Tubulin beta chain

Overview
NameTubulin beta chain
Smed IDSMED30005902
Length (bp)840
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30005902SMESG000048285.1 SMESG000048286.1 PL06009B1D06_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30005902SMESG000048286.1 Contig3496_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB2A (tubulin beta 2A class IIa [Source:HGNC Symbol;Acc:HGNC:12412])

HSP 1 Score: 444.891 bits (1143), Expect = 1.940e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET++IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB2B (tubulin beta 2B class IIb [Source:HGNC Symbol;Acc:HGNC:30829])

HSP 1 Score: 443.351 bits (1139), Expect = 7.280e-156
Identity = 218/278 (78.42%), Postives = 247/278 (88.85%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 442.965 bits (1138), Expect = 1.054e-155
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 442.965 bits (1138), Expect = 1.054e-155
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Human
Match: TUBB (tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:20778])

HSP 1 Score: 442.965 bits (1138), Expect = 1.054e-155
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: ben-1 (Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q18817])

HSP 1 Score: 444.506 bits (1142), Expect = 7.729e-157
Identity = 216/278 (77.70%), Postives = 249/278 (89.57%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+VQ GQCGNQ+G+KFWEVISDEHGI PDG YKG+SDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++VVRKE+E C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ +FS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+LSNPTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPL+++ +Q YR
Sbjct:    5 VHVQAGQCGNQIGAKFWEVISDEHGIQPDGTYKGESDLQLERINVYYNEANGGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLSNPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGAQAYR 282          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-4 (Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot;Acc:P41937])

HSP 1 Score: 442.195 bits (1136), Expect = 7.923e-156
Identity = 217/279 (77.78%), Postives = 247/279 (88.53%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRN 837
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR  L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+L+ PTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR+
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGAYNGDSDLQLERINVYYNEASGGKYVPRACLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKEAESCDCLQGFQMTHSLGGGTGSGMGTLLISKIREEYPDRIMMTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSMTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRS 283          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 435.647 bits (1119), Expect = 2.972e-153
Identity = 210/278 (75.54%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+VQ GQCGNQ+GSKFWEVISDEHGI PDG +KG++DLQLERI VYY EA  G+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++V+RKE+E C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ +FS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDIC+RTL+L+NPTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPL+++ +Q YR
Sbjct:    5 VHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYR 282          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 435.647 bits (1119), Expect = 2.972e-153
Identity = 210/278 (75.54%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+VQ GQCGNQ+GSKFWEVISDEHGI PDG +KG++DLQLERI VYY EA  G+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++V+RKE+E C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ +FS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDIC+RTL+L+NPTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPL+++ +Q YR
Sbjct:    5 VHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYR 282          
BLAST of Tubulin beta chain vs. Ensembl Celegans
Match: tbb-2 (Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P52275])

HSP 1 Score: 435.647 bits (1119), Expect = 2.972e-153
Identity = 210/278 (75.54%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+VQ GQCGNQ+GSKFWEVISDEHGI PDG +KG++DLQLERI VYY EA  G+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++V+RKE+E C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ +FS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDIC+RTL+L+NPTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPL+++ +Q YR
Sbjct:    5 VHVQAGQCGNQIGSKFWEVISDEHGIQPDGTFKGETDLQLERIDVYYNEANNGKYVPRAVLVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDNVLDVIRKEAEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSSFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICYRTLKLTNPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLSAKGTQAYR 282          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub56D (gene:FBgn0284243 transcript:FBtr0086536)

HSP 1 Score: 435.647 bits (1119), Expect = 3.721e-153
Identity = 213/278 (76.62%), Postives = 246/278 (88.49%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWE+ISDEHGI   G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ T+S  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub97EF (gene:FBgn0003890 transcript:FBtr0300611)

HSP 1 Score: 434.491 bits (1116), Expect = 1.604e-152
Identity = 215/278 (77.34%), Postives = 244/278 (87.77%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+GSKFWE+ISDEHGI P+GYY G+S LQ ERI VYY EA  G+ VPR +L DLEP TMD+VR  P G LFRPDNFVY  SGAGNNWAKGHYT+GAELIDSV+EV+RKESE C+CLQGFQ+ HSLGGGTGSG+GTLL+SKIREEY DRI+ +FS  PSPKVSD VVEPYNATL+IH L+E +DETF IDNEALYDICFRTL+LS+PTYGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLT++ SQ YR
Sbjct:    5 VHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQHERIDVYYNEASSGKYVPRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVLRKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETFCIDNEALYDICFRTLKLSSPTYGDLNHLVSVTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub85D (gene:FBgn0003889 transcript:FBtr0082046)

HSP 1 Score: 432.18 bits (1110), Expect = 8.181e-152
Identity = 215/278 (77.34%), Postives = 242/278 (87.05%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G KFWEVISDEH I   G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR G +G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGGKFWEVISDEHCIDATGTYYGDSDLQLERINVYYNEATGAKYVPRAILVDLEPGTMDSVRSGAFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESEGCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0343443)

HSP 1 Score: 429.098 bits (1102), Expect = 1.587e-150
Identity = 215/283 (75.97%), Postives = 246/283 (86.93%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAI-----GGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V +Q GQCGNQ+G+KFWE+IS+EHGI  +G Y GDSDLQLER+ VYY EA      GG+ VPR IL DLEP TM++VR GPYG LFRPDNFVY  SGAGNNWAKGHYT+GAEL+D+V++VVRKE ENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ T+S  PSPKVSD VVEPYNATL+IH L+E +DET+ IDNEALYDICFRTL++SNP+YGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLERVSVYYNEASVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 287          
BLAST of Tubulin beta chain vs. Ensembl Fly
Match: betaTub60D (gene:FBgn0003888 transcript:FBtr0072270)

