGYGVATDGKTVFVVGQYLPPGNFTNPGAFEKNVLPAGT 150          
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Match: ENSAMXT00000056153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002310.1:17472:20230:1 gene:ENSAMXG00000040666.1 transcript:ENSAMXT00000056153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 4.075e-21
Identity = 51/153 (33.33%), Postives = 77/153 (50.33%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKPTIT 1872
              F    L+ HN YR +H  +PL  ++E+   AQ WA+++ +   + +S+    G   GEN+         S   +  V +WY E +++ Y   P      GHF+QVVW  TKE+G G++T  +   +V  Y PPGN    G F KN+ P  T
Sbjct:   13 SGFEKEFLQSHNTYRNKHGAQPLTISRELCRSAQAWAEHLLSIKTLQHSS----GGKFGENLFYTWSSGGKSLTGREAVDSWYNEVKDYNYS-RPGFSSGTGHFTQVVWKDTKELGYGVATDGKTVFVVGQYLPPGNFTNPGAFEKNVLPAGT 160          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002224.1 (pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002224.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 3.831e-12
Identity = 42/152 (27.63%), Postives = 75/152 (49.34%), Query Frame = 1
Query: 1438 NILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVV---GENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI--KGEFVKNIKPTITQ 1875
            ++L  HN+ R  H  +PL+ +  +   A+ WA+ +A +  +       + H     G+N  +++ GS+P    K+   WY ++  + Y   P      G+FSQ+VW  + ++G+G++   R   V V FY P GN+     +  N+ P  TQ
Sbjct:    1 DVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-------RSHPTVPHGQNRCVRV-GSIPR--RKVTNCWYADRLAYDYN-NPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNLPYAMSYRDNVLPPHTQ 141          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002228.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002228.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 6.027e-12
Identity = 39/170 (22.94%), Postives = 79/170 (46.47%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVF-NWYQEKENFQY---GIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTITQKQNIE*QNISLIYVTP 1923
            DF  ++L  HN  R RH   PL++   +   A+ WA+++     + +S+  +     GEN+  +  G+      K V  +WY E +++ +   G +PK    +G+  ++VW  ++ +G+G + + +  V+V   + P            P + Q+      +  +I V+P
Sbjct:   28 DFAGDLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTSH-----GENLYYRPLGAREQAPGKEVTEHWYSEVKHYDFSSPGYKPK----VGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDP------------PALGQRCATPSDDAEMIAVSP 176          

HSP 2 Score: 56.6102 bits (135), Expect = 8.037e-9
Identity = 38/144 (26.39%), Postives = 67/144 (46.53%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVV---GENIVLQLKGSLPSFID---KMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI 1833
            ++F  ++L  HN+ R  H  +PL+ +  +   A+ WA+ +A +  +       + H     G+N V          I    K+   WY ++  + Y   P      G+FSQ+VW  + ++G+G++   R   V V FY P GN+
Sbjct:  219 EEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-------RSHPTVPHGQNTVAFAWVRYRMLITAGRKVTNCWYADRLAYDYN-NPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNL 354          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002231.1 (pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 gene:ENSPMAG00000002025.1 transcript:ENSPMAT00000002231.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 8.343e-11
Identity = 33/148 (22.30%), Postives = 74/148 (50.00%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID-------KMVFNWYQEKENFQY---GIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYS-VIVCFYFPPGNIK 1836
            DF  ++L  HN  R RH   PL++   +   A+ WA+++     + +S+  +  ++    +  + +G+ P           ++  +WY E +++ +   G +PK    +G+  ++VW  ++ +G+G + + +   V+V  Y PP +I+
Sbjct:    1 DFAGDLLRAHNAARARHGAAPLRACAALEREARAWAEHLLERRALKHSDTSHGENLYYRPLGAREQGAEPGGTGLRLRGRKEVTEHWYSEVKHYDFSSPGYKPK----VGYLDKLVWRASQSLGVGRAVSPQGCVVVVAVYDPPKDIR 144          

HSP 2 Score: 61.2326 bits (147), Expect = 2.752e-10
Identity = 42/155 (27.10%), Postives = 76/155 (49.03%), Query Frame = 1
Query: 1387 NDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVV---GENIVLQLKGS--LPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI 1833
            +D E    E + ++F  ++L  HN+ R  H  +PL+ +  +   A+ WA+ +A +  +       + H     G+N+  +  G+  LP    K+   WY ++  + Y   P      G+FSQ+VW  + ++G+G++   R   V V FY P GN+
Sbjct:  176 SDVENGTPEEDQEEFCIDVLAEHNRLREIHGARPLRRSVALGRDARAWARELARSRAL-------RSHPTVPHGQNVWAKHIGTGELPKG-RKVTNCWYADRLAYDYN-NPGFQQGTGNFSQLVWRSSLDLGVGLACDGRGMFVAVAFYSPAGNL 321          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP2 (cysteine rich secretory protein 2 [Source:HGNC Symbol;Acc:HGNC:12024])

HSP 1 Score: 52.7582 bits (125), Expect = 2.191e-8
Identity = 31/86 (36.05%), Postives = 43/86 (50.00%), Query Frame = 1
Query: 1594 VGENIVLQLKGSLPSFIDKMVFNWYQEKE--NFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTS----RYSVIVCFYFPPGNI 1833
             GENI L    + P      V +WY E E   F +G  P    DIGH++QVVW  + ++G  ++       +Y V VC Y P GN+
Sbjct:    1 CGENIFLA---TAPLSWQDAVLDWYNEAEVPGFIFGKGPAAPGDIGHYTQVVWYSSFQLGCAVNYCPEAIYKY-VYVCHYCPAGNL 82          
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Match: CRISP3 (cysteine rich secretory protein 3 [Source:HGNC Symbol;Acc:HGNC:16904])

HSP 1 Score: 50.8322 bits (120), Expect = 2.827e-7
Identity = 40/150 (26.67%), Postives = 65/150 (43.33%), Query Frame = 1
Query: 1441 ILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGH-----------VVGENIVLQLKGSLPSFIDKMVFNWYQE--KENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTT------SRYSVIVCFYFPPGNI 1833
            I+++HN  RR  N  P   N     L   W +  A  N + ++N    GH             GENI +    S P   +  + +WY E     FQY +       +GH++Q+VW  + ++G  ++        ++Y + VC Y P GN+
Sbjct:   47 IVDLHNDLRR--NVTPSAGNM----LQMMWKKE-AYLNALSWANNCTFGHSPDARRKTTQWTCGENIFMS---SAPFTWNYAIRDWYNEVISPGFQYDVGSTTTGAVGHYTQLVWYNSFQLGCAVNYCPKNPGVAKY-LYVCHYCPMGNL 185          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY3 (Cell wall-associated protein involved in export of acetylated sterols; member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); role in mating efficiency; expression of full-length transcript is daughter cell-specific; in response to alpha factor, a short transcript starting at +452 is expressed and the long form is repressed by Ste12p [Source:SGD;Acc:S000003614])

