Protein YIPF

Overview
NameProtein YIPF
Smed IDSMED30005895
Length (bp)1249
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein YIPF (SMED30005895) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein YIPF (SMED30005895) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein YIPF (SMED30005895) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein YIPF (SMED30005895) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005895

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30005895h1SMcG0015154 dd_Smed_v4_2945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30005895h1SMcG0015154 dd_Smed_v4_2945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30005895h1SMcG0015154 OX_Smed_1.0.16440ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF4 (Yip1 domain family member 4 [Source:HGNC Symbol;Acc:HGNC:28145])

HSP 1 Score: 173.326 bits (438), Expect = 5.284e-51
Identity = 130/231 (56.28%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  203 TNIDLGFYDENIDNKDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            TN D  F   + D +DLSG+I + +  +     F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   13 TNGDFTFV-SSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSF-EVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 241          
BLAST of Protein YIPF vs. Ensembl Human
Match: YIPF4 (Yip1 domain family member 4 [Source:HGNC Symbol;Acc:HGNC:28145])

HSP 1 Score: 48.1358 bits (113), Expect = 4.678e-7
Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  245 KDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKP 388
            +DLSG+I + +  +     F      +TFLR+RG+GW+LEVE+ DP+  KP
Sbjct:    1 EDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKP 51          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y60A3A.19 (pep chromosome:WBcel235:V:19916557:19919996:1 gene:WBGene00013365.1 transcript:Y60A3A.19b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y60A3A.19)

HSP 1 Score: 149.058 bits (375), Expect = 5.792e-42
Identity = 121/246 (49.19%), Postives = 164/246 (66.67%), Query Frame = 2
Query:  191 EKESTNIDL-GFYDENID---------NKDLSGNILNDNSHIES----FNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            ++   +IDL GFY  N +         N   SG+I +    I +      + GA   F+   GFGW+LEV E D D + PLLEELDIDL DIYYK R VLLP PYF +   +VR+ PDFWGPL VV+ +A++SL GQF VVSWII IW  G  ++Y IAR+LGG+V Y+Q LG++GY L+P+++  LI+PL     + ++N   +FG IW+ YSAG+LLC++ELQ K+ L++YP+ LLYIYF S+Y
Sbjct:    9 KQPEVSIDLNGFYSSNFEQFEHPDQSSNAPNSGSISSPTGQISAQAYRRTNAGAAGKFMENSGFGWLLEVNEEDSD-QIPLLEELDIDLTDIYYKIRCVLLPLPYFRMKLNIVRESPDFWGPLAVVLAFAILSLYGQFGVVSWIITIWFCGGFMVYFIARALGGDVGYSQVLGIVGYCLIPLVVTSLITPLFSSF-RLLSNGLGMFGTIWSVYSAGTLLCVDELQAKKPLVVYPVFLLYIYFYSLY 252          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y60A3A.19 (pep chromosome:WBcel235:V:19916557:19919976:1 gene:WBGene00013365.1 transcript:Y60A3A.19a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y60A3A.19)

HSP 1 Score: 97.4413 bits (241), Expect = 2.986e-23
Identity = 104/246 (42.28%), Postives = 142/246 (57.72%), Query Frame = 2
Query:  191 EKESTNIDL-GFYDENID---------NKDLSGNILNDNSHIES----FNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            ++   +IDL GFY  N +         N   SG+I +    I +      + GA   F+   GFGW+LEV E D D + PLLEELDIDL DIYYK R VLLP PYF +   +V                           VSWII IW  G  ++Y IAR+LGG+V Y+Q LG++GY L+P+++  LI+PL     + ++N   +FG IW+ YSAG+LLC++ELQ K+ L++YP+ LLYIYF S+Y
Sbjct:    9 KQPEVSIDLNGFYSSNFEQFEHPDQSSNAPNSGSISSPTGQISAQAYRRTNAGAAGKFMENSGFGWLLEVNEEDSD-QIPLLEELDIDLTDIYYKIRCVLLPLPYFRMKLNIV---------------------------VSWIITIWFCGGFMVYFIARALGGDVGYSQVLGIVGYCLIPLVVTSLITPLFSSF-RLLSNGLGMFGTIWSVYSAGTLLCVDELQAKKPLVVYPVFLLYIYFYSLY 225          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: Y60A3A.19 (pep chromosome:WBcel235:V:19916557:19918302:1 gene:WBGene00013365.1 transcript:Y60A3A.19c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y60A3A.19)