HSP 1 Score: 429.098 bits (1102), Expect = 2.110e-150
Identity = 215/284 (75.70%), Postives = 246/284 (86.62%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAI------GGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V +Q GQCGNQ+G+KFWE+IS+EHGI  +G Y GDSDLQLER+ VYY EA       GG+ VPR IL DLEP TM++VR GPYG LFRPDNFVY  SGAGNNWAKGHYT+GAEL+D+V++VVRKE ENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ T+S  PSPKVSD VVEPYNATL+IH L+E +DET+ IDNEALYDICFRTL++SNP+YGDLNHLVS TMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLERVSVYYNEASAVTRSSGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVDNVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 288          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 447.973 bits (1151), Expect = 8.810e-158
Identity = 219/278 (78.78%), Postives = 249/278 (89.57%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y+GDS+LQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF+IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYQGDSELQLERINVYYNEASGNKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: tubb5 (tubulin, beta 5 [Source:ZFIN;Acc:ZDB-GENE-031110-4])

HSP 1 Score: 443.351 bits (1139), Expect = 4.058e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:153426 (zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220])

HSP 1 Score: 442.965 bits (1138), Expect = 6.013e-156
Identity = 217/279 (77.78%), Postives = 249/279 (89.25%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRN 837
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR+
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRS 283          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 442.58 bits (1137), Expect = 7.639e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Match: zgc:55461 (zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879])

HSP 1 Score: 442.58 bits (1137), Expect = 9.019e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: ubxn11 (UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-985480])

HSP 1 Score: 444.506 bits (1142), Expect = 1.960e-156
Identity = 219/279 (78.49%), Postives = 249/279 (89.25%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRN 837
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSVM+VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR+
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVMDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRS 283          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: znf330 (zinc finger protein 330 [Source:Xenbase;Acc:XB-GENE-1010548])

HSP 1 Score: 443.351 bits (1139), Expect = 6.047e-156
Identity = 217/278 (78.06%), Postives = 247/278 (88.85%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: reps2 (RALBP1 associated Eps domain containing 2 [Source:Xenbase;Acc:XB-GENE-985000])

HSP 1 Score: 442.965 bits (1138), Expect = 7.774e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb (tubulin beta class I [Source:NCBI gene;Acc:448742])

HSP 1 Score: 442.965 bits (1138), Expect = 9.558e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Match: tubb3 (tubulin beta 3 class III [Source:NCBI gene;Acc:395045])

HSP 1 Score: 430.639 bits (1106), Expect = 7.006e-151
Identity = 214/278 (76.98%), Postives = 243/278 (87.41%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA   + VPR IL DLEP TMD+VR G +G LFRPDNF++  SGAGNNWAKGHYT+GAEL+DSV++VVRKE ENC+CLQGFQ+ HSLGGGTGSGMGTLL+SK+REEY DRI+ TFS  PSPKVSD VVEPYNATL+IH L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TT LRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLT+R SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPCGNYIGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2a (tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:MGI:107861])

HSP 1 Score: 444.891 bits (1143), Expect = 1.332e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET++IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb2b (tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:MGI:1920960])

HSP 1 Score: 443.351 bits (1139), Expect = 4.998e-156
Identity = 218/278 (78.42%), Postives = 247/278 (88.85%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb5 (tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI:107812])

HSP 1 Score: 442.965 bits (1138), Expect = 7.239e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4b (tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:MGI:1915472])

HSP 1 Score: 442.58 bits (1137), Expect = 8.353e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Mouse
Match: Tubb4a (tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:MGI:107848])

HSP 1 Score: 439.499 bits (1129), Expect = 1.647e-154
Identity = 215/278 (77.34%), Postives = 247/278 (88.85%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG  VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREE+ DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q9NFZ6|TBB2_ECHMU (Tubulin beta-2 chain OS=Echinococcus multilocularis OX=6211 GN=TUB-2 PE=3 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 2.771e-156
Identity = 218/278 (78.42%), Postives = 249/278 (89.57%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++V+RKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ T+S  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+LSNPTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRAGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVIRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMVTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLSNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|O44388|TBB_TRITR (Tubulin beta chain OS=Trichuris trichiura OX=36087 PE=3 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 6.634e-156
Identity = 219/278 (78.78%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR IL DLEP TMD+VR GP+G LFRPDNF++  SGAGNNWAKGHYT+GAEL+D+V++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRAGPFGTLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDNVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMTTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQGYR 282          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|P85108|TBB2A_RAT (Tubulin beta-2A chain OS=Rattus norvegicus OX=10116 GN=Tubb2a PE=1 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.319e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET++IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q7TMM9|TBB2A_MOUSE (Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=Tubb2a PE=1 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.319e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET++IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Match: sp|Q4R5B3|TBB2A_MACFA (Tubulin beta-2A chain OS=Macaca fascicularis OX=9541 GN=TUBB2A PE=2 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.319e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET++IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A0V0J3W3 (Tubulin beta chain OS=Schistocephalus solidus OX=70667 GN=TR83001 PE=3 SV=1)

HSP 1 Score: 454.907 bits (1169), Expect = 1.819e-157
Identity = 225/280 (80.36%), Postives = 250/280 (89.29%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            V++QVGQCGNQMG+KFWEV+SDEHGI P+G YKGDSDLQLERI VYY EA GG+ VPR IL+DLEP TMD VR GP G LFRPDNFV+  +GAGNNWAKGHYTDGAELIDSV EVVRKE+E  ECLQGFQ+ H+LGGGTG+GMGTLL+SKIREE+ DRIICTFS  PSPKVSDVVVEPYNATL++H L+E SDETF IDNEALYDIC RTL+L +PTYGDLNHLVSAT+SGITTCLRFPGQLNADLRKL TN++PFPRLHFF+PGF+PLTSR SQ YR Y
Sbjct:    5 VHIQVGQCGNQMGAKFWEVVSDEHGISPEGLYKGDSDLQLERISVYYNEATGGKFVPRAILTDLEPGTMDAVRSGPVGNLFRPDNFVFGATGAGNNWAKGHYTDGAELIDSVTEVVRKEAEYSECLQGFQITHALGGGTGAGMGTLLISKIREEFPDRIICTFSTVPSPKVSDVVVEPYNATLSVHQLVENSDETFCIDNEALYDICNRTLKLVSPTYGDLNHLVSATVSGITTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRYSQAYRTY 284          
BLAST of Tubulin beta chain vs. TrEMBL
Match: A0A074ZYT3 (Tubulin beta chain OS=Opisthorchis viverrini OX=6198 GN=T265_01645 PE=3 SV=1)