HSP 1 Score: 82.8037 bits (203), Expect = 6.891e-17
Identity = 51/150 (34.00%), Postives = 75/150 (50.00%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRH-NTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI--STTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +F +++L  HN++R  H +T PL  +  +   AQN+A     +  + +S+  Y     GEN+ L        + D   V  WY E   + Y   P   +  GHF+QVVW  T EIG G     T+  + IVC Y PPGN  GEF + ++P
Sbjct:   24 NFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYADQYDCSGVLTHSDGPY-----GENLAL-------GYTDTGAVDAWYGEISKYNYS-NPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWNNYIVCSYNPPGNYLGEFAEEVEP 160          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY1 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY2; may be involved in detoxification of hydrophobic compounds; PRY1 has a paralog, PRY2, that arose from the whole genome duplication [Source:SGD;Acc:S000003615])

HSP 1 Score: 74.7146 bits (182), Expect = 4.349e-15
Identity = 45/144 (31.25%), Postives = 70/144 (48.61%), Query Frame = 1
Query: 1441 ILEIHNQYRRRH-NTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRY--SVIVCFYFPPGNIKGEFVKNIKP 1863
            +L  HN+ R  H +T  L  +  +   AQ++A     +  + +S   Y     GEN+ L   G  P+ +D     WY E  N+ +   P    + GHF+QVVW  T ++G GI T        ++C Y P GN +GE+  N++P
Sbjct:  166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPY-----GENLALGYDG--PAAVDA----WYNEISNYDFS-NPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPAGNYEGEYADNVEP 297          

HSP 2 Score: 46.595 bits (109), Expect = 6.668e-6
Identity = 23/49 (46.94%), Postives = 30/49 (61.22%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQW--IVIARYVKPGNIVGKFLNNVQ 429
            GHF Q+VWK T++VG G  KT  G W   VI  Y   GN  G++ +NV+
Sbjct:  249 GHFTQVVWKSTTQVGCGI-KTCGGAWGDYVICSYDPAGNYEGEYADNVE 296          
BLAST of Venom allergen 5 vs. Ensembl Yeast
Match: PRY2 (Sterol binding protein involved in the export of acetylated sterols; secreted glycoprotein and member of the CAP protein superfamily (cysteine-rich secretory proteins (CRISP), antigen 5, and pathogenesis related 1 proteins); sterol export function is redundant with that of PRY1; may be involved in detoxification of hydrophobic compounds; PRY2 has a paralog, PRY1, that arose from the whole genome duplication [Source:SGD;Acc:S000001721])

HSP 1 Score: 69.707 bits (169), Expect = 2.599e-13
Identity = 48/149 (32.21%), Postives = 71/149 (47.65%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRH-NTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGI-STTSRYS-VIVCFYFPPGNIKGEFVKNIKP 1863
            DF  +++  HN  R  H +T  L  +  +   AQN+A     +  + +S   Y     GEN+ L   G+  S +D     WY E  ++ Y   P   +  GHF+QVVW  T E+G G+ S    +   I+C Y   GN+ GEF  N+ P
Sbjct:  191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPY-----GENLALGY-GTTGS-VDA----WYNEITSYDYS-NPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIICSYKAAGNVIGEFADNVMP 327          

HSP 2 Score: 53.9138 bits (128), Expect = 3.855e-8
Identity = 24/48 (50.00%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQW--IVIARYVKPGNIVGKFLNNV 426
            GHF Q+VWK TSEVG G  K+  G+W   +I  Y   GN++G+F +NV
Sbjct:  279 GHFTQVVWKGTSEVGCGL-KSCGGEWGDYIICSYKAAGNVIGEFADNV 325          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO48881 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM8])

HSP 1 Score: 92.0485 bits (227), Expect = 5.178e-22
Identity = 53/147 (36.05%), Postives = 81/147 (55.10%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYS-VIVCFYFPPGNIKGEFVKNIKP 1863
            +F+N+IL+ HN YR +H TK LK N  +   AQ+WA+ +A  N I +S+ +  G  +       L G       K    WY E + +++   P      GHF+QVVW  + E+G G +T+S  +  +V  Y PPGN+ G+F +N+KP
Sbjct:    1 EFKNDILKTHNDYRAQHGTKALKWNARLASEAQSWAENLAQRNAIQHSSSREYGESIAYMSGAVLTGR------KATDMWYGEVDKYRFE-NPGFSTSSGHFTQVVWAGSTEMGAGKATSSSGAHFVVARYTPPGNVMGQFPENVKP 140          

HSP 2 Score: 54.299 bits (129), Expect = 1.453e-12
Identity = 21/47 (44.68%), Postives = 33/47 (70.21%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQ 429
            GHF Q+VW  ++E+G G++ +  G   V+ARY  PGN++G+F  NV+
Sbjct:   93 GHFTQVVWAGSTEMGAGKATSSSGAHFVVARYTPPGNVMGQFPENVK 139          

HSP 3 Score: 36.965 bits (84), Expect = 1.453e-12
Identity = 21/71 (29.58%), Postives = 42/71 (59.15%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSF-SNYKQSGEEITLKWYREVDEFKF 214
            R+ H    LK + +LA ++Q  ++N+A++   ++  S   +GE+ ++ S    +G + T  WY EVD+++F
Sbjct:   14 RAQHGTKALKWNARLASEAQSWAENLAQR-NAIQHSSSREYGESIAYMSGAVLTGRKATDMWYGEVDKYRF 83          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO49310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH92])

HSP 1 Score: 88.1965 bits (217), Expect = 7.558e-19
Identity = 51/149 (34.23%), Postives = 82/149 (55.03%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTT--SRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +D R+ IL+IHN YR  HN  PL+ +  + + AQ WA  +A   ++ +++++ + +  GENI    + S    I   +  WY E E++QY   P      GHF+Q+VW  T+E+G+G + +   R +  V  Y PPGN    F +N+ P
Sbjct:  211 EDTRSRILDIHNNYRAMHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDR-YYKGENIC---RMSHHFDIGDALQIWYNESESYQYD-NPGFALTTGHFTQIVWRGTREVGVGFAKSPDGRLTYAVARYNPPGNNMRHFKENVLP 354          

HSP 2 Score: 78.1814 bits (191), Expect = 1.682e-15
Identity = 48/154 (31.17%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKE--NFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSV-IVCFYFPPGNIKGEFVKNIKPTIT 1872
            +D F    L+ HN+YR  HN  PL  +  I   AQ WA  +A   ++ +   +      GEN+ +    +     +    +WYQE E  NFQ G    +    GHF+QVVW  ++E+G+  + + + +V +V  Y P GN    F +NI P ++
Sbjct:    1 MDVFARKSLDAHNRYRAMHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSG---QGENVFMSSGANFDDAGEAACESWYQEVERYNFQRG---GHQSGTGHFTQVVWKSSEELGVARAKSKKGAVFVVARYSPGGNDLNAFNENILPKVS 148          