HSP 1 Score: 90.1225 bits (222), Expect = 2.331e-21
Identity = 66/140 (47.14%), Postives = 84/140 (60.00%), Query Frame = 2
Query:  191 EKESTNIDL-GFYDENID---------NKDLSGNILNDNSHIES----FNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRV 568
            ++   +IDL GFY  N +         N   SG+I +    I +      + GA   F+   GFGW+LEV E D D + PLLEELDIDL DIYYK R VLLP PYF +   +VR+ PDFWGPL VV+ +A++SL GQF V
Sbjct:    9 KQPEVSIDLNGFYSSNFEQFEHPDQSSNAPNSGSISSPTGQISAQAYRRTNAGAAGKFMENSGFGWLLEVNEEDSD-QIPLLEELDIDLTDIYYKIRCVLLPLPYFRMKLNIVRESPDFWGPLAVVLAFAILSLYGQFGV 147          
BLAST of Protein YIPF vs. Ensembl Celegans
Match: T08D2.6 (pep chromosome:WBcel235:X:179786:182169:-1 gene:WBGene00011611.1 transcript:T08D2.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T08D2.6)

HSP 1 Score: 45.4394 bits (106), Expect = 1.928e-6
Identity = 34/53 (64.15%), Postives = 39/53 (73.58%), Query Frame = 2
Query:  335 GFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRD 493
            GFGW+LEV E D D + PLLEELDIDL DIYYK R VL P PYF +   +VR+
Sbjct:   13 GFGWLLEVNEEDSD-QIPLLEELDIDLTDIYYKIRCVLHPLPYFRMKLNIVRE 64          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf4 (Yip1 domain family, member 4 [Source:NCBI gene;Acc:405827])

HSP 1 Score: 154.451 bits (389), Expect = 4.814e-44
Identity = 130/234 (55.56%), Postives = 167/234 (71.37%), Query Frame = 2
Query:  197 ESTNIDLGFYDENIDNKDLSGNI----LNDNSHIESFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
              TN D  F     D ++LSG I    +  N   ES N +   +TFLR+RG+GW+LEVEE + +  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+L++++S+ GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    4 SPTNGDFTFVSST-DAEELSGTIDAPDITLNMGPES-NRDTYATTFLRQRGYGWLLEVEEEESEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLLFSMISIYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLVIGGF-EVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 234          
BLAST of Protein YIPF vs. Ensembl Zebrafish
Match: yipf4 (Yip1 domain family, member 4 [Source:NCBI gene;Acc:405827])

HSP 1 Score: 154.451 bits (389), Expect = 4.814e-44
Identity = 130/234 (55.56%), Postives = 167/234 (71.37%), Query Frame = 2
Query:  197 ESTNIDLGFYDENIDNKDLSGNI----LNDNSHIESFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
              TN D  F     D ++LSG I    +  N   ES N +   +TFLR+RG+GW+LEVEE + +  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+L++++S+ GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    4 SPTNGDFTFVSST-DAEELSGTIDAPDITLNMGPES-NRDTYATTFLRQRGYGWLLEVEEEESEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLLFSMISIYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLVIGGF-EVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 234          
BLAST of Protein YIPF vs. Ensembl Mouse
Match: Yipf4 (Yip1 domain family, member 4 [Source:MGI Symbol;Acc:MGI:1915114])