HSP 1 Score: 453.751 bits (1166), Expect = 5.816e-157
Identity = 215/280 (76.79%), Postives = 252/280 (90.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            +Y+Q+GQCGNQMG+KFWEVISDEHG+G DG Y+G+SDLQ+ERIYVY+TEA  GR VPR +L+DLEP  +DN+R GP G LF+P+NFV   +GAGNNWAKGHYTDGAE+I+ +ME +R+E E CEC+QGFQ++HS+GGGTG+G+GTLL+ KIREEY DRI+CTFS YPSPKVSDVVVEPYNATL  + L++L+DETF IDNEALYDIC+RTL+L NPTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSR SQ YR+Y
Sbjct:    5 IYIQIGQCGNQMGAKFWEVISDEHGLGADGIYRGESDLQMERIYVYFTEAAAGRFVPRCVLADLEPGCLDNIRAGPCGQLFKPENFVVGSAGAGNNWAKGHYTDGAEMIEPIMEQIRRECEMCECIQGFQLIHSMGGGTGAGLGTLLMGKIREEYPDRIMCTFSAYPSPKVSDVVVEPYNATLAANLLIDLADETFVIDNEALYDICYRTLKLVNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRYSQAYRSY 284          
BLAST of Tubulin beta chain vs. TrEMBL
Match: I6TL06 (Tubulin beta chain OS=Spirometra erinaceieuropaei OX=99802 PE=2 SV=1)

HSP 1 Score: 453.366 bits (1165), Expect = 8.221e-157
Identity = 223/280 (79.64%), Postives = 250/280 (89.29%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            V++QVGQCGNQMG+KFWEV+SDEHGI P+G YKGDSDLQLERI VYY EA GG+ VPR +L+DLEP TMD VR GP G LFRPDNFV+  +GAGNNWAKGHYTDGAELIDSV EVVRKE+E  ECLQGFQ+ H+LGGGTG+GMGTLL+SKIREE+ DRIIC+FS  PSPKVSDVVVEPYNATL++H L+E SDETF IDNEALYDIC RTL+L +PTYGDLNHLVSAT+SGITTCLRFPGQLNADLRKL TN++PFPRLHFF+PGF+PLTSR SQ YR Y
Sbjct:    5 VHIQVGQCGNQMGAKFWEVVSDEHGISPEGLYKGDSDLQLERISVYYNEATGGKFVPRAVLTDLEPGTMDAVRSGPVGNLFRPDNFVFGATGAGNNWAKGHYTDGAELIDSVTEVVRKEAEYSECLQGFQITHALGGGTGAGMGTLLISKIREEFPDRIICSFSTVPSPKVSDVVVEPYNATLSVHQLVENSDETFCIDNEALYDICNRTLKLVSPTYGDLNHLVSATVSGITTCLRFPGQLNADLRKLATNMVPFPRLHFFMPGFSPLTSRYSQAYRTY 284          
BLAST of Tubulin beta chain vs. TrEMBL
Match: G7YKG6 (Tubulin beta chain OS=Clonorchis sinensis OX=79923 GN=CLF_110246 PE=3 SV=1)

HSP 1 Score: 451.055 bits (1159), Expect = 5.122e-156
Identity = 214/280 (76.43%), Postives = 252/280 (90.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            +YVQ+GQCGNQMG+KFWEVISDEHG+G DG Y+G+SDLQ+ERIYVY+TEA  GR VPR +L+DLEP  +DN+R GP G LF+P+NFV   +GAGNNWAKG+YTDGAE+I+ +ME +R+E E CEC+QGFQ++HS+GGGTG+G+GTLL+ K+REEY DRI+CTFS YPSPKVSDVVVEPYNATL  + L++L+DETF IDNEALYDIC+RTL+L NPTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSR SQ YR+Y
Sbjct:    5 IYVQIGQCGNQMGAKFWEVISDEHGLGADGIYRGESDLQMERIYVYFTEAAAGRYVPRCVLADLEPGCLDNIRAGPCGLLFKPENFVVGSAGAGNNWAKGYYTDGAEMIEPIMEQIRRECEMCECIQGFQLIHSMGGGTGAGLGTLLMGKVREEYPDRIMCTFSAYPSPKVSDVVVEPYNATLAANQLIDLADETFVIDNEALYDICYRTLKLVNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRYSQAYRSY 284          
BLAST of Tubulin beta chain vs. TrEMBL
Match: G3PIG1 (Tubulin beta chain OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 450.669 bits (1158), Expect = 1.291e-155
Identity = 222/278 (79.86%), Postives = 249/278 (89.57%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y+GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+DSVM+VVRKESENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF+IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGSYQGDSDLQLERINVYYNEASGSKYVPRAILVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVMDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: zgc:55461 (tubulin beta-4B chain [Source:NCBI gene;Acc:103024068])

HSP 1 Score: 442.965 bits (1138), Expect = 5.388e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGAYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB2A (tubulin beta-2A chain [Source:NCBI gene;Acc:103041736])

HSP 1 Score: 446.047 bits (1146), Expect = 5.660e-156
Identity = 217/278 (78.06%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI   G Y+G+S+LQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF+IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:   82 VHIQAGQCGNQIGAKFWEVISDEHGIDATGSYQGESELQLERINVYYNEATGSKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 359          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: TUBB1 (tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HGNC:16257])