HSP 3 Score: 47.3654 bits (111), Expect = 1.428e-13
Identity = 24/73 (32.88%), Postives = 41/73 (56.16%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN---KSFSNYKQSGEEITLKWYREVDEFKF 214
            R++H  PPL  S  +A ++Q  ++ +A++ K +  KS    GEN    S +N+  +GE     WY+EV+ + F
Sbjct:   16 RAMHNVPPLTWSNSIAREAQKWANKLAKEGKLIHDKSRSGQGENVFMSSGANFDDAGEAACESWYQEVERYNF 88          

HSP 4 Score: 46.9802 bits (110), Expect = 1.428e-13
Identity = 20/46 (43.48%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNV 426
            GHF Q+VWK + E+G  R+K+  G   V+ARY   GN +  F  N+
Sbjct:   98 GHFTQVVWKSSEELGVARAKSKKGAVFVVARYSPGGNDLNAFNENI 143          

HSP 5 Score: 48.521 bits (114), Expect = 2.234e-11
Identity = 24/47 (51.06%), Postives = 30/47 (63.83%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWI-VIARYVKPGNIVGKFLNNV 426
            GHF QIVW+ T EVG G +K+ DG+    +ARY  PGN +  F  NV
Sbjct:  306 GHFTQIVWRGTREVGVGFAKSPDGRLTYAVARYNPPGNNMRHFKENV 352          

HSP 6 Score: 38.891 bits (89), Expect = 2.234e-11
Identity = 21/73 (28.77%), Postives = 42/73 (57.53%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIAR--KIKQVKKKSHYLFGENKS-FSNYKQSGEEITLKWYREVDEFKF 214
            R++H A PL+ S  LA+D+Q  +  +AR  +++   ++  Y  GEN    S++   G+ + + WY E + +++
Sbjct:  225 RAMHNAAPLRWSAALAKDAQAWAGKLAREGRLEHASREDRYYKGENICRMSHHFDIGDALQI-WYNESESYQY 296          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO34556 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP07])

HSP 1 Score: 80.8777 bits (198), Expect = 4.928e-18
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYS-VIVCFYFPPGNIKGEFVKNIKP 1863
            + F++  +  HN YR  H+  PL  +  +   AQNWA+ +A +     S  K +G  +     L+L G         V  WY+E  ++ Y   P      G+FSQ+VW  ++E G+G +     S V+V  Y+PPGNI G+F +N+KP
Sbjct:    1 EKFKSECVISHNYYRSLHDAPPLNWSPMLAAEAQNWAEKLARSGSFRRSGDKDRGENLAFAFGLELSGR------DAVDTWYEELIDYDYEY-PGFTSHTGNFSQLVWVGSQEFGMGKAVGEDGSCVVVGRYYPPGNIVGQFQENVKP 141          

HSP 2 Score: 55.4546 bits (132), Expect = 1.252e-13
Identity = 23/53 (43.40%), Postives = 36/53 (67.92%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGW 447
            G+F+Q+VW  + E G G++  +DG  +V+ RY  PGNIVG+F  NV+ +  G+
Sbjct:   94 GNFSQLVWVGSQEFGMGKAVGEDGSCVVVGRYYPPGNIVGQFQENVKPKGAGY 146          

HSP 3 Score: 39.2762 bits (90), Expect = 1.252e-13
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFS-NYKQSGEEITLKWYREVDEFKF 214
            RSLH APPL  S  LA ++Q  ++ +AR     ++      GEN +F+   + SG +    WY E+ ++ +
Sbjct:   15 RSLHDAPPLNWSPMLAAEAQNWAEKLARS-GSFRRSGDKDRGENLAFAFGLELSGRDAVDTWYEELIDYDY 84          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO37114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGM4])

HSP 1 Score: 80.8777 bits (198), Expect = 5.087e-18
Identity = 47/152 (30.92%), Postives = 76/152 (50.00%), Query Frame = 1
Query: 1438 NILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVL--QLKGSLPSFIDKMVFN-WYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR--YSVIVCFYFPPGNIKGEFVKNIKPTITQK 1878
            N LE HN+YR+RH  K +  +  +   AQ WA  ++  +   +          GEN+      K +  + +D   F+ WY E   + Y    K   + GHF+Q+VW  T+++GIG +  ++     +V  + P GNIKG+F  N+ P+I  K
Sbjct:    4 NCLEAHNEYRKRHGAKEMTWSASLAADAQKWADKLSQTDAFKHDYASINSKSQGENLAYFTPQKPNNTAIMD--AFDAWYDESSKYDYA-NAKFSKETGHFTQLVWKATQKMGIGTAKNAKGDKEYVVARFSPAGNIKGQFADNVLPSIVNK 152          

HSP 2 Score: 49.2914 bits (116), Expect = 5.589e-7
Identity = 23/52 (44.23%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDG-QWIVIARYVKPGNIVGKFLNNVQHRII 441
            GHF Q+VWK T ++G G +K   G +  V+AR+   GNI G+F +NV   I+
Sbjct:   99 GHFTQLVWKATQKMGIGTAKNAKGDKEYVVARFSPAGNIKGQFADNVLPSIV 150          
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Match: EDO34553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP04])

HSP 1 Score: 78.5666 bits (192), Expect = 2.890e-17
Identity = 42/143 (29.37%), Postives = 75/143 (52.45%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNI 1857
            F+   L  HN YR RH    L+ +  +   AQ WA+ +    ++ +++ +    +VGEN+   +   L     +    WY+E E++ +   P   +D  +F+QV+W  ++ +G+G +T     V+V FY PPGN++  F KN+
Sbjct:    3 FQEECLFSHNMYRSRHGAPFLRWSPPLAWAAQQWAEELVRMGELKHNDDE----MVGENLAGMVGDELTGM--EATCMWYEEVEDYDFS-NPGYSEDTSNFTQVIWVGSELLGVGRATLGDLCVVVAFYEPPGNMEDFFQKNV 138          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000043877.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 88.5817 bits (218), Expect = 3.681e-20
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFI--DKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKP 1863
            ++F+   L  HN YR  H   PL  N+E+ + AQ WA      + +G+S+ +      GEN+  +  GS P  +     V  WY E +++ +  +P +    GHF+QVVW ++KE+G+G++T  R + +V  Y PPGN    G+F  N+ P
Sbjct:    9 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE-----GENVFYK-SGSPPVKVTGKDAVDAWYSEIKDYNFK-KPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFVVGQYRPPGNFTNPGQFEANVLP 152          

HSP 2 Score: 42.743 bits (99), Expect = 7.432e-8
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF Q+VWKE+ E+G G + TD     V+ +Y  PGN    G+F  NV
Sbjct:  104 GHFTQVVWKESKELGLGMA-TDGRMAFVVGQYRPPGNFTNPGQFEANV 150          