HSP 1 Score: 171.4 bits (433), Expect = 1.814e-50
Identity = 127/221 (57.47%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  239 DNKDLSGNILNDNSHIE-----SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            D +DLSG+I   +  +       F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  I  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   24 DAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSF-EMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 243          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q9BSR8|YIPF4_HUMAN (Protein YIPF4 OS=Homo sapiens OX=9606 GN=YIPF4 PE=1 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.537e-50
Identity = 130/231 (56.28%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  203 TNIDLGFYDENIDNKDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            TN D  F   + D +DLSG+I + +  +     F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   13 TNGDFTFV-SSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSF-EVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 241          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q5M7T4|YIPF4_RAT (Protein YIPF4 OS=Rattus norvegicus OX=10116 GN=Yipf4 PE=2 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.269e-49
Identity = 127/221 (57.47%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  239 DNKDLSGNILNDNSHIE-----SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            D +DLSG+I   +  +       F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  I  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   24 DAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSF-EMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 243          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q8C407|YIPF4_MOUSE (Protein YIPF4 OS=Mus musculus OX=10090 GN=Yipf4 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.269e-49
Identity = 127/221 (57.47%), Postives = 161/221 (72.85%), Query Frame = 2
Query:  239 DNKDLSGNILNDNSHIE-----SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            D +DLSG+I   +  +       F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  I  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   24 DAEDLSGSIAAPDVKLNLGVSGDFIKESTATTFLRQRGYGWLLEVEDEDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSF-EMVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 243          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q5ZJD7|YIPF4_CHICK (Protein YIPF4 OS=Gallus gallus OX=9031 GN=YIPF4 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.730e-48
Identity = 124/219 (56.62%), Postives = 161/219 (73.52%), Query Frame = 2
Query:  239 DNKDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            D +D SG+I   +  +     F    + +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQF+VVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   29 DAEDPSGSITTPDVKLNLGGEFIKESSATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFKVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSF-EVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 246          
BLAST of Protein YIPF vs. UniProt/SwissProt
Match: sp|Q6NYF1|YIPF4_DANRE (Protein YIPF4 OS=Danio rerio OX=7955 GN=yipf4 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.634e-43
Identity = 130/234 (55.56%), Postives = 167/234 (71.37%), Query Frame = 2
Query:  197 ESTNIDLGFYDENIDNKDLSGNI----LNDNSHIESFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
              TN D  F     D ++LSG I    +  N   ES N +   +TFLR+RG+GW+LEVEE + +  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+L++++S+ GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    4 SPTNGDFTFVSST-DAEELSGTIDAPDITLNMGPES-NRDTYATTFLRQRGYGWLLEVEEEESEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLLFSMISIYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLVIGGF-EVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 234          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A1I8GR47 (Protein YIPF OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.741e-50