HSP 1 Score: 352.443 bits (903), Expect = 2.181e-120
Identity = 181/278 (65.11%), Postives = 217/278 (78.06%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q+GQCGNQ+GSK  E+                             +  GG+ VPR +L DLEP TMD+VRG   G LFRPDNF++ +SGAGNNWAKGHYT+GAEL++ V++ VR E+E+C+CLQGFQ VHSLGGGTGSGMGTL+++KIREEY DRI+ +FS  PSPKVSD VVEPYNATL+IH L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVS TMSG+TT LRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLT+R SQ YR
Sbjct:    5 VHLQIGQCGNQIGSKVTEI--------------------------RLIDTCGGKYVPRALLVDLEPGTMDSVRGSRIGQLFRPDNFIHGNSGAGNNWAKGHYTEGAELVEQVVDRVRNEAESCDCLQGFQFVHSLGGGTGSGMGTLIINKIREEYPDRIMNSFSIMPSPKVSDTVVEPYNATLSIHQLIENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYR 256          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000019550.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000026.1:1405913:1407004:-1 gene:ENSAMXG00000018987.2 transcript:ENSAMXT00000019550.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 303.138 bits (775), Expect = 3.344e-102
Identity = 154/189 (81.48%), Postives = 174/189 (92.06%), Query Frame = 1
Query:  268 HSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
             SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:   13 QSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 201          
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Match: tuba8l2 (tubulin alpha chain-like [Source:NCBI gene;Acc:103042625])

HSP 1 Score: 235.728 bits (600), Expect = 1.238e-74
Identity = 126/273 (46.15%), Postives = 172/273 (63.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDL--QLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + V VGQ G QMG+  WE+   EHGI PDG       +    +    +++E   G+ VPR I  DLEP+ +D VR G Y  LF P+  +     A NN+A+GHYT G E+IDSV++ +RK ++ C  LQGF V HS GGGTGSG  +LL+ ++  ++  +    F+ YP+P+VS  VVEPYN+ LT H  LE SD  F +DNEA+YDIC R L +  P+Y +LN L+S  +S IT  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S
Sbjct:    5 ISVHVGQAGVQMGNTCWELYCLEHGIQPDGQMPSQKPVGGHDDSFTTFFSETGAGKYVPRAIFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNYARGHYTIGKEIIDSVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDFGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIS 277          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 402.905 bits (1034), Expect = 5.128e-142
Identity = 203/265 (76.60%), Postives = 233/265 (87.92%), Query Frame = 1
Query:   43 KFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTF-SCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            +FWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY  +++ T  +  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    1 QFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 265          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 231.106 bits (588), Expect = 1.023e-74
Identity = 122/273 (44.69%), Postives = 171/273 (62.64%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQ--LERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + + VGQ G Q+G+  WE+   EHGI PDG    D  +    +    +++E   G+ VPR +  DLEP+ +D VR G Y  LF P+  +     A NN+A+GHYT G E++D V++ +RK ++ C  LQGF + HS GGGTGSG  +LL+ ++  +Y  +    F+ YP+P+VS  VVEPYN+ LT H  LE SD  F +DNEA+YDIC R L +  PTY +LN L+   +S IT  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S
Sbjct:    5 ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIS 277          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009623.1 (pep scaffold:Pmarinus_7.0:GL485233:4234:10583:1 gene:ENSPMAG00000008696.1 transcript:ENSPMAT00000009623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 7.791e-70
Identity = 114/155 (73.55%), Postives = 134/155 (86.45%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKG-DSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREE 462
            V+VQ GQCGNQ+GSKFWEVIS+EHGI   G Y+G ++ LQ+ERI VYY+EA  G+ VPR I+ DLEP TMD VR GP G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+ENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREE
Sbjct:    5 VHVQAGQCGNQVGSKFWEVISEEHGIDRTGSYRGYNARLQMERINVYYSEATSGKFVPRAIMVDLEPGTMDAVRSGPLGHMFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREE 159          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.193 bits (474), Expect = 1.110e-57
Identity = 111/277 (40.07%), Postives = 157/277 (56.68%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQL---ERIYVYYTEAIGGRLVPRTILSDLEPSTMDN---VRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + + +GQ G QMG+  WE+   EHGI PDG+     D+          +++E   G+ VPR I  DLEPS +     +R    GG  R    +       +   +G    G ++   V+   R +SE C  LQGF + HS GGGTGSG  +LL+ ++  +Y  +    F  YP+P+VS  VVEPYNA LT H  LE SD +F +DNEA+YDIC + L +  P+Y +LN L++  +S IT  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S
Sbjct:    6 ISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHPDVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGEPCGLRTLTVGGXLRMSMMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVIS 282          
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 186.422 bits (472), Expect = 1.953e-56
Identity = 99/277 (35.74%), Postives = 160/277 (57.76%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSH--SGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSP-KVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSS 822
            + +Q+GQCGNQ+G +FW+ +  EHGI PDG  +  +    +R  V++ +A     +PR +L DLEP  ++++    Y  L+ P+N   S    GAGNNWA GH + G ++ + + +++ +E++  + L+   +   L     + +      K    +  ++I T+S +P+  ++SDVVV+PYN+ LT+  L + +D    +DN AL  I    L + NP++  +N LVS  MS  TT LR+PG +N DL  L  +LIP PRLHF + G+ PLT+  S
Sbjct:    6 ITLQLGQCGNQIGFEFWKQLCAEHGISPDGILEDFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVINSIVNSSYANLYNPENIYLSEHGGGAGNNWASGH-SQGEKIHEEIFDIIDREADGSDSLEKCPLTRRLSATNWNELC-----KYFCRFPKKLIQTYSVFPNQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQS 276          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 368.622 bits (945), Expect = 1.648e-127
Identity = 181/279 (64.87%), Postives = 226/279 (81.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRN 837
            +++  GQCGNQ+G+ FWE I  EHG+  +G Y G  D+Q ER+ VY+ EA  G+ VPR+I  DLEP T+D VR    G LFRPDN+++  S AGN WAKGHYT+GAEL+DSVM+V+R+E+E C+ LQGFQ+ HSLGGGTGSGMGTLL+SKIREE+ DR++ TFS  PSPK SD VVEPYNATL++H L+E SDETF IDNEALYDIC RTL+L+ P+YGDLN+LVS+ MSG+TT LR+PGQLN+DLRKL  NL+PFPRLHFF+ G+APLT+  SQ +R+
Sbjct:    5 IHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRS 283          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 228.794 bits (582), Expect = 6.399e-73
Identity = 126/277 (45.49%), Postives = 181/277 (65.34%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYK-GDSDLQ--LERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSS 822
            + + VGQ G Q+G+  WE+ S EHGI PDG+ + G S  +   E    ++ E   G+ VPR I  DLEP+ +D VR GPY  LF P+  +     A NN+A+GHYT G E++  V++ +RK ++ C+ LQGF   HSLGGGTGSG+G+LLL ++  EY  +    F+ YP+P+VS  VVEPYN  LT H  LE +D TF +DNEA+YD+C R L +  P++ +LN+L++  +S +T  LRF G LN DL +  TNL+P+PR+HF +  ++P+ S+S 
Sbjct:    5 ISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSK 281          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 224.942 bits (572), Expect = 1.790e-71
Identity = 126/276 (45.65%), Postives = 177/276 (64.13%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYK-GDSDLQ--LERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRS 819
            + + VGQ G Q+G+  WE+ S EHGI  DG+ + G S  +   E    ++ E   G+ VPR I  DLEP+ +D VR G +  LF P+  +     A NN+A+GHYT G E++D V E +RK ++ C+ LQGF   HSLGGGTGSG+G+LLL  +  EY  +    F+ YP+P++S  VVEPYN  LT H  LE +D TF +DNEA+YDIC R L +S P++ +LN L++  +S +T  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S+ 
Sbjct:    5 ISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKK 280          
BLAST of Tubulin beta chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 151.369 bits (381), Expect = 4.344e-43
Identity = 97/275 (35.27%), Postives = 150/275 (54.55%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYK--GDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGA--GNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + +Q GQCGN +G   W  ++ EH IG DG  +    S  + +    ++ E    +  PR I+ D EPS + +V    + G F P N   +  GA  GN+WA G Y  G    D ++  + KE ++ +  +GFQ++HS+ GGTGSG+G+ LL  + + Y  +I+ T+S +P+ + S+VVV+ YN  L +  L+E SD T   DN +L +I  +  R  N      N L+S  +S +T  +RFP  + + +  + + LIP P LHF  P F P TS
Sbjct:    6 ITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDTKPFFRENSRNKFTPRAIMMDSEPSVIADVEN-TFRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTS 277          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO39945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I3])