HSP 3 Score: 34.2686 bits (77), Expect = 7.432e-8
Identity = 21/74 (28.38%), Postives = 36/74 (48.65%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSN----YKQSGEEITLKWYREVDEFKF 214
            R+LH APPL  + +L +++Q  +D   R        S    GEN  + +     K +G++    WY E+ ++ F
Sbjct:   23 RALHGAPPLTYNKELCDEAQKWADTCLR--THTLGHSDTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNF 94          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000020413.2 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 86.6557 bits (213), Expect = 1.403e-19
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFI--DKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKP 1863
            ++F+   L  HN YR  H   PL  N+E+ + AQ WA      + +G+S+ +      GEN+  +  GS P  +     V  WY E +++ +  +P +    GHF+QVVW ++KE+G+G++T  R + +V  Y PPGN    G+F  N+ P
Sbjct:    4 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE-----GENVFYK-SGSPPVKVTGKDAVDAWYSEIKDYNFK-KPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFVVGQYRPPGNFTNPGQFEANVLP 147          

HSP 2 Score: 41.9726 bits (97), Expect = 1.534e-7
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF Q+VWKE+ E+G G + TD     V+ +Y  PGN    G+F  NV
Sbjct:   99 GHFTQVVWKESKELGLGMA-TDGRMAFVVGQYRPPGNFTNPGQFEANV 145          

HSP 3 Score: 33.8834 bits (76), Expect = 1.534e-7
Identity = 24/74 (32.43%), Postives = 37/74 (50.00%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN---KSFS-NYKQSGEEITLKWYREVDEFKF 214
            R+LH APPL  + +L +++Q  +D   R        S    GEN   KS S   K +G++    WY E+ ++ F
Sbjct:   18 RALHGAPPLTYNKELCDEAQKWADTCLR--THTLGHSDTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNF 89          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000028427.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101166141])

HSP 1 Score: 86.6557 bits (213), Expect = 1.403e-19
Identity = 51/151 (33.77%), Postives = 82/151 (54.30%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFI--DKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKP 1863
            ++F+   L  HN YR  H   PL  N+E+ + AQ WA      + +G+S+ +      GEN+  +  GS P  +     V  WY E +++ +  +P +    GHF+QVVW ++KE+G+G++T  R + +V  Y PPGN    G+F  N+ P
Sbjct:    4 EEFQQEFLNAHNAYRALHGAPPLTYNKELCDEAQKWADTCLRTHTLGHSDTEE-----GENVFYK-SGSPPVKVTGKDAVDAWYSEIKDYNFK-KPGSQSGTGHFTQVVWKESKELGLGMATDGRMAFVVGQYRPPGNFTNPGQFEANVLP 147          

HSP 2 Score: 41.9726 bits (97), Expect = 1.534e-7
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF Q+VWKE+ E+G G + TD     V+ +Y  PGN    G+F  NV
Sbjct:   99 GHFTQVVWKESKELGLGMA-TDGRMAFVVGQYRPPGNFTNPGQFEANV 145          

HSP 3 Score: 33.8834 bits (76), Expect = 1.534e-7
Identity = 24/74 (32.43%), Postives = 37/74 (50.00%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGEN---KSFS-NYKQSGEEITLKWYREVDEFKF 214
            R+LH APPL  + +L +++Q  +D   R        S    GEN   KS S   K +G++    WY E+ ++ F
Sbjct:   18 RALHGAPPLTYNKELCDEAQKWADTCLR--THTLGHSDTEEGENVFYKSGSPPVKVTGKDAVDAWYSEIKDYNF 89          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: ENSORLT00000031186.1 (Golgi-associated plant pathogenesis-related protein 1-like [Source:NCBI gene;Acc:101165896])

HSP 1 Score: 83.5741 bits (205), Expect = 1.428e-18
Identity = 51/148 (34.46%), Postives = 75/148 (50.68%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDK-MVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIK--GEFVKNIKP 1863
            F+   LE HN YR  H   PL  N ++   AQ WA      + +G+S  K      GEN+  +      S   K  V  WY E +++ +  +P      GHF+QVVW ++KE+G+G++T  R + +V  Y PPGN    G+F  N+ P
Sbjct:    6 FQQEFLETHNAYRALHGAPPLTYNSKMCGEAQKWADECLRIHTLGHSETKD-----GENVFFKSGSPSVSITGKDAVDAWYSEIKDYNFK-KPGFKSGTGHFTQVVWKESKELGLGMATDGRMAFVVGQYRPPGNFSNPGQFEANVLP 147          

HSP 2 Score: 41.9726 bits (97), Expect = 7.373e-7
Identity = 22/48 (45.83%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF Q+VWKE+ E+G G + TD     V+ +Y  PGN    G+F  NV
Sbjct:   99 GHFTQVVWKESKELGLGMA-TDGRMAFVVGQYRPPGNFSNPGQFEANV 145          

HSP 3 Score: 31.5722 bits (70), Expect = 7.373e-7
Identity = 21/76 (27.63%), Postives = 36/76 (47.37%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIAR--KIKQVKKKSHYLFGENKSFSNYKQS----GEEITLKWYREVDEFKF 214
            R+LH APPL  + ++  ++Q  +D   R   +   + K     GEN  F +   S    G++    WY E+ ++ F
Sbjct:   18 RALHGAPPLTYNSKMCGEAQKWADECLRIHTLGHSETKD----GENVFFKSGSPSVSITGKDAVDAWYSEIKDYNF 89          
BLAST of Venom allergen 5 vs. Ensembl Medaka
Match: glipr2l (GLI pathogenesis related 2 [Source:NCBI gene;Acc:101165836])

HSP 1 Score: 51.2174 bits (121), Expect = 2.226e-14
Identity = 25/74 (33.78%), Postives = 49/74 (66.22%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIA--RKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQ 220
            R  H+AP LKLS +L+ ++   ++++A  R +K  +  +    GEN ++++Y Q+G+++T +WY EV ++ FS+
Sbjct:   21 RKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARGSCGENLAWASYDQTGKDVTDRWYEEVKQYNFSR 94          

HSP 2 Score: 48.1358 bits (113), Expect = 2.226e-14
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIV--GKFLNNV 426
            GHF  +VWK T ++G G++   DG   V+ARY   GNI   G F NNV
Sbjct:  102 GHFTAMVWKNTKKLGVGKAVASDGSSFVVARYFPAGNITNQGHFENNV 149          