Identity = 128/188 (68.09%), Postives = 157/188 (83.51%), Query Frame = 2
Query:  323 LRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            LR+RGFGW++EVEE D + +KPLLEELDID  DIYYK R VLLP PYFG +RQVVRD+PDFWGPLFVV+L+ALV++VGQFRVVSWI+ IWL GS  +YV+ARSLGGEV Y+Q LGVIGYS+LP+LL+ L+ PL   V   V   C++  V+WA+Y+AGSLLC+EELQ K+ LLLYPI LLY+YF+S+Y
Sbjct:   34 LRRRGFGWLMEVEE-DDEQQKPLLEELDIDPTDIYYKLRCVLLPLPYFGYDRQVVRDRPDFWGPLFVVLLFALVAMVGQFRVVSWILTIWLAGSWFVYVLARSLGGEVSYSQSLGVIGYSVLPLLLVGLLLPLAAKVHGLVGFACKILAVVWASYTAGSLLCVEELQVKKPLLLYPIFLLYVYFLSLY 220          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A1I8J4V1 (Protein YIPF OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012595g1 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 2.067e-50
Identity = 128/188 (68.09%), Postives = 157/188 (83.51%), Query Frame = 2
Query:  323 LRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            LR+RGFGW++EVEE D + +KPLLEELDID  DIYYK R VLLP PYFG +RQVVRD+PDFWGPLFVV+L+ALV++VGQFRVVSWI+ IWL GS  +YV+ARSLGGEV Y+Q LGVIGYS+LP+LL+ L+ PL   V   V   C++  V+WA+Y+AGSLLC+EELQ K+ LLLYPI LLY+YF+S+Y
Sbjct:   55 LRRRGFGWLMEVEE-DDEQQKPLLEELDIDPTDIYYKLRCVLLPLPYFGYDRQVVRDRPDFWGPLFVVLLFALVAMVGQFRVVSWILTIWLAGSWFVYVLARSLGGEVSYSQSLGVIGYSVLPLLLVGLLLPLAAKVHGLVGFACKILAVVWASYTAGSLLCVEELQVKKPLLLYPIFLLYVYFLSLY 241          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A2K5DCZ5 (Protein YIPF OS=Aotus nancymaae OX=37293 GN=YIPF4 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 5.765e-48
Identity = 131/231 (56.71%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  203 TNIDLGFYDENIDNKDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            TN D  F   + D +DLSG+I + +  +     F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  I  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   13 TNGDFTFV-SSADAQDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSF-EVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 241          
BLAST of Protein YIPF vs. TrEMBL
Match: G1STD4 (Protein YIPF OS=Oryctolagus cuniculus OX=9986 GN=YIPF4 PE=3 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 6.016e-48
Identity = 131/231 (56.71%), Postives = 167/231 (72.29%), Query Frame = 2
Query:  203 TNIDLGFYDENIDNKDLSGNILNDNSHIE---SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            TN D  F   + D +DLSG+I + +  +     F      +TFLR+RG+GW+LEVE+ DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  I  ++    + V+   +LFGV WAAYSA SLL  EE + K+ LL+YPI LLYIYF+S+Y
Sbjct:   13 TNGDFTFV-SSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPILLVVGSF-EVVSTLIKLFGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLY 241          
BLAST of Protein YIPF vs. TrEMBL
Match: A0A444U732 (Protein YIPF OS=Acipenser ruthenus OX=7906 GN=EOD39_7365 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 6.259e-48
Identity = 130/240 (54.17%), Postives = 171/240 (71.25%), Query Frame = 2
Query:  173 MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIE--SFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            M+Q       TN D  F     D ++LSG+I + +  +     + + + +TFLR+RG+GW+LEVEE DP+  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++SL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++    + V+   +LFGV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    1 MHQQAQHFSPTNGDFTFVSST-DAEELSGSIESPDVKVNMGGDSKDASATTFLRQRGYGWLLEVEEDDPEDTKPLLEELDIDLKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLVIGGF-EVVSTLIKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 238          
BLAST of Protein YIPF vs. Ensembl Cavefish
Match: yipf4 (Yip1 domain family member 4 [Source:NCBI gene;Acc:103044597])