HSP 1 Score: 442.58 bits (1137), Expect = 2.397e-156
Identity = 218/278 (78.42%), Postives = 247/278 (88.85%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+ Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX9])

HSP 1 Score: 440.269 bits (1131), Expect = 2.019e-155
Identity = 216/278 (77.70%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V +Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR++L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+C+QGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VSLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRSVLIDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELMDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSIVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO42890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S027])

HSP 1 Score: 423.32 bits (1087), Expect = 1.097e-148
Identity = 208/278 (74.82%), Postives = 241/278 (86.69%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFW    +EHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+C+QGFQ+ HSLGGGTGSGM TLL+ KIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRL FF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFW----NEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCIQGFQLTHSLGGGTGSGMVTLLILKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLPFFMPGFAPLTSRGSQQYR 278          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO35973 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJX5])

HSP 1 Score: 370.933 bits (951), Expect = 4.954e-131
Identity = 187/242 (77.27%), Postives = 215/242 (88.84%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQL 726
            V+ Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQ+
Sbjct:    5 VHCQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQV 246          
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Match: EDO49518 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGG3])

HSP 1 Score: 372.474 bits (955), Expect = 1.065e-128
Identity = 183/281 (65.12%), Postives = 225/281 (80.07%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYK--GDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRN 837
            + +QVGQCGNQ+G++FW  I++EHGI P G      D+  + +RI VY+ E  GGR VPR+IL DLEP TMD VRGGP G +FRPDNFV S SGA NNWAKGHY++GAELID++ +V+RKE+ENC+C+QG Q++ +LGGGTGSG+GTL+LSKIREEY DRI+  FS  PSPKVS+ VVEPYNATL++H L+E+ DE F  DNEALYDIC RTL+L+ P Y DLN LVS  M G+T  LRFPGQLN DLRKL  N++PFPRLHFF+PGFAPL SR++Q Y+N
Sbjct:    5 INIQVGQCGNQIGTEFWRDIAEEHGIDPTGAKSLIEDTHGRFDRIDVYFHEGNGGRYVPRSILVDLEPGTMDAVRGGPLGNMFRPDNFVNSQSGAANNWAKGHYSEGAELIDNIFDVLRKEAENCDCMQGVQLIQALGGGTGSGLGTLILSKIREEYPDRILSAFSVVPSPKVSETVVEPYNATLSVHQLVEVVDEDFMFDNEALYDICCRTLKLAKPNYADLNQLVSMAMCGLTASLRFPGQLNGDLRKLAVNMVPFPRLHFFMPGFAPLASRANQQYQN 285          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb2 (tubulin beta-2B chain [Source:NCBI gene;Acc:101162245])