HSP 3 Score: 70.8626 bits (172), Expect = 5.471e-14
Identity = 44/148 (29.73%), Postives = 74/148 (50.00%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR-YSVIVCFYFPPGNI--KGEFVKNIKP 1863
            F   +L  HN+YR++H    LK + +++  A  +A+ +A+   + +S    +G   GEN+      S       +   WY+E + + +   P      GHF+ +VW  TK++G+G +  S   S +V  YFP GNI  +G F  N+ P
Sbjct:    9 FSEELLRCHNEYRKKHQAPELKLSSKLSTEAARYAESLASIRILKHSEASARGS-CGENLAW---ASYDQTGKDVTDRWYEEVKQYNFS-RPGFTTGTGHFTAMVWKNTKKLGVGKAVASDGSSFVVARYFPAGNITNQGHFENNVLP 151          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000031976.1 (SMESG000031976.1)

HSP 1 Score: 1054.66 bits (2726), Expect = 0.000e+0
Identity = 524/535 (97.94%), Postives = 525/535 (98.13%), Query Frame = 1
Query:  286 LGHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYPIILKLKSYNNFQAKMINSPTGNVVKVERNVDARTNYDDDMLKDPEKNSINVTPPFDNKRIDFKFESKLTNENFYSDKNMEEDINKIKNINHNFLKSSEDKVLNYFLQNKNEEQLKQLSNEKKFNIRKNNEDLQTGNSDTSSIYSNLILENRIGDFKTFPNKSNKYSNSEQNIIFKQVNGNESQPEGSTLTEQIKNSQIKTNETSLKENFNLILEDENSSVVSYDNFSKNRNLGIILKPEPFAKAQSYQNVNKQESHPVHRLPPDEPDFMDDSKAYKKNQPNKINLKDEEIIQPKKVGSEYTDLDLIDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTITQKQNIE 1890
            + HFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYPIILKLK YNNF AKMINSPTGNVVKVERNVDARTNYDDDMLKD    SINVTPPFDNKRIDFKFESKLTNENFYSDKNMEEDINKIKNINHNFLKSSEDKVLNYF QNKNEEQLKQLSNEKKFNIRKNNEDLQTGNSDTSSIYSNLILENRIGDFKTFPNKSNKYSNSEQNIIFKQVN NESQPEGSTLTEQIKNSQIKTNETSLKENFNLILEDENSSVVSYDNFSKNRNLGIILKPEPFAKAQSYQNVNKQESHPVHRLPPDEPDFMDDSKAYKKNQPNKINLKDEEIIQPKKVGSEYTDLDL DGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTITQKQNIE
Sbjct:   96 ICHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYPIILKLKGYNNFPAKMINSPTGNVVKVERNVDARTNYDDDMLKD----SINVTPPFDNKRIDFKFESKLTNENFYSDKNMEEDINKIKNINHNFLKSSEDKVLNYFQQNKNEEQLKQLSNEKKFNIRKNNEDLQTGNSDTSSIYSNLILENRIGDFKTFPNKSNKYSNSEQNIIFKQVNANESQPEGSTLTEQIKNSQIKTNETSLKENFNLILEDENSSVVSYDNFSKNRNLGIILKPEPFAKAQSYQNVNKQESHPVHRLPPDEPDFMDDSKAYKKNQPNKINLKDEEIIQPKKVGSEYTDLDLKDGINDEEEVFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTITQKQNIE 626          

HSP 2 Score: 169.474 bits (428), Expect = 1.789e-44
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:    2 LRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQERQNLAAIC 247
            LRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQERQNLAAIC
Sbjct:   16 LRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQERQNLAAIC 97          

HSP 3 Score: 74.3294 bits (181), Expect = 1.572e-13
Identity = 46/151 (30.46%), Postives = 79/151 (52.32%), Query Frame = 1
Query: 1423 DDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATA-NQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYS-VIVCFYFPPGNIKGEFVKNIKPTI 1869
            + F    L+IHN+ R  H   PLK + ++ E +Q  +  IA    Q+    +K   ++ GEN       +     +++   WY+E + F++  E +N+  I HF+Q+VW +T E+G G S T     +++  Y  PGNI G+F+ N++  I
Sbjct:    3 ESFNLECLQIHNELRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQV----KKKSHYLFGENKSF---SNYKQSGEEITLKWYREVDEFKFSQERQNLAAICHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRI 146          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000005602.1 (SMESG000005602.1)

HSP 1 Score: 114.39 bits (285), Expect = 6.933e-27
Identity = 56/147 (38.10%), Postives = 84/147 (57.14%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRY-SVIVCFYFPPGNIKGEFVKNI 1857
            I  F   ++  HN YRR HN   L  + ++N  AQ+WA  +A  N++ +SN  ++   +GENI  +           +V +WY E  N+ Y  EP N   +GHF+Q++W K+K+IG+G+   S+  S IVCFY P GN K EF +N+
Sbjct:  272 IKSFIEAVVSQHNYYRRNHNVATLNLDNQLNTYAQDWADELALENKMSFSNYLFENVPLGENITTKKGNVTEESAKALVDSWYNEGRNYNYRKEPDNFKSVGHFTQLLWKKSKKIGVGVGKNSKGESFIVCFYSPAGNTKNEFSQNV 418          

HSP 2 Score: 60.4622 bits (145), Expect = 1.059e-17
Identity = 28/62 (45.16%), Postives = 36/62 (58.06%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQ-WIVIARYVKPGNIVGKFLNNVQHRIIG--WESYPII 465
            GHF Q++WK + E GFGR+K      W ++ RY   GN VGK+L NV     G  W+  PII
Sbjct:  108 GHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPPLPRGQKWDKVPII 169          

HSP 3 Score: 49.2914 bits (116), Expect = 1.059e-17
Identity = 31/83 (37.35%), Postives = 47/83 (56.63%), Query Frame = 2
Query:    2 LRSLHKAPPLKLSIQLAEDSQISSDNIARK--IKQVKKKSHYLFGEN-----KSFSNYKQSGEEITLKWYREVDEFKFSQERQ 229
            LR  H APPL+ S QL+ D+Q  ++ IA K  ++  KK+     GEN     + F +YK SG   +  WY E+ ++ F++E Q
Sbjct:   18 LRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRNDAGENLAMSMRPFVDYKYSGLGASASWYSEIKDYDFNKEAQ 100          

HSP 4 Score: 80.4925 bits (197), Expect = 8.221e-16
Identity = 47/158 (29.75%), Postives = 85/158 (53.80%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSFID------KMVFNWYQEKENFQYGIE--PKNVDDIGHFSQVVWDKTKEIGIGIS--TTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            ++DF    L  HN  R+ HN  PL+ +++++  AQ +A+ IA  +++ +S ++ +    GEN+ + ++     F+D          +WY E +++ +  E  P N    GHF+Q++W  +KE G G +   TS    IV  Y P GN  G++++N+ P
Sbjct:    4 LEDFNYECLHSHNGLRKEHNAPPLRYSKQLSLDAQRYAELIAAKDEMEHSKKEDRND-AGENLAMSMR----PFVDYKYSGLGASASWYSEIKDYDFNKEAQPPNNPATGHFTQLIWKGSKEAGFGRAKNPTSNCWYIVGRYQPAGNFVGKYLENVPP 156          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000036937.1 (SMESG000036937.1)