HSP 1 Score: 163.31 bits (412), Expect = 1.860e-47
Identity = 126/231 (54.55%), Postives = 162/231 (70.13%), Query Frame = 2
Query:  203 TNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGA---TSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            TN D  F     D ++LSG I   +  +      G     +TFLR+RG+GW+LEVEE + +  KPLLEELDIDLKDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+L++++S+ GQFRVVSWII IW+ GS  ++++AR LGGEV Y Q LGVIGYSLLP++++  +  +     + VA   +L GV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    6 TNGDFTFVSST-DAEELSGTIDAPDIKLNMGGDQGKDAYATTFLRQRGYGWLLEVEEDEAEDTKPLLEELDIDLKDIYYKVRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLLFSMISIYGQFRVVSWIITIWIFGSLTVFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPVLLITGGF-EVVATLIKLAGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 234          
BLAST of Protein YIPF vs. Ensembl Sea Lamprey
Match: yipf4 (Yip1 domain family, member 4 [Source:NCBI gene;Acc:405827])

HSP 1 Score: 128.642 bits (322), Expect = 5.617e-36
Identity = 95/176 (53.98%), Postives = 123/176 (69.89%), Query Frame = 2
Query:  359 EEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            EE+D D++             IYYK R VL+P P  G NRQVVRD PDFWGPL VV+ +A+VSL GQFRVVSWII IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++      ++   +LFGV W+AYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    1 EELDIDLKD------------IYYKLRCVLMPLPALGFNRQVVRDNPDFWGPLAVVLFFAMVSLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLVVIVPMLLVVTSFD-FLSVLVKLFGVFWSAYSAASLLVGDEFKAKKPLLIYPIFLLYIYFLSLY 163          
BLAST of Protein YIPF vs. Ensembl Nematostella
Match: EDO31572 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXI6])

HSP 1 Score: 151.369 bits (381), Expect = 1.228e-43
Identity = 122/214 (57.01%), Postives = 152/214 (71.03%), Query Frame = 2
Query:  287 ESFNSNGAT------------STFLRKRGFGWMLEVEEI-DPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFC-RLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            ES+  NG T            S    ++GF W+LEV+E  D D  KPLLEELDID+ DIYYK R V+ P P  G  R V+RD PDFWGPL +VILYA+++L GQFRVVSWII IW++GS I++++AR LGGEV Y+QCLGVIGYSL+P++L  L  PL+ Y    +  FC +  GV+WA+YSAGSLL  E+L+ KR LLLYPI LLYIYF S+Y
Sbjct:    3 ESYVENGKTAGDNGDVGKSIYSQVFSRKGFEWLLEVDETEDDDFNKPLLEELDIDVADIYYKVRCVIFPLPSLGFKRDVLRDSPDFWGPLLIVILYAILALYGQFRVVSWIITIWVLGSLIVFLLARVLGGEVTYSQCLGVIGYSLIPLVLTALALPLVHYFP--MLGFCIKAIGVVWASYSAGSLLIHEDLRSKRPLLLYPILLLYIYFFSLY 214          
BLAST of Protein YIPF vs. Ensembl Nematostella
Match: EDO31573 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXJ0])

HSP 1 Score: 97.8265 bits (242), Expect = 7.040e-22
Identity = 62/134 (46.27%), Postives = 79/134 (58.96%), Query Frame = 2
Query:  425 YYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFC-RLFGVIWAAYSAGSLLCLEELQ 823
            YYK R V+ P P  G  R V+RD PDFWGPL +VILYA+++L GQFRV                           Y+QCLGVIGYSL+P++L  L  PL+ Y    +  FC +  GV+WA+YSAGSLL  E+L+
Sbjct:  784 YYKVRCVMFPLPSLGFKRDVLRDSPDFWGPLLIVILYAILALYGQFRVT--------------------------YSQCLGVIGYSLIPLVLTALALPLVHYFP--MLGFCIKAIGVVWASYSAGSLLIHEDLR 889          
BLAST of Protein YIPF vs. Ensembl Medaka
Match: yipf4 (Yip1 domain family member 4 [Source:NCBI gene;Acc:101162233])

HSP 1 Score: 159.073 bits (401), Expect = 8.344e-46
Identity = 121/241 (50.21%), Postives = 166/241 (68.88%), Query Frame = 2
Query:  173 MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGA---TSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            + ++  +    N D  F   + + ++LSG I   +  +      G     +TFLR+RG+GW+LEV++ D +  KPLLEELDID+KDIYYK R VL+P P  G NRQVVRD PDFWGPL VV+ ++++S+ GQFRVVSWI+ IW+ GS  I+++AR LGGEV Y Q LGVIGYSLLP++++  +  ++      V+   +LFGV WAAYSA SLL  +E + K+ LL+YPI LLYIYF+S+Y
Sbjct:    5 VTKMTMQFSPNNGDFTFVSSS-EAQELSGTISTPDVKLNMGADGGRDPYATTFLRQRGYGWLLEVDDDDNEESKPLLEELDIDVKDIYYKIRCVLMPMPSLGFNRQVVRDNPDFWGPLAVVLFFSMISIYGQFRVVSWILTIWIFGSLTIFLLARVLGGEVSYGQVLGVIGYSLLPLIVIAPLLLVIGRFDV-VSTLVKLFGVFWAAYSAASLLVGDEFKTKKPLLIYPIFLLYIYFLSLY 243          
BLAST of Protein YIPF vs. Planmine SMEST
Match: SMESG000020934.1 (SMESG000020934.1)