HSP 1 Score: 446.817 bits (1148), Expect = 1.846e-157
Identity = 220/278 (79.14%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y+GDSDLQLERI VYY EA G + VPR IL DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+D+V++VVRKESENC+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYQGDSDLQLERINVYYNEASGSKYVPRAILVDLEPGTMDSVRSGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKESENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: tubb5 (tubulin beta chain [Source:NCBI gene;Acc:101157969])

HSP 1 Score: 443.351 bits (1139), Expect = 3.417e-156
Identity = 218/278 (78.42%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQL+RI VYY EA GG+ VPR IL DLEP TMD+VR GP+G +FRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKESE+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHIQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000045809.1 (tubulin beta-6 chain [Source:NCBI gene;Acc:101166121])

HSP 1 Score: 417.157 bits (1071), Expect = 1.700e-145
Identity = 204/278 (73.38%), Postives = 241/278 (86.69%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V+VQ+GQCGNQ+GSKFWEVIS+EHGI   G Y+GDS LQLERI VY++EA GG+ VPR +L DLEP TMD++RG   G LFRPDNF++ +SGAGNNWAKGHYT+GAEL++ V++ VR ESE C+CLQGFQ+VHSLGGGTGSGMGTL+++KI+EE+ DRI+ TFS  PSPKVSD VVEPYNATL++H LLE +D TF IDNEALYDICFRTL+L+ PTYGDLNHLV  TMSG+TT LRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLT+R SQ YR
Sbjct:    5 VHVQIGQCGNQIGSKFWEVISEEHGINATGIYEGDSTLQLERINVYFSEAYGGKYVPRALLVDLEPGTMDSIRGSRIGALFRPDNFIHGNSGAGNNWAKGHYTEGAELVEQVVDRVRHESEGCDCLQGFQLVHSLGGGTGSGMGTLIINKIKEEFPDRIMNTFSIMPSPKVSDTVVEPYNATLSVHQLLENADATFCIDNEALYDICFRTLKLTTPTYGDLNHLVCMTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYR 282          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000033163.1 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 236.498 bits (602), Expect = 6.511e-75
Identity = 127/273 (46.52%), Postives = 172/273 (63.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQ--LERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + + VGQ G Q+G+  WE+   EHGI PDG    D  +    +    +++E   G+ VPR +  DLEP+ +D VR G Y  LF P+  +     A NN+A+GHYT G E+ID V++ +RK ++ C  LQGF V HS GGGTGSG  +LL+ ++  +Y  +    FS YP+P+VS  VVEPYNA LT H  LE SD  F +DNEA+YDIC R L +  PTY +LN L+S  +S IT  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S
Sbjct:    5 ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIS 277          
BLAST of Tubulin beta chain vs. Ensembl Medaka
Match: ENSORLT00000020578.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 236.498 bits (602), Expect = 6.511e-75
Identity = 127/273 (46.52%), Postives = 172/273 (63.00%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQ--LERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTS 813
            + + VGQ G Q+G+  WE+   EHGI PDG    D  +    +    +++E   G+ VPR +  DLEP+ +D VR G Y  LF P+  +     A NN+A+GHYT G E+ID V++ +RK ++ C  LQGF V HS GGGTGSG  +LL+ ++  +Y  +    FS YP+P+VS  VVEPYNA LT H  LE SD  F +DNEA+YDIC R L +  PTY +LN L+S  +S IT  LRF G LN DL +  TNL+P+PR+HF +  +AP+ S
Sbjct:    5 ISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIS 277          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000048308.1 (SMESG000048308.1)

HSP 1 Score: 460.685 bits (1184), Expect = 3.042e-163
Identity = 226/280 (80.71%), Postives = 255/280 (91.07%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            V++QVGQCGNQMG KFWEVISDEHGI  DG+YKGDSDLQLERI VYY EA GG+ VPR IL+DLEP TMD++R G  G LFRPDNF++  +GAGNNWAKGHYTDGAELID+V+EVVRKESENCECLQGFQ+VH+LGGGTG+GMGTLL+SKIREE+ DRI+C+FSC PSPKVSDVVVEPYNATL+IH L+E  DET+ IDNEALYDIC RTL+L++PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL TN+IPFPRLHFF+PGF+PLTSR SQPYR Y
Sbjct:    5 VHIQVGQCGNQMGGKFWEVISDEHGISVDGFYKGDSDLQLERICVYYNEATGGKFVPRAILTDLEPGTMDSLRCGVVGNLFRPDNFIFGSTGAGNNWAKGHYTDGAELIDNVIEVVRKESENCECLQGFQIVHALGGGTGAGMGTLLISKIREEFPDRIVCSFSCVPSPKVSDVVVEPYNATLSIHQLVENCDETYCIDNEALYDICNRTLKLTSPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLATNMIPFPRLHFFMPGFSPLTSRHSQPYRCY 284          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000062548.1 (SMESG000062548.1)

HSP 1 Score: 450.669 bits (1158), Expect = 9.167e-160
Identity = 216/280 (77.14%), Postives = 233/280 (83.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYRNY 840
            VY+QVGQCGNQMG+KFWEVISDEHG+  DG+YKGDSDLQLERI VYY EA GGRLVPRTIL+DLEPSTMD+V+ GPYG LFRPDNF Y H+GAGNNWAKGHYTDGAELIDSV+E+V                                SKIREE+ DRI+CTFS YPSPKVSDVVVEPYNATL IH L+E++DETFTIDNEALYDICFRTL+LSNPTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSR SQPYR Y
Sbjct:    5 VYIQVGQCGNQMGAKFWEVISDEHGLSVDGFYKGDSDLQLERINVYYNEATGGRLVPRTILTDLEPSTMDSVKCGPYGSLFRPDNFAYGHTGAGNNWAKGHYTDGAELIDSVLELV-------------------------------FSKIREEFPDRIVCTFSTYPSPKVSDVVVEPYNATLAIHQLVEMADETFTIDNEALYDICFRTLKLSNPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRHSQPYRTY 253          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000047284.1 (SMESG000047284.1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.573e-157
Identity = 219/278 (78.78%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+GSKFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV+++VRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHMQAGQCGNQIGSKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000046374.1 (SMESG000046374.1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.573e-157
Identity = 219/278 (78.78%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+GSKFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR +L DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV+++VRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DETF IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHMQAGQCGNQIGSKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAVLVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDIVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETFCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYR 282          
BLAST of Tubulin beta chain vs. Planmine SMEST
Match: SMESG000074579.1 (SMESG000074579.1)