HSP 1 Score: 113.235 bits (282), Expect = 7.919e-27
Identity = 58/159 (36.48%), Postives = 91/159 (57.23%), Query Frame = 1
Query: 1411 ERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLK-GSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSR----YSVIVCFYFPPGNIKGEFVKNIKPTIT 1872
            +R +  F  + +   N+YR +H    LK N+E++ LAQ WA+ +   + +  SN  YKG  VGENI  +   G      D++  +WY E   F Y  EP NV  IG+F+Q++W  TKEIGIG +  ++      ++VC Y+P GN+  +F++N+KP + 
Sbjct:  219 KRQLRQFIRDTVRSINRYRIKHGVLKLKHNKELDNLAQAWAEELVQKSTLSNSNNSYKGDRVGENIASRWSNGKCDYTADQVADHWYVESSKFSYEKEPPNVQGIGNFTQMIWKSTKEIGIGKAFLTKDNDTRVIVVCNYYPAGNVLRKFLENVKPPLV 377          

HSP 2 Score: 88.9669 bits (219), Expect = 1.183e-18
Identity = 49/153 (32.03%), Postives = 86/153 (56.21%), Query Frame = 1
Query: 1426 DFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLP----SFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVKNIKPTIT 1872
            +F +  L  HN+YR  H   PL+ +  +++ AQ WA+ +  ++ +  S+   KG V GENI ++ K + P    S +D +   WY + +N+ +    K     G+F+Q+VW  T+E+G GI+      ++V  Y PPGN+KG ++ N+ P ++
Sbjct:    5 EFIDECLREHNKYRNLHGVPPLRHSIHLDKTAQEWAEDLVNSDSLRNSSVSSKGEV-GENISMR-KSTSPNVTLSGVD-VSKQWYDDSKNYDF---IKGSGPAGNFTQMVWRSTEEVGFGIAHVKGKCIVVGHYKPPGNVKGNYIDNVMPLLS 151          

HSP 3 Score: 50.0618 bits (118), Expect = 9.378e-10
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIG 444
            G+F Q+VW+ T EVGFG +    G+ IV+  Y  PGN+ G +++NV   + G
Sbjct:  102 GNFTQMVWRSTEEVGFGIAHV-KGKCIVVGHYKPPGNVKGNYIDNVMPLLSG 152          

HSP 4 Score: 32.7278 bits (73), Expect = 9.378e-10
Identity = 21/77 (27.27%), Postives = 37/77 (48.05%), Query Frame = 2
Query:    5 RSLHKAPPLKLSIQLAEDSQISSDNIAR--KIKQVKKKSHYLFGENKSF-----SNYKQSGEEITLKWYREVDEFKF 214
            R+LH  PPL+ SI L + +Q  ++++     ++     S    GEN S       N   SG +++ +WY +   + F
Sbjct:   18 RNLHGVPPLRHSIHLDKTAQEWAEDLVNSDSLRNSSVSSKGEVGENISMRKSTSPNVTLSGVDVSKQWYDDSKNYDF 94          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000070848.1 (SMESG000070848.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.152e-25
Identity = 28/67 (41.79%), Postives = 45/67 (67.16%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSKTDDGQWIVIARYVKPGNIVGKFLNNVQHRIIGWESYPIILKLKSYNN 489
            GHF+Q+VWK + E+GFG  K+ +G W   +RY+ PGN VGK+L +V +    W  +P+I+K+  + +
Sbjct:   99 GHFSQVVWKSSLEIGFGLEKSTNGMWYYCSRYLPPGNCVGKYLEHVNNYGKNWIDHPLIIKISQHRH 165          

HSP 2 Score: 63.929 bits (154), Expect = 1.152e-25
Identity = 32/79 (40.51%), Postives = 51/79 (64.56%), Query Frame = 2
Query:    2 LRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQVKKKSHYLFGENKSFSNYKQSGEEITLKWYREVDEFKFSQERQNLA 238
            LR LH AP + ++  L  D+Q  + ++A  +K    KS   +GEN + S+ K +G+E+TL WYRE+ ++ F+ E+QNLA
Sbjct:   18 LRRLHNAPDMTINDLLMSDAQDWARHMAETMKLEHSKSDGKYGENIASSSKKLNGQEVTLMWYREIFDYNFNDEKQNLA 96          

HSP 3 Score: 79.7221 bits (195), Expect = 1.400e-16
Identity = 47/147 (31.97%), Postives = 76/147 (51.70%), Query Frame = 1
Query: 1429 FRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVL---QLKGSLPSFIDKMVFNWYQEKENFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCF-YFPPGNIKGEFVKNI 1857
            F    LE HN+ RR HN   +  N  +   AQ+WA+++A   ++ +S    K    GENI     +L G       ++   WY+E  ++ +  E +N+   GHFSQVVW  + EIG G+  ++      C  Y PPGN  G++++++
Sbjct:    7 FNTEGLETHNELRRLHNAPDMTINDLLMSDAQDWARHMAETMKLEHSKSDGK---YGENIASSSKKLNG------QEVTLMWYREIFDYNFNDEKQNLAKTGHFSQVVWKSSLEIGFGLEKSTNGMWYYCSRYLPPGNCVGKYLEHV 144          
BLAST of Venom allergen 5 vs. Planmine SMEST
Match: SMESG000005601.1 (SMESG000005601.1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.867e-18
Identity = 52/156 (33.33%), Postives = 90/156 (57.69%), Query Frame = 1
Query: 1420 IDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATANQIGYSNQKYKGHVVGENIVLQLKGSLPSF----IDKMVFNWYQEKE--NFQYGIEPKNVDDIGHFSQVVWDKTKEIGIGIS--TTSRYSVIVCFYFPPGNIKGEFVKNIKP 1863
            +D+F    L+ HN  RR HN+ PL+  ++++  AQ +A +IA+ +++ +SN++ + ++VGEN+ + +K  + S+    +   VF WY E    +F+ G   +N+   GHF+QV+W  TK+ G G +    S    IV  YFP GN    + +N+ P
Sbjct:   13 MDEFNCECLDAHNGLRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDR-NLVGENLAMSMK-QISSYKFSGLGATVF-WYSEIRDCDFELGNRERNLMKTGHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENVFP 165          

HSP 2 Score: 49.2914 bits (116), Expect = 1.777e-13
Identity = 22/65 (33.85%), Postives = 35/65 (53.85%), Query Frame = 1
Query:  289 GHFAQIVWKETSEVGFGRSK-TDDGQWIVIARYVKPGNIVGKFLNNV-----QHRIIGWESYPII 465
            GHF Q++WK+T + GFGR++  +   W ++ RY   GN    +  NV       R   W++ PI+
Sbjct:  117 GHFTQVIWKDTKKAGFGRARNAESDCWYIVGRYFPSGNCFDNYNENVFPLKENQR---WDTLPIV 178          