HSP 1 Score: 357.451 bits (916), Expect = 2.418e-123
Identity = 235/238 (98.74%), Postives = 236/238 (99.16%), Query Frame = 2
Query:  173 MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGATSTFLRKRGFGWMLEVEEIDPDMRKPXXXXXXXXXXXXYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWXXXXXXXXXXXXYVIARSLGGEVYYAQCLGVIGYXXXXXXXXXXXXXXXXYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRXXXXXXXXXXXXXFISIY 886
            MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGATSTFLRKRGF WMLEVEEIDPDMRKPLLEELDIDLKDIYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWIIIIWLIGSCIIYVIARSLGGEVYYAQCLGVIGYSLLPMLLMCLISPLLLYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRILLLYPIGLLYIYF S+Y
Sbjct:    1 MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGATSTFLRKRGFAWMLEVEEIDPDMRKPLLEELDIDLKDIYYKTRSVLLPFPYFGLNRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWIIIIWLIGSCIIYVIARSLGGEVYYAQCLGVIGYSLLPMLLMCLISPLLLYVSKHVANFCRLFGVIWAAYSAGSLLCLEELQKKRILLLYPIGLLYIYFFSLY 238          
The following BLAST results are available for this feature:
BLAST of Protein YIPF vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
YIPF45.284e-5156.28Yip1 domain family member 4 [Source:HGNC Symbol;Ac... [more]
YIPF44.678e-743.14Yip1 domain family member 4 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y60A3A.195.792e-4249.19pep chromosome:WBcel235:V:19916557:19919996:1 gene... [more]
Y60A3A.192.986e-2342.28pep chromosome:WBcel235:V:19916557:19919976:1 gene... [more]
Y60A3A.192.331e-2147.14pep chromosome:WBcel235:V:19916557:19918302:1 gene... [more]
T08D2.61.928e-664.15pep chromosome:WBcel235:X:179786:182169:-1 gene:WB... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein YIPF vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
yipf44.814e-4455.56Yip1 domain family, member 4 [Source:NCBI gene;Acc... [more]
yipf44.814e-4455.56Yip1 domain family, member 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein YIPF vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Yipf41.814e-5057.47Yip1 domain family, member 4 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Protein YIPF vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BSR8|YIPF4_HUMAN2.537e-5056.28Protein YIPF4 OS=Homo sapiens OX=9606 GN=YIPF4 PE=... [more]
sp|Q5M7T4|YIPF4_RAT1.269e-4957.47Protein YIPF4 OS=Rattus norvegicus OX=10116 GN=Yip... [more]
sp|Q8C407|YIPF4_MOUSE1.269e-4957.47Protein YIPF4 OS=Mus musculus OX=10090 GN=Yipf4 PE... [more]
sp|Q5ZJD7|YIPF4_CHICK1.730e-4856.62Protein YIPF4 OS=Gallus gallus OX=9031 GN=YIPF4 PE... [more]
sp|Q6NYF1|YIPF4_DANRE3.634e-4355.56Protein YIPF4 OS=Danio rerio OX=7955 GN=yipf4 PE=2... [more]
back to top
BLAST of Protein YIPF vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GR471.741e-5068.09Protein YIPF OS=Macrostomum lignano OX=282301 PE=3... [more]
A0A1I8J4V12.067e-5068.09Protein YIPF OS=Macrostomum lignano OX=282301 GN=B... [more]