HSP 1 Score: 446.432 bits (1147), Expect = 1.815e-157
Identity = 219/278 (78.78%), Postives = 248/278 (89.21%), Query Frame = 1
Query:    1 VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEAIGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKGHYTDGAELIDSVMEVVRKESENCECLQGFQVVHXXXXXXXXXXXXXXXXKIREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDNEALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLGTNLIPFPRLHFFVPGFAPLTSRSSQPYR 834
            V++Q GQCGNQ+G+KFWEVISDEHGI P G Y GDSDLQLERI VYY EA GG+ VPR IL DLEP TMD+VR GP+G LFRPDNFV+  SGAGNNWAKGHYT+GAEL+DSV++VVRKE+E+C+CLQGFQ+ HSLGGGTGSGMGTLL+SKIREEY DRI+ TFS  PSPKVSD VVEPYNATL++H L+E +DET+ IDNEALYDICFRTL+L+ PTYGDLNHLVSATMSG+TTCLRFPGQLNADLRKL  N++PFPRLHFF+PGFAPLTSR SQ YR
Sbjct:    5 VHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYVPRAILVDLEPGTMDSVRAGPFGQLFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMSTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFIPGFAPLTSRGSQQYR 282          
The following BLAST results are available for this feature:
BLAST of Tubulin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBB2A1.940e-15678.42tubulin beta 2A class IIa [Source:HGNC Symbol;Acc:... [more]
TUBB2B7.280e-15678.42tubulin beta 2B class IIb [Source:HGNC Symbol;Acc:... [more]
TUBB1.054e-15578.06tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.054e-15578.06tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
TUBB1.054e-15578.06tubulin beta class I [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ben-17.729e-15777.70Tubulin beta chain [Source:UniProtKB/TrEMBL;Acc:Q... [more]
tbb-47.923e-15677.78Tubulin beta-4 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-22.972e-15375.54Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-22.972e-15375.54Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
tbb-22.972e-15375.54Tubulin beta-2 chain [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
betaTub56D3.721e-15376.62gene:FBgn0284243 transcript:FBtr0086536[more]
betaTub97EF1.604e-15277.34gene:FBgn0003890 transcript:FBtr0300611[more]
betaTub85D8.181e-15277.34gene:FBgn0003889 transcript:FBtr0082046[more]
betaTub60D1.587e-15075.97gene:FBgn0003888 transcript:FBtr0343443[more]
betaTub60D2.110e-15075.70gene:FBgn0003888 transcript:FBtr0072270[more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb28.810e-15878.78tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
tubb54.058e-15678.42tubulin, beta 5 [Source:ZFIN;Acc:ZDB-GENE-031110-4... [more]
zgc:1534266.013e-15677.78zgc:153426 [Source:ZFIN;Acc:ZDB-GENE-060929-220][more]
zgc:554617.639e-15678.06zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
zgc:554619.019e-15678.06zgc:55461 [Source:ZFIN;Acc:ZDB-GENE-040426-2879][more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubxn111.960e-15678.49UBX domain protein 11 [Source:Xenbase;Acc:XB-GENE-... [more]
znf3306.047e-15678.06zinc finger protein 330 [Source:Xenbase;Acc:XB-GEN... [more]
reps27.774e-15678.06RALBP1 associated Eps domain containing 2 [Source:... [more]
tubb9.558e-15678.06tubulin beta class I [Source:NCBI gene;Acc:448742][more]
tubb37.006e-15176.98tubulin beta 3 class III [Source:NCBI gene;Acc:395... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tubb2a1.332e-15678.42tubulin, beta 2A class IIA [Source:MGI Symbol;Acc:... [more]
Tubb2b4.998e-15678.42tubulin, beta 2B class IIB [Source:MGI Symbol;Acc:... [more]
Tubb57.239e-15678.06tubulin, beta 5 class I [Source:MGI Symbol;Acc:MGI... [more]
Tubb4b8.353e-15678.06tubulin, beta 4B class IVB [Source:MGI Symbol;Acc:... [more]
Tubb4a1.647e-15477.34tubulin, beta 4A class IVA [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tubulin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NFZ6|TBB2_ECHMU2.771e-15678.42Tubulin beta-2 chain OS=Echinococcus multiloculari... [more]
sp|O44388|TBB_TRITR6.634e-15678.78Tubulin beta chain OS=Trichuris trichiura OX=36087... [more]
sp|P85108|TBB2A_RAT9.319e-15678.42Tubulin beta-2A chain OS=Rattus norvegicus OX=1011... [more]
sp|Q7TMM9|TBB2A_MOUSE9.319e-15678.42Tubulin beta-2A chain OS=Mus musculus OX=10090 GN=... [more]
sp|Q4R5B3|TBB2A_MACFA9.319e-15678.42Tubulin beta-2A chain OS=Macaca fascicularis OX=95... [more]
back to top
BLAST of Tubulin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J3W31.819e-15780.36Tubulin beta chain OS=Schistocephalus solidus OX=7... [more]
A0A074ZYT35.816e-15776.79Tubulin beta chain OS=Opisthorchis viverrini OX=61... [more]
I6TL068.221e-15779.64Tubulin beta chain OS=Spirometra erinaceieuropaei ... [more]
G7YKG65.122e-15676.43Tubulin beta chain OS=Clonorchis sinensis OX=79923... [more]
G3PIG11.291e-15579.86Tubulin beta chain OS=Gasterosteus aculeatus OX=69... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:554615.388e-15678.06tubulin beta-4B chain [Source:NCBI gene;Acc:103024... [more]
TUBB2A5.660e-15678.06tubulin beta-2A chain [Source:NCBI gene;Acc:103041... [more]
TUBB12.181e-12065.11tubulin beta 1 class VI [Source:HGNC Symbol;Acc:HG... [more]
ENSAMXT00000019550.23.344e-10281.48pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
tuba8l21.238e-7446.15tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb25.128e-14276.60tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
TUBA3C1.023e-7444.69tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000009623.17.791e-7073.55pep scaffold:Pmarinus_7.0:GL485233:4234:10583:1 ge... [more]
ENSPMAT00000001139.11.110e-5740.07pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubg11.953e-5635.74tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB21.648e-12764.87Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB16.399e-7345.49Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB31.790e-7145.65Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB44.344e-4335.27Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO399452.397e-15678.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359582.019e-15577.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428901.097e-14874.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359734.954e-13177.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495181.065e-12865.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubb21.846e-15779.14tubulin beta-2B chain [Source:NCBI gene;Acc:101162... [more]
tubb53.417e-15678.42tubulin beta chain [Source:NCBI gene;Acc:101157969... [more]
ENSORLT00000045809.11.700e-14573.38tubulin beta-6 chain [Source:NCBI gene;Acc:1011661... [more]
ENSORLT00000033163.16.511e-7546.52tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000020578.26.511e-7546.52tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
back to top
BLAST of Tubulin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048308.13.042e-16380.71SMESG000048308.1[more]
SMESG000062548.19.167e-16077.14SMESG000062548.1[more]
SMESG000047284.11.573e-15778.78SMESG000047284.1[more]
SMESG000046374.11.573e-15778.78SMESG000046374.1[more]
SMESG000074579.11.815e-15778.78SMESG000074579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005902 ID=SMED30005902|Name=Tubulin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=840bp
GTTTACGTTCAAGTCGGCCAGTGCGGTAATCAGATGGGTTCAAAGTTCTG
GGAAGTAATATCTGATGAGCATGGGATTGGACCTGATGGGTATTATAAAG
GTGATAGTGATCTTCAGTTAGAAAGAATTTATGTTTATTACACCGAAGCT
ATTGGGGGTCGACTTGTTCCTAGAACTATTTTATCAGATTTGGAACCAAG
TACAATGGATAATGTCAGAGGAGGACCTTATGGAGGACTTTTCAGACCGG
ATAATTTCGTATATAGTCACAGTGGAGCCGGTAATAATTGGGCTAAAGGT
CATTATACTGACGGTGCAGAACTCATCGATTCTGTAATGGAAGTTGTGAG
AAAAGAATCCGAGAATTGTGAATGTCTTCAAGGATTTCAAGTAGTTCATT
CACTTGGAGGAGGAACTGGTTCTGGTATGGGTACTTTACTATTAAGTAAA
ATCAGAGAAGAGTATGCAGACAGGATTATATGCACATTTTCTTGTTATCC
TTCACCCAAGGTATCTGACGTGGTCGTCGAGCCTTATAATGCCACATTAA
CAATCCATCACCTTCTAGAATTATCCGATGAAACGTTTACTATTGATAAC
GAAGCTCTCTATGATATCTGCTTCCGAACGCTAAGATTATCTAATCCAAC
TTACGGTGACCTTAATCATTTAGTTAGTGCTACAATGTCCGGAATTACTA
CATGCTTACGATTTCCGGGTCAGCTCAATGCTGATTTGAGAAAATTGGGC
ACAAATCTAATACCATTCCCCAGACTTCATTTCTTTGTACCTGGATTCGC
TCCATTAACTAGCCGAAGCTCTCAGCCATATAGAAATTAT
back to top