HSP 3 Score: 46.2098 bits (108), Expect = 1.777e-13
Identity = 29/78 (37.18%), Postives = 42/78 (53.85%), Query Frame = 2
Query:    2 LRSLHKAPPLKLSIQLAEDSQISSDNIARKIKQV--KKKSHYLFGEN-----KSFSNYKQSGEEITLKWYREVDEFKF 214
            LR  H +PPL+   QL+ ++Q  +D IA K + V   ++   L GEN     K  S+YK SG   T+ WY E+ +  F
Sbjct:   27 LRRFHNSPPLEYCKQLSREAQKYADFIASKDRMVHSNREDRNLVGENLAMSMKQISSYKFSGLGATVFWYSEIRDCDF 104          
The following BLAST results are available for this feature:
BLAST of Venom allergen 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GLIPR22.948e-1831.76GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
GLIPR23.363e-1229.05GLI pathogenesis related 2 [Source:HGNC Symbol;Acc... [more]
CRISP26.357e-828.57cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP26.357e-828.57cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
PI161.384e-726.62peptidase inhibitor 16 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C07A4.34.080e-1630.00pep chromosome:WBcel235:X:10174985:10175896:1 gene... [more]
F09B9.52.650e-1532.26pep chromosome:WBcel235:X:10154821:10156856:1 gene... [more]
D2062.13.352e-1428.18pep chromosome:WBcel235:II:2631473:2633054:1 gene:... [more]
F57B7.28.536e-1330.46pep chromosome:WBcel235:V:11441925:11443484:-1 gen... [more]
F57B7.22.040e-1230.46pep chromosome:WBcel235:V:11441925:11443603:-1 gen... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG340493.575e-2034.04gene:FBgn0054049 transcript:FBtr0302372[more]
CG169959.166e-1732.67gene:FBgn0031412 transcript:FBtr0077758[more]
CG42704.870e-1632.00gene:FBgn0031407 transcript:FBtr0077754[more]
CG314826.068e-1528.19gene:FBgn0051482 transcript:FBtr0081679[more]
CG42702.800e-1030.51gene:FBgn0031407 transcript:FBtr0077755[more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR855258.31.382e-2133.33pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
AL929549.22.792e-2133.79pep chromosome:GRCz11:CHR_ALT_CTG5_1_26:33034715:3... [more]
CR855258.35.010e-2033.80pep chromosome:GRCz11:CHR_ALT_CTG5_2_7:33042518:33... [more]
glipr21.449e-1933.11GLI pathogenesis-related 2 [Source:ZFIN;Acc:ZDB-GE... [more]
glipr21.494e-1933.11GLI pathogenesis-related 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
echdc13.057e-2135.00ethylmalonyl-CoA decarboxylase 1 [Source:Xenbase;A... [more]
trappc35.551e-1733.33trafficking protein particle complex 3 [Source:Xen... [more]
trappc35.757e-1733.33trafficking protein particle complex 3 [Source:Xen... [more]
stn16.175e-1133.33STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
stn11.378e-1031.39STN1, CST complex subunit [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Glipr24.601e-1832.43GLI pathogenesis-related 2 [Source:MGI Symbol;Acc:... [more]
Glipr1l18.684e-1029.67GLI pathogenesis-related 1 like 1 [Source:MGI Symb... [more]
Pi168.009e-925.97peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.112e-826.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
Pi161.112e-826.14peptidase inhibitor 16 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Venom allergen 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H4G4|GAPR1_HUMAN1.416e-1731.76Golgi-associated plant pathogenesis-related protei... [more]
sp|Q9CYL5|GAPR1_MOUSE3.218e-1732.43Golgi-associated plant pathogenesis-related protei... [more]
sp|P47033|PRY3_YEAST4.785e-1534.00Cell wall protein PRY3 OS=Saccharomyces cerevisiae... [more]
sp|P47032|PRY1_YEAST3.162e-1331.25Protein PRY1 OS=Saccharomyces cerevisiae (strain A... [more]
sp|P81657|VA5_VESMA7.681e-1233.76Venom allergen 5 OS=Vespa mandarinia OX=7446 PE=1 ... [more]
back to top
BLAST of Venom allergen 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NM496.287e-2935.47Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A1B6GU913.476e-2531.16Uncharacterized protein OS=Cuerna arida OX=1464854... [more]
A0A0R3W1S18.418e-2534.71SCP domain-containing protein OS=Taenia asiatica O... [more]
A0A4E0S1T51.129e-2435.53SCP domain-containing protein OS=Fasciola hepatica... [more]
A0A1B6IKP71.171e-2430.65SCP domain-containing protein (Fragment) OS=Homalo... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037136.19.944e-2332.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000051775.13.205e-2232.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000046499.12.035e-2133.11pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045529.12.270e-2133.99pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000056153.14.075e-2133.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002224.13.831e-1227.63pep scaffold:Pmarinus_7.0:GL477414:68570:72489:-1 ... [more]
ENSPMAT00000002228.16.027e-1222.94pep scaffold:Pmarinus_7.0:GL477414:68597:85540:-1 ... [more]
ENSPMAT00000002231.18.343e-1122.30pep scaffold:Pmarinus_7.0:GL477414:68597:85459:-1 ... [more]
CRISP22.191e-836.05cysteine rich secretory protein 2 [Source:HGNC Sym... [more]
CRISP32.827e-726.67cysteine rich secretory protein 3 [Source:HGNC Sym... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PRY36.891e-1734.00Cell wall-associated protein involved in export of... [more]
PRY14.349e-1531.25Sterol binding protein involved in the export of a... [more]
PRY22.599e-1332.21Sterol binding protein involved in the export of a... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO488815.178e-2236.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493107.558e-1934.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345564.928e-1833.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371145.087e-1830.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345532.890e-1729.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Venom allergen 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000043877.13.681e-2033.77Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000020413.21.403e-1933.77Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000028427.11.403e-1933.77Golgi-associated plant pathogenesis-related protei... [more]
ENSORLT00000031186.11.428e-1834.46Golgi-associated plant pathogenesis-related protei... [more]
glipr2l2.226e-1433.78GLI pathogenesis related 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Venom allergen 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031976.11.789e-4497.94SMESG000031976.1[more]
SMESG000005602.16.933e-2738.10SMESG000005602.1[more]
SMESG000036937.17.919e-2736.48SMESG000036937.1[more]
SMESG000070848.11.152e-2541.79SMESG000070848.1[more]
SMESG000005601.14.867e-1833.33SMESG000005601.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005904 ID=SMED30005904|Name=Venom allergen 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2067bp
ATTGAGATCTCTCCACAAAGCTCCGCCTTTAAAATTATCGATACAACTAG
CGGAAGATTCTCAAATATCTTCTGATAATATCGCAAGAAAAATTAAACAA
GTTAAAAAGAAATCACATTATTTATTTGGGGAAAATAAAAGCTTTTCAAA
TTATAAACAATCAGGAGAGGAAATCACTTTGAAGTGGTATCGAGAGGTTG
ATGAATTCAAATTTAGTCAAGAAAGGCAAAATTTAGCAGCTATTTGTCTG
TCATTTAATAAATAAATAATATTTCATAATAAATTTTAGGTCATTTTGCT
CAAATAGTATGGAAAGAAACTTCTGAAGTTGGGTTCGGGAGAAGCAAAAC
TGATGATGGTCAATGGATTGTGATTGCTCGCTATGTTAAACCTGGAAATA
TTGTGGGGAAATTTTTGAACAATGTTCAACATCGAATTATAGGATGGGAA
AGTTATCCTATAATCTTGAAATTAAAAAGCTATAACAACTTTCAAGCGAA
AATGATTAACAGTCCAACTGGAAATGTTGTTAAAGTGGAAAGAAATGTTG
ACGCCAGAACAAATTATGATGATGATATGCTTAAAGATCCAGAAAAAAAT
TCAATAAATGTAACTCCACCTTTTGATAACAAAAGAATCGATTTCAAATT
TGAGAGTAAACTAACTAATGAAAACTTTTATTCTGATAAAAATATGGAAG
AAGATATAAATAAAATTAAAAACATCAATCATAATTTCCTCAAGTCAAGT
GAAGACAAAGTTTTAAACTATTTTCTACAAAACAAAAATGAAGAACAATT
AAAACAATTATCGAATGAAAAAAAATTCAATATTAGGAAAAATAATGAAG
ATCTTCAAACAGGAAATAGTGACACAAGCTCGATTTATTCAAATTTAATT
TTAGAAAATAGAATAGGAGATTTCAAAACCTTTCCAAATAAATCTAATAA
ATATTCTAATTCTGAACAAAATATTATTTTTAAGCAAGTAAATGGAAATG
AAAGTCAACCGGAAGGCTCTACCTTGACCGAACAAATAAAGAACTCGCAA
ATTAAAACAAACGAGACTTCTTTAAAAGAAAATTTTAATTTAATTTTGGA
AGATGAAAATTCATCTGTTGTTTCCTATGACAATTTTTCCAAAAACCGTA
ATTTAGGAATAATTTTGAAGCCTGAGCCATTTGCAAAAGCACAAAGTTAT
CAAAATGTCAATAAACAAGAAAGTCATCCAGTCCATAGATTACCACCCGA
TGAACCAGACTTCATGGACGATTCTAAAGCATATAAGAAAAACCAGCCTA
ACAAGATCAATCTCAAAGATGAAGAAATTATTCAACCAAAAAAAGTCGGT
TCAGAATATACAGATTTAGATTTGATAGATGGAATTAATGATGAAGAAGA
AGTTTTTAATGAAAGAAACATAGATGATTTCCGTAATAATATATTGGAAA
TTCACAACCAATACAGAAGGCGGCACAACACAAAACCACTGAAGTCCAAT
CAGGAAATAAATGAATTAGCACAAAATTGGGCTCAATACATCGCTACAGC
AAATCAAATCGGATACAGTAACCAAAAATATAAAGGACATGTAGTCGGTG
AAAATATTGTCCTTCAACTTAAAGGTTCTTTACCATCTTTCATCGACAAA
ATGGTTTTCAATTGGTACCAGGAAAAGGAAAACTTCCAGTATGGAATTGA
GCCAAAAAATGTCGATGATATAGGGCATTTCTCCCAAGTAGTATGGGACA
AAACAAAGGAAATTGGCATCGGAATATCAACCACGTCTCGCTATTCTGTA
ATTGTTTGTTTTTATTTTCCTCCTGGGAACATAAAAGGTGAATTTGTAAA
GAATATCAAACCAACAATAACTCAAAAACAAAATATTGAATAGCAAAATA
TCAGTTTAATTTATGTAACTCCCTAATTCTAGTTGCTTTTAATATTTATT
TCTTATTATTATAAATAATAATGCTATTTTAATTTTCCTCTATATTTATA
CAATAAAGTTGAACTGTTTTTAAAAGTCTAAGCTCTACACGATGATCTCA
TCCAAATAATATTATAG
back to top