A0A2K5DCZ55.765e-4856.71Protein YIPF OS=Aotus nancymaae OX=37293 GN=YIPF4 ... [more]
G1STD46.016e-4856.71Protein YIPF OS=Oryctolagus cuniculus OX=9986 GN=Y... [more]
A0A444U7326.259e-4854.17Protein YIPF OS=Acipenser ruthenus OX=7906 GN=EOD3... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yipf41.860e-4754.55Yip1 domain family member 4 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yipf45.617e-3653.98Yip1 domain family, member 4 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein YIPF vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO315721.228e-4357.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315737.040e-2246.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein YIPF vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
yipf48.344e-4650.21Yip1 domain family member 4 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein YIPF vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020934.12.418e-12398.74SMESG000020934.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005895 ID=SMED30005895|Name=Protein YIPF|organism=Schmidtea mediterranea sexual|type=transcript|length=1249bp
GACAAAAGTAATTAAACTCTTTTAATATTTCAAAAACTAATTAAATTGAT
TTAAATACTTAAATTTACATAAGCGCATTTTTAAATAGTGACAACAAATA
TATTCATTTCACTTTTCGTAAAGATATTTCTTTTGTTATCTTTTGAACTA
TTTGATAAAGTGAAATTTTTAAATGAATCAAGTGAATTCAGAAAAAGAAT
CAACAAATATTGATCTAGGATTTTACGACGAAAATATTGACAACAAAGAT
TTATCGGGAAATATTCTGAATGATAACTCTCACATTGAAAGTTTCAACTC
AAATGGTGCTACATCAACATTTTTAAGGAAACGTGGATTCGGATGGATGT
TAGAAGTAGAAGAAATTGATCCAGATATGAGAAAACCTTTACTAGAGGAA
TTAGATATAGATCTTAAAGATATTTACTATAAAACAAGATCGGTTTTATT
GCCATTTCCATATTTTGGTTTAAATAGACAAGTTGTACGCGATAAACCAG
ATTTTTGGGGACCACTATTTGTTGTTATCCTTTATGCTTTAGTTTCTTTA
GTTGGCCAGTTTCGGGTCGTATCATGGATTATAATAATTTGGTTGATTGG
ATCCTGCATAATTTATGTAATTGCCAGGTCACTTGGAGGAGAGGTGTATT
ATGCTCAATGCCTTGGTGTGATCGGATATTCTCTGTTACCAATGCTTTTA
ATGTGTTTAATCAGCCCCTTATTATTGTATGTCAGCAAGCACGTTGCCAA
CTTTTGTCGGCTATTTGGAGTGATATGGGCAGCTTACAGTGCTGGCTCAC
TATTGTGCTTAGAAGAATTACAGAAGAAAAGAATTTTATTACTTTATCCA
ATCGGATTGTTATACATATATTTTATTTCTATATACTGGTGCATGATAAA
ATGGCAGAATTCTGGTTCCTTTGTTCTTTATGATATATATATATATATTA
TCCATTCTGATAATTCTGTTATTTGATCAGATCCAAAATTGAAGTTTATC
TATTGAAAATTGTAATATTGAATTCTTATTTTAAAATCTTTTTTACCAAA
ACTTATTTTTTCTTTTTTCTTTAAACCGACAGTAATTATTTTTATAGTAT
TGTAGAGATTGAGTTTGATAGGGTTTTAGAAATTTTCCACAAAATAGTAT
ATTTTTAGACAAATAAAAAGTAATAATTGATAAATAACAATTGTACTATG
CTTGGTAATTAATATCAGCTTTCATAAATTATCCACAGCAATGACAAAT
back to top

protein sequence of SMED30005895-orf-1

>SMED30005895-orf-1 ID=SMED30005895-orf-1|Name=SMED30005895-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=268bp
MNQVNSEKESTNIDLGFYDENIDNKDLSGNILNDNSHIESFNSNGATSTF
LRKRGFGWMLEVEEIDPDMRKPLLEELDIDLKDIYYKTRSVLLPFPYFGL
NRQVVRDKPDFWGPLFVVILYALVSLVGQFRVVSWIIIIWLIGSCIIYVI
ARSLGGEVYYAQCLGVIGYSLLPMLLMCLISPLLLYVSKHVANFCRLFGV
IWAAYSAGSLLCLEELQKKRILLLYPIGLLYIYFISIYWCMIKWQNSGSF
VLYDIYIYIIHSDNSVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006977Yip1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane