Coiled-coil domain containing 81

Overview
NameCoiled-coil domain containing 81
Smed IDSMED30005883
Length (bp)1980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil domain containing 81 (SMED30005883) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil domain containing 81 (SMED30005883) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil domain containing 81 (SMED30005883) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil domain containing 81 (SMED30005883) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005883

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005883SMESG000036887.1 SmedASXL_008071SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005883SMESG000036887.1 dd_Smed_v6_6753_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005883SMESG000036887.1 dd_Smed_v4_6753_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil domain containing 81 vs. Ensembl Human
Match: CCDC81 (coiled-coil domain containing 81 [Source:HGNC Symbol;Acc:HGNC:26281])

HSP 1 Score: 204.912 bits (520), Expect = 2.622e-57
Identity = 140/360 (38.89%), Postives = 223/360 (61.94%), Query Frame = 1
Query:  745 PSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            PS +  ++      S  C      GQ++CYVC QR +RN  + ++E+ + RE E+ER+IQ YQ +KD E L + Q   L+ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P    +KQ + S  L KQ+D +     K  +    M+RLEQ+QL E+LA QR ++LKDK +    YK+ALD Q+ +K   LP  EPDS EP+FGKN+   E ++EK+ + Q+ +K+Q+E A   K++ ++ +L +Q  + ++L + + + + DR    +R   NR+   L+ +WE++   KK+RDL ++      D   L +QC+KY RC QC+R+T N+G+SN+W    F+PG+R +
Sbjct:  208 PSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEE-RRREIEDERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNE--GELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERV--NRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLL 561          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Human
Match: CCDC81 (coiled-coil domain containing 81 [Source:HGNC Symbol;Acc:HGNC:26281])

HSP 1 Score: 204.527 bits (519), Expect = 1.412e-56
Identity = 140/360 (38.89%), Postives = 223/360 (61.94%), Query Frame = 1
Query:  745 PSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            PS +  ++      S  C      GQ++CYVC QR +RN  + ++E+ + RE E+ER+IQ YQ +KD E L + Q   L+ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P    +KQ + S  L KQ+D +     K  +    M+RLEQ+QL E+LA QR ++LKDK +    YK+ALD Q+ +K   LP  EPDS EP+FGKN+   E ++EK+ + Q+ +K+Q+E A   K++ ++ +L +Q  + ++L + + + + DR    +R   NR+   L+ +WE++   KK+RDL ++      D   L +QC+KY RC QC+R+T N+G+SN+W    F+PG+R +
Sbjct:  298 PSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEE-RRREIEDERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNE--GELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERV--NRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLL 651          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Human
Match: CCDC81 (coiled-coil domain containing 81 [Source:HGNC Symbol;Acc:HGNC:26281])

HSP 1 Score: 170.244 bits (430), Expect = 2.516e-46
Identity = 111/282 (39.36%), Postives = 179/282 (63.48%), Query Frame = 1
Query:  979 LSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            L+ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P    +KQ + S  L KQ+D +     K  +    M+RLEQ+QL E+LA QR ++LKDK +    YK+ALD Q+ +K   LP  EPDS EP+FGKN+   E ++EK+ + Q+ +K+Q+E A   K++ ++ +L +Q  + ++L + + + + DR    +R   NR+   L+ +WE++   KK+RDL ++      D   L +QC+KY RC QC+R+T N+G+SN+W    F+PG+R +
Sbjct:  110 LATREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNEG--ELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERV--NRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLL 386          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Xenopus
Match: cbwd1.1 (COBW domain containing 1, gene 1 [Source:Xenbase;Acc:XB-GENE-5878454])

HSP 1 Score: 233.802 bits (595), Expect = 4.700e-67
Identity = 140/335 (41.79%), Postives = 220/335 (65.67%), Query Frame = 1
Query:  817 GQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKL----EPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTR 1809
            GQ+LCY+C QR ++N+P+ F E+ + +E+E+ER++Q YQ+MKD E L+K Q   L+ +   +K +A+N GV EA+++++  ++ + Y+SY F+KRPLTPP ++KQ Q    L KQ+  K +     ++D+  ++RLEQMQL+E+L  QR ++LK+K +    YK ALDTQ+T++    P      EPD  EPVFG+ND+T EKL+EKR +A ++ K Q++ + ++K+  ++++L +Q  E  +L K K  ++ D+A +Y +  + +  L+ EW K  E K+ +D  E  K     S LL +Q DKY RC QCKR+  N GQSNIW E+ +IPG R
Sbjct:  334 GQELCYLCMQRAQKNIPVYFTEERRLKEQEDERILQEYQHMKDQEALVKSQLASLANRKQYEKDAAYNMGVGEAVRNEKNKRNMDFYKSYFFQKRPLTPPAYLKQDQCYQSLTKQIAEKKSKELTLKQDKDLLDRLEQMQLSEELTAQRAKFLKEKNEQVQCYKSALDTQITTQGKMKPAFLLSSEPDVTEPVFGRNDMTNEKLVEKRKRALEVSKQQLQASVERKRLAVLNELLQQRQEGDMLAKSKQQMVSDKADQYNKMYRIQKALQEEWAKCAELKQHKD-NEEEKFIQAGSHLLLDQFDKYRRCFQCKRRPSNRGQSNIWSESRYIPGAR 667          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Xenopus
Match: cbwd1.1 (COBW domain containing 1, gene 1 [Source:Xenbase;Acc:XB-GENE-5878454])

HSP 1 Score: 229.18 bits (583), Expect = 9.466e-66
Identity = 138/333 (41.44%), Postives = 218/333 (65.47%), Query Frame = 1
Query:  823 DLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKL----EPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTR 1809
            +LCY+C QR ++N+P+ F E+ + +E+E+ER++Q YQ+MKD E L+K Q   L+ +   +K +A+N GV EA+++++  ++ + Y+SY F+KRPLTPP ++KQ Q    L KQ+  K +     ++D+  ++RLEQMQL+E+L  QR ++LK+K +    YK ALDTQ+T++    P      EPD  EPVFG+ND+T EKL+EKR +A ++ K Q++ + ++K+  ++++L +Q  E  +L K K  ++ D+A +Y +  + +  L+ EW K  E K+ +D  E  K     S LL +Q DKY RC QCKR+  N GQSNIW E+ +IPG R
Sbjct:  282 ELCYLCMQRAQKNIPVYFTEERRLKEQEDERILQEYQHMKDQEALVKSQLASLANRKQYEKDAAYNMGVGEAVRNEKNKRNMDFYKSYFFQKRPLTPPAYLKQDQCYQSLTKQIAEKKSKELTLKQDKDLLDRLEQMQLSEELTAQRAKFLKEKNEQVQCYKSALDTQITTQGKMKPAFLLSSEPDVTEPVFGRNDMTNEKLVEKRKRALEVSKQQLQASVERKRLAVLNELLQQRQEGDMLAKSKQQMVSDKADQYNKMYRIQKALQEEWAKCAELKQHKD-NEEEKFIQAGSHLLLDQFDKYRRCFQCKRRPSNRGQSNIWSESRYIPGAR 613          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Xenopus