protein sequence of SMED30005904-orf-1

>SMED30005904-orf-1 ID=SMED30005904-orf-1|Name=SMED30005904-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=464bp
MINSPTGNVVKVERNVDARTNYDDDMLKDPEKNSINVTPPFDNKRIDFKF
ESKLTNENFYSDKNMEEDINKIKNINHNFLKSSEDKVLNYFLQNKNEEQL
KQLSNEKKFNIRKNNEDLQTGNSDTSSIYSNLILENRIGDFKTFPNKSNK
YSNSEQNIIFKQVNGNESQPEGSTLTEQIKNSQIKTNETSLKENFNLILE
DENSSVVSYDNFSKNRNLGIILKPEPFAKAQSYQNVNKQESHPVHRLPPD
EPDFMDDSKAYKKNQPNKINLKDEEIIQPKKVGSEYTDLDLIDGINDEEE
VFNERNIDDFRNNILEIHNQYRRRHNTKPLKSNQEINELAQNWAQYIATA
NQIGYSNQKYKGHVVGENIVLQLKGSLPSFIDKMVFNWYQEKENFQYGIE
PKNVDDIGHFSQVVWDKTKEIGIGISTTSRYSVIVCFYFPPGNIKGEFVK
NIKPTITQKQNIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035940CAP_sf
IPR034113SCP_GAPR1-like
IPR014044CAP_domain
IPR001283CRISP-related
IPR018244Allrgn_V5/Tpx1_CS
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001283Cysteine-rich secretory protein-relatedPRINTSPR00837V5TPXLIKEcoord: 403..419
score: 47.12
coord: 326..344
score: 24.65
coord: 380..393
score: 28.72
coord: 429..442
score: 48.12
IPR001283Cysteine-rich secretory protein-relatedPANTHERPTHR10334CYSTEINE-RICH SECRETORY PROTEIN-RELATEDcoord: 284..450
IPR014044CAP domainSMARTSM00198SCP_3coord: 305..442
e-value: 3.1E-26
score: 103.1
IPR014044CAP domainPFAMPF00188CAPcoord: 311..432
e-value: 3.7E-19
score: 69.8
IPR035940CAP superfamilyGENE3DG3DSA:3.40.33.10coord: 300..452
e-value: 8.5E-36
score: 125.4
IPR035940CAP superfamilySUPERFAMILYSSF55797PR-1-likecoord: 303..443
NoneNo IPR availablePANTHERPTHR10334:SF411coord: 284..450
IPR018244Allergen V5/Tpx-1-related, conserved sitePROSITEPS01009CRISP_1coord: 404..414
IPR034113Golgi-associated plant pathogenesis-related protein 1, SCP domainCDDcd05382CAP_GAPR1-likecoord: 305..440
e-value: 6.33098E-36
score: 127.331