protein sequence of SMED30005902-orf-1

>SMED30005902-orf-1 ID=SMED30005902-orf-1|Name=SMED30005902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=280bp
VYVQVGQCGNQMGSKFWEVISDEHGIGPDGYYKGDSDLQLERIYVYYTEA
IGGRLVPRTILSDLEPSTMDNVRGGPYGGLFRPDNFVYSHSGAGNNWAKG
HYTDGAELIDSVMEVVRKESENCECLQGFQVVHSLGGGTGSGMGTLLLSK
IREEYADRIICTFSCYPSPKVSDVVVEPYNATLTIHHLLELSDETFTIDN
EALYDICFRTLRLSNPTYGDLNHLVSATMSGITTCLRFPGQLNADLRKLG
TNLIPFPRLHFFVPGFAPLTSRSSQPYRNY
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR000217Tubulin
IPR002453Beta_tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002453Beta tubulinPRINTSPR01163BETATUBULINcoord: 261..277
score: 71.23
coord: 104..122
score: 68.3
coord: 148..160
score: 69.54
coord: 37..54
score: 69.78
coord: 241..254
score: 73.1
coord: 84..95
score: 71.57
coord: 226..235
score: 76.06
coord: 208..220
score: 71.6
IPR000217TubulinPRINTSPR01161TUBULINcoord: 128..146
score: 78.03
coord: 147..168
score: 49.23
coord: 89..100
score: 64.67
coord: 47..66
score: 54.96
coord: 172..185
score: 70.14
coord: 6..26
score: 69.35
coord: 186..206
score: 62.0
coord: 102..126
score: 55.88
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..279
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 42..240
e-value: 1.3E-61
score: 220.6
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 2..207
e-value: 1.1E-63
score: 215.0
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..280
e-value: 8.0E-122
score: 408.8
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 1..239
NoneNo IPR availablePANTHERPTHR11588:SF100TUBULIN BETA-2A CHAINcoord: 1..279
NoneNo IPR availableCDDcd02187beta_tubulincoord: 1..278
e-value: 4.19064E-180
score: 500.556
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 136..142
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 243..279