Match: cbwd1.1 (COBW domain containing 1, gene 1 [Source:Xenbase;Acc:XB-GENE-5878454])

HSP 1 Score: 186.037 bits (471), Expect = 1.204e-50
Identity = 108/271 (39.85%), Postives = 180/271 (66.42%), Query Frame = 1
Query:  814 FGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKL----EPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRY------QRALQ 1596
            +  +LCY+C QR ++N+P+ F E+ + +E+E+ER++Q YQ+MKD E L+K Q   L+ +   +K +A+N GV EA+++++  ++ + Y+SY F+KRPLTPP ++KQ Q    L KQ+  K +     ++D+  ++RLEQMQL+E+L  QR ++LK+K +    YK ALDTQ+T++    P      EPD  EPVFG+ND+T EKL+EKR +A ++ K Q++ + ++K+  ++++L +Q  E  +L K K  ++ D+A +Y      Q+ALQ
Sbjct:  251 YSTELCYLCMQRAQKNIPVYFTEERRLKEQEDERILQEYQHMKDQEALVKSQLASLANRKQYEKDAAYNMGVGEAVRNEKNKRNMDFYKSYFFQKRPLTPPAYLKQDQCYQSLTKQIAEKKSKELTLKQDKDLLDRLEQMQLSEELTAQRAKFLKEKNEQVQCYKSALDTQITTQGKMKPAFLLSSEPDVTEPVFGRNDMTNEKLVEKRKRALEVSKQQLQASVERKRLAVLNELLQQRQEGDMLAKSKQQMVSDKADQYNKMYRIQKALQ 521          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Mouse
Match: Ccdc81 (coiled-coil domain containing 81 [Source:MGI Symbol;Acc:MGI:1918134])

HSP 1 Score: 198.364 bits (503), Expect = 1.766e-54
Identity = 143/354 (40.40%), Postives = 218/354 (61.58%), Query Frame = 1
Query:  763 NNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            N RP TS +  C      GQ++CYVC QR +RN  + + ++ + RE E+ER++Q YQ +KD E   K Q   ++ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P     KQ + S  L KQ++ K     K  ++   M+RLEQ+QL E+LA QR QYLK+K +    YK+ALD QV +K   LP  EPDS EP+FGKND  +E  +EKR + Q  +K+QME A   K+  ++++L +Q  + ++L + + + + DRA    R   NR+   L+ +W+++   KK+RD+ E+      D   L +QC+KY RC QC+R+T N G+SN+W    F+ G+R +
Sbjct:  305 NERPRTSPAPACQDHNKAGQEMCYVCLQRAQRNFALHYGDERRRREIEDERLMQQYQILKDQEAFFKNQVKGMAAREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPEINAFKQEEYSQSLLKQMESKREKEIKQRQNRELMDRLEQVQLTEELAAQRAQYLKEKMEETQHYKRALDAQVKNKPPQLPMFEPDSAEPIFGKNDGERE--MEKRKREQSCMKHQMEAAASHKRNTILNQLVDQRRDLQMLQRTQREHMADRAAEMDRV--NRLNQCLQEDWDRSLAMKKQRDVEEKAFERASDKLFLLDQCEKYRRCRQCQRRTCNTGESNLWPMNKFLQGSRLL 653          
BLAST of Coiled-coil domain containing 81 vs. UniProt/SwissProt
Match: sp|Q6ZN84|CCD81_HUMAN (Coiled-coil domain-containing protein 81 OS=Homo sapiens OX=9606 GN=CCDC81 PE=1 SV=2)

HSP 1 Score: 204.527 bits (519), Expect = 6.779e-56
Identity = 140/360 (38.89%), Postives = 223/360 (61.94%), Query Frame = 1
Query:  745 PSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            PS +  ++      S  C      GQ++CYVC QR +RN  + ++E+ + RE E+ER+IQ YQ +KD E L + Q   L+ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P    +KQ + S  L KQ+D +     K  +    M+RLEQ+QL E+LA QR ++LKDK +    YK+ALD Q+ +K   LP  EPDS EP+FGKN+   E ++EK+ + Q+ +K+Q+E A   K++ ++ +L +Q  + ++L + + + + DR    +R   NR+   L+ +WE++   KK+RDL ++      D   L +QC+KY RC QC+R+T N+G+SN+W    F+PG+R +
Sbjct:  298 PSCLKHDSEMKPQTSPACQDHNKAGQEMCYVCLQRAQRNSLLYYSEE-RRREIEDERLIQQYQMLKDQEALFRHQMKSLATREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPALNALKQEEYSRSLLKQMDNRQENEIKQRQYRELMDRLEQVQLTEELAAQRAKFLKDKMEETQCYKRALDAQIKNKPSRLPPFEPDSSEPIFGKNE--GELMVEKQKREQNYMKHQLEAAANHKRKAILHQLVDQRRDLQMLQRTQREHLADRTAELERV--NRVNQCLQEDWERSAAMKKQRDLEDKAFERASDKLFLLDQCEKYRRCKQCQRRTSNVGESNLWPLNKFLPGSRLL 651          
BLAST of Coiled-coil domain containing 81 vs. UniProt/SwissProt
Match: sp|Q5XIN9|CCD81_RAT (Coiled-coil domain-containing protein 81 OS=Rattus norvegicus OX=10116 GN=Ccdc81 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.685e-54
Identity = 144/354 (40.68%), Postives = 217/354 (61.30%), Query Frame = 1
Query:  763 NNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            N +P TS +  C      GQ++CYVC QR +RN  + + ++ + RE E+ER++Q YQ  KD E   K Q   ++ +  +QK +A+N GVAEAI+S +  K P+ Y+S+LF+KRPL+P     KQ + S  L KQ++ K     K  ++   M+RLEQ+QL E+LA QR QYLK+K +    YK+ALD QV +K   LP  EPDS EP+FGKN+   E  +EKR + Q  +K+QME A   K+  ++++L +Q  + ++L + K + + DRA    R   NR+   L+ +W+++   KK+RDL E+      D   L +QC+KY RC QC+R+T N G+SN+W    F+ G+R +
Sbjct:  302 NEKPKTSPAPACQDHNKAGQEMCYVCLQRAQRNFALYYGDEKRRREIEDERLMQQYQIAKDQEAFFKSQMKSMATREQNQKNAAYNLGVAEAIRSHKNEK-PDFYKSFLFDKRPLSPEINAFKQEEYSQSLLKQMESKREKEIKQRQNRELMDRLEQVQLTEELAAQRAQYLKEKMEETQYYKRALDAQVKNKPSQLPMFEPDSAEPIFGKNEGEME--MEKRKREQSCMKHQMEAAANLKRNTILNQLVDQRRDLQMLQRTKREHLADRAAEVDRV--NRLNQCLQEDWDRSLAMKKQRDLEEKAFERASDKLFLLDQCEKYRRCRQCQRRTSNTGESNVWPLNKFLQGSRLL 650          
BLAST of Coiled-coil domain containing 81 vs. UniProt/SwissProt
Match: sp|Q9D5W4|CCD81_MOUSE (Coiled-coil domain-containing protein 81 OS=Mus musculus OX=10090 GN=Ccdc81 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.235e-53
Identity = 143/354 (40.40%), Postives = 218/354 (61.58%), Query Frame = 1
Query:  763 NNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPP-KFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIR--LXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            N RP TS +  C      GQ++CYVC QR +RN  + + ++ + RE E+ER++Q YQ +KD E   K Q   ++ +  +QK +A+N GVAEAI++ +  K P  Y+S+LF+KRPL+P     KQ + S  L KQ++ K     K  ++   M+RLEQ+QL E+LA QR QYLK+K +    YK+ALD QV +K   LP  EPDS EP+FGKND  +E  +EKR + Q  +K+QME A   K+  ++++L +Q  + ++L + + + + DRA    R   NR+   L+ +W+++   KK+RD+ E+      D   L +QC+KY RC QC+R+T N G+SN+W    F+ G+R +
Sbjct:  305 NERPRTSPAPACQDHNKAGQEMCYVCLQRAQRNFALHYGDERRRREIEDERLMQQYQILKDQEAFFKNQVKGMAAREQNQKNAAYNLGVAEAIRNHKNEK-PEFYKSFLFDKRPLSPEINAFKQEEYSQSLLKQMESKREKEIKQRQNRELMDRLEQVQLTEELAAQRAQYLKEKMEETQHYKRALDAQVKNKPPQLPMFEPDSAEPIFGKNDGERE--MEKRKREQSCMKHQMEAAASHKRNTILNQLVDQRRDLQMLQRTQREHMADRAAEMDRV--NRLNQCLQEDWDRSLAMKKQRDVEEKAFERASDKLFLLDQCEKYRRCRQCQRRTCNTGESNLWPMNKFLQGSRLL 653          
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Match: A0A267F6C8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016345g1 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 2.162e-103
Identity = 182/349 (52.15%), Postives = 268/349 (76.79%), Query Frame = 1
Query:  769 RPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            RP ++ASS CGH G  GQ+LCYVC+QR +RN+P+SFAE+LK REKEE++++ AY  M+D E ++KEQ++LL+K++D+QK+SAFN G+AEA K  +  +DP+   SY+F+ RPLTPP+ IKQ  L++EL +QV  K +T  +   DEAF+ERLEQ+QLAEDLA QR+Q+LKD+E+ K++YK+AL  Q+  K +PLP  EPDS EPVFG+NDVT+EKL+E+R +A+++  +Q++    KK+E L+ +LQEQ +EE+VL + + DL+ DRA R+ R  +NR  LE +W +A + K++R+L E+++ S P   L+HEQCD + RC QCKR+  N G++N+W E+Y++PG+RY+
Sbjct:  218 RPPSTASS-CGHAG-AGQELCYVCHQRARRNIPVSFAEELKRREKEEDQLLHAYNEMRDKERILKEQESLLAKRHDAQKVSAFNLGIAEAQKDSRGQRDPDNRPSYIFQARPLTPPRRIKQMALNAELERQVTDKKSTHDRVRADEAFLERLEQVQLAEDLAAQREQFLKDREEQKEMYKRALSAQLRYKPVPLPPREPDSSEPVFGRNDVTEEKLLERRRRAKEVAVSQLDDVNAKKREELLRRLQEQKYEEEVLRRTREDLVRDRAWRFDRMQRNRKGLEDDWSQAAQIKRDRELAEKMRASSP-GGLIHEQCDNHRRCKQCKRRLNNSGETNVWCESYYVPGSRYL 563          
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Match: A0A267G095 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016345g3 PE=4 SV=1)

HSP 1 Score: 335.88 bits (860), Expect = 3.187e-101
Identity = 182/349 (52.15%), Postives = 268/349 (76.79%), Query Frame = 1
Query:  769 RPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            RP ++ASS CGH G  GQ+LCYVC+QR +RN+P+SFAE+LK REKEE++++ AY  M+D E ++KEQ++LL+K++D+QK+SAFN G+AEA K  +  +DP+   SY+F+ RPLTPP+ IKQ  L++EL +QV  K +T  +   DEAF+ERLEQ+QLAEDLA QR+Q+LKD+E+ K++YK+AL  Q+  K +PLP  EPDS EPVFG+NDVT+EKL+E+R +A+++  +Q++    KK+E L+ +LQEQ +EE+VL + + DL+ DRA R+ R  +NR  LE +W +A + K++R+L E+++ S P   L+HEQCD + RC QCKR+  N G++N+W E+Y++PG+RY+
Sbjct:  416 RPPSTASS-CGHAGA-GQELCYVCHQRARRNIPVSFAEELKRREKEEDQLLHAYNEMRDKERILKEQESLLAKRHDAQKVSAFNLGIAEAQKDSRGQRDPDNRPSYIFQARPLTPPRRIKQMALNAELERQVTDKKSTHDRVRADEAFLERLEQVQLAEDLAAQREQFLKDREEQKEMYKRALSAQLRYKPVPLPPREPDSSEPVFGRNDVTEEKLLERRRRAKEVAVSQLDDVNAKKREELLRRLQEQKYEEEVLRRTREDLVRDRAWRFDRMQRNRKGLEDDWSQAAQIKRDRELAEKMRASSP-GGLIHEQCDNHRRCKQCKRRLNNSGETNVWCESYYVPGSRYL 761          
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Match: A0A267GGD7 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016345g2 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.261e-100
Identity = 181/349 (51.86%), Postives = 267/349 (76.50%), Query Frame = 1
Query:  769 RPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            RP ++ASS CGH G  GQ+LCYVC+QR +RN+P+SFAE+LK REKEE++++ AY  M+D E ++KEQ++LL+K++D+QK+SAFN G+AEA K  +  +DP+   SY+F+ RPLTPP+ IKQ  L++EL +QV  K +T  +   DEAF+ERLEQ+QLAEDLA QR+Q+LKD+E+ K++YK+AL  Q+  K +PLP  EPDS EPVFG+NDVT+EKL+E+R +A+++  +Q++    K +E L+ +LQEQ +EE+VL + + DL+ DRA R+ R  +NR  LE +W +A + K++R+L E+++ S P   L+HEQCD + RC QCKR+  N G++N+W E+Y++PG+RY+
Sbjct:  416 RPPSTASS-CGHAGA-GQELCYVCHQRARRNIPVSFAEELKRREKEEDQLLHAYNEMRDKERILKEQESLLAKRHDAQKVSAFNLGIAEAQKDSRGQRDPDNRPSYIFQARPLTPPRRIKQMALNAELERQVTDKKSTHDRVRADEAFLERLEQVQLAEDLAAQREQFLKDREEQKEMYKRALSAQLRYKPVPLPPREPDSSEPVFGRNDVTEEKLLERRRRAKEVAVSQLDDVNAKNREELLRRLQEQKYEEEVLRRTREDLVRDRAWRFDRMQRNRKGLEDDWSQAAQIKRDRELAEKMRASSP-GGLIHEQCDNHRRCKQCKRRLNNSGETNVWCESYYVPGSRYL 761          
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Match: A0A1I8HV64 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 5.806e-100
Identity = 182/349 (52.15%), Postives = 268/349 (76.79%), Query Frame = 1
Query:  769 RPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            RP ++ASS CGH G  GQ+LCYVC+QR +RN+P+SFAE+LK REKEE++++ AY  M+D E ++KEQ++LL+K++D+QK+SAFN G+AEA K  +  +DP+   SY+F+ RPLTPP+ IKQ  L++EL +QV  K +T  +   DEAF+ERLEQ+QLAEDLA QR+Q+LKD+E+ K++YK+AL  Q+  K +PLP  EPDS EPVFG+NDVT+EKL+E+R +A+++  +Q++    KK+E L+ +LQEQ +EE+VL + + DL+ DRA R+ R  +NR  LE +W +A + K++R+L E+++ S P   L+HEQCD + RC QCKR+  N G++N+W E+Y++PG+RY+
Sbjct:  541 RPPSTASS-CGHAGA-GQELCYVCHQRARRNIPVSFAEELKRREKEEDQLLHAYNEMRDKERILKEQESLLAKRHDAQKVSAFNLGIAEAQKDSRGQRDPDNRPSYIFQARPLTPPRRIKQMALNAELERQVTDKKSTHDRVRADEAFLERLEQVQLAEDLAAQREQFLKDREEQKEMYKRALSAQLRYKPVPLPPREPDSSEPVFGRNDVTEEKLLERRRRAKEVAVSQLDDVNAKKREELLRRLQEQKYEEEVLRRTREDLVRDRAWRFDRMQRNRKGLEDDWSQAAQIKRDRELAEKMRASSP-GGLIHEQCDNHRRCKQCKRRLNNSGETNVWCESYYVPGSRYL 886          
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Match: A0A1I8H806 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 6.549e-100
Identity = 182/349 (52.15%), Postives = 268/349 (76.79%), Query Frame = 1
Query:  769 RPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            RP ++ASS CGH G  GQ+LCYVC+QR +RN+P+SFAE+LK REKEE++++ AY  M+D E ++KEQ++LL+K++D+QK+SAFN G+AEA K  +  +DP+   SY+F+ RPLTPP+ IKQ  L++EL +QV  K +T  +   DEAF+ERLEQ+QLAEDLA QR+Q+LKD+E+ K++YK+AL  Q+  K +PLP  EPDS EPVFG+NDVT+EKL+E+R +A+++  +Q++    KK+E L+ +LQEQ +EE+VL + + DL+ DRA R+ R  +NR  LE +W +A + K++R+L E+++ S P   L+HEQCD + RC QCKR+  N G++N+W E+Y++PG+RY+
Sbjct:  529 RPPSTASS-CGHAGA-GQELCYVCHQRARRNIPVSFAEELKRREKEEDQLLHAYNEMRDKERILKEQESLLAKRHDAQKVSAFNLGIAEAQKDSRGQRDPDNRPSYIFQARPLTPPRRIKQMALNAELERQVTDKKSTHDRVRADEAFLERLEQVQLAEDLAAQREQFLKDREEQKEMYKRALSAQLRYKPVPLPPREPDSSEPVFGRNDVTEEKLLERRRRAKEVAVSQLDDVNAKKREELLRRLQEQKYEEEVLRRTREDLVRDRAWRFDRMQRNRKGLEDDWSQAAQIKRDRELAEKMRASSP-GGLIHEQCDNHRRCKQCKRRLNNSGETNVWCESYYVPGSRYL 874          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Cavefish
Match: CCDC81 (coiled-coil domain containing 81 [Source:NCBI gene;Acc:103040579])

HSP 1 Score: 200.675 bits (509), Expect = 1.813e-55
Identity = 129/345 (37.39%), Postives = 205/345 (59.42%), Query Frame = 1
Query:  781 SASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            SA+  C +    GQ+LCY+C QR +RN+P+   E+  + EKEEE+V+   +  KD + L  EQ      +  ++K +AFN  +AEA+K+++ A+      SY+F  RP+TPP  +KQ +   EL +Q   +     +++++   ++RL Q+QLA+++AKQR Q +  K+ +   Y+KAL  Q+  ++  +P  +PDS+ PVFG  D     L E++ +A+ + + Q+  A  K+KE L ++L+ Q  E  +L   + +LI DR  RY++    R  LE  W ++ + K  RD  ER  I    S LL +QC +Y RC QCKRKT N G+SNIWKE+ +IPG+R +
Sbjct:  301 SATPTCLNHTRAGQELCYLCMQRTQRNIPLYLTEEKMKAEKEEEKVLLLAEQHKDEQFLKMEQIQQEEDREYNKKTAAFNLEIAEALKAKKSARPSQFDGSYIFHGRPVTPPMLLKQRRYMQELLEQAAYRRQQNTQSKQNHELIDRLHQIQLADEIAKQRSQEIHQKKANIKSYQKALSAQLEQRATGIPARQPDSDGPVFGVRDRAPSALAEQKQRARKLYQEQLSTANTKRKEALFNRLEVQRKERDMLHCSRKELIADRISRYEKLRNVRASLEDTWTRSADLKHHRDQEERDFIR-SGSRLLIDQCQQYRRCHQCKRKTSNCGESNIWKESRYIPGSRLM 644          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001530.1 (pep scaffold:Pmarinus_7.0:GL476341:577018:598505:-1 gene:ENSPMAG00000001379.1 transcript:ENSPMAT00000001530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 3.759e-46
Identity = 118/356 (33.15%), Postives = 209/356 (58.71%), Query Frame = 1
Query:  751 SICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEE-PVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            S C    P+T     C   G  GQ+LCY+C QR  RNVP+  AE+ + +E+ EER +  Y++ +D +   KEQ+ L   + +S+K++AFN GV+EA+K+ +  +  N ++S++   R  TP    +  + +  L +Q   ++    ++ + +  +E+L+++QLA +LA +R+Q L+ K +    Y++AL TQV SK+L   +    +E  PVFG +D T   L E+R +A+++       A +KK+ +++S+L EQ  + ++L++ + +L  +   R+ + +  R  L+  W  + E K+ R+L   + +   +  LL EQCDKY RC QC R+  N G+S++WK++ ++PGTR I
Sbjct:  269 SWCPGLAPATPPG--CTTHGRAGQELCYLCMQRSLRNVPVYVAEERRLQEEAEERALLEYRHGQDLQAFTKEQELLELARDNSRKVAAFNLGVSEAVKASKHGQS-NGFQSFILGDRAATPLSAARSREYAHHLERQRSERMEREGRHRKQQRILEQLQRVQLARELALEREQMLQSKAEEAQAYQQALATQVQSKALAAAQERGAAEAAPVFGGDDSTARALEERRERARELRCELAGEAARKKRSVVVSQLTEQRRQMELLERNQQELAREHVTRHAQTVGRRAALQEAWALSAELKRGRNLQLEMHLKFSELFLLLEQCDKYKRCQQCTRRLSNRGESHVWKDSRYLPGTRMI 621          
BLAST of Coiled-coil domain containing 81 vs. Ensembl Nematostella
Match: EDO38720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC01])

HSP 1 Score: 271.166 bits (692), Expect = 2.218e-81
Identity = 164/389 (42.16%), Postives = 248/389 (63.75%), Query Frame = 1
Query:  688 PLPTPQPP---SKSFLLPE-PKKPSSICSNNRP--------STSASSICG-HPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYI 1815
            P P P PP   S     PE P+ P+   +  +         S S    C  H    GQ+LCY+C+QR ++NVP+ F+E+ + +E E++R++Q YQ+ KDSE ++ EQ   +  +  +QK++AFN GV+E IK+++  +     RSY+F+ RPLTPP++IKQ + S  L  QV  K     +   ++ F+ERLEQ+QLAEDLA QR+QY+++K+ + +LYKKALDTQV  K LP+P LEPDS  P+FG +D T+EKL E+R + + + K Q++   QKK+E ++  L+ Q  E  +L++ K D+I DR  R+Q  L  R +LE+ W +    KK+R+  ER++   P   L+HEQC+KY RC QC+R+  N G+SN+W E+ +IPG+R +
Sbjct:  306 PEPVPTPPKSASPRRRAPETPQAPADTQTQGQEMEAEPLGRSNSGMLACTLHGDRGGQELCYLCHQRAEKNVPVYFSEERRRKELEQDRLLQHYQHQKDSEAIIMEQAKNMENRRYNQKVAAFNLGVSEGIKTKKSTRPTEFCRSYVFQNRPLTPPRYIKQNEYSQTLADQVTSKSNKLTRLNREKEFLERLEQVQLAEDLALQREQYMREKKLANELYKKALDTQVRFKPLPIPALEPDSIGPIFGIHDATEEKLEEQRNRNRKLYKEQLDMVSQKKREAILRDLKSQKEESDMLERTKRDIILDRTLRHQEMLDTRRKLENSWAEHVTRKKDREEEERMRAQSP-GMLIHEQCEKYRRCNQCRRRPHNCGESNVWSESRYIPGSRIM 693          
BLAST of Coiled-coil domain containing 81 vs. Planmine SMEST
Match: SMESG000036887.1 (SMESG000036887.1)

HSP 1 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 432/433 (99.77%), Postives = 433/433 (100.00%), Query Frame = 1
Query:  520 KPLTEQETNPTFENHPIYIESVNSEELSRRDFNDNDQTEQINKYNQIEEEFDTQFKPLPTPQPPSKSFLLPEPKKPSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLXXXXXXXXXVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQXXXXXXXXXXXXXXALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLXXXXXXXXXXXXXRDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYIY 1818
            +PLTEQETNPTFENHPIYIESVNSEELSRRDFNDNDQTEQINKYNQIEEEFDTQFKPLPTPQPPSKSFLLPEPKKPSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLKEREKEEERVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQYLKDKEKSKDLYKKALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLESEWEKAKEEKKERDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYIY
Sbjct:  266 EPLTEQETNPTFENHPIYIESVNSEELSRRDFNDNDQTEQINKYNQIEEEFDTQFKPLPTPQPPSKSFLLPEPKKPSSICSNNRPSTSASSICGHPGPFGQDLCYVCYQREKRNVPISFAEQLKEREKEEERVIQAYQNMKDSEHLMKEQDTLLSKKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQTQLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQYLKDKEKSKDLYKKALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMKAQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQRALQNRIRLESEWEKAKEEKKERDLIERLKISMPDSTLLHEQCDKYTRCAQCKRKTQNMGQSNIWKETYFIPGTRYIY 698          
The following BLAST results are available for this feature:
BLAST of Coiled-coil domain containing 81 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CCDC812.622e-5738.89coiled-coil domain containing 81 [Source:HGNC Symb... [more]
CCDC811.412e-5638.89coiled-coil domain containing 81 [Source:HGNC Symb... [more]
CCDC812.516e-4639.36coiled-coil domain containing 81 [Source:HGNC Symb... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cbwd1.14.700e-6741.79COBW domain containing 1, gene 1 [Source:Xenbase;A... [more]
cbwd1.19.466e-6641.44COBW domain containing 1, gene 1 [Source:Xenbase;A... [more]
cbwd1.11.204e-5039.85COBW domain containing 1, gene 1 [Source:Xenbase;A... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc811.766e-5440.40coiled-coil domain containing 81 [Source:MGI Symbo... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q6ZN84|CCD81_HUMAN6.779e-5638.89Coiled-coil domain-containing protein 81 OS=Homo s... [more]
sp|Q5XIN9|CCD81_RAT1.685e-5440.68Coiled-coil domain-containing protein 81 OS=Rattus... [more]
sp|Q9D5W4|CCD81_MOUSE1.235e-5340.40Coiled-coil domain-containing protein 81 OS=Mus mu... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F6C82.162e-10352.15Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267G0953.187e-10152.15Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GGD72.261e-10051.86Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8HV645.806e-10052.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H8066.549e-10052.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CCDC811.813e-5537.39coiled-coil domain containing 81 [Source:NCBI gene... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001530.13.759e-4633.15pep scaffold:Pmarinus_7.0:GL476341:577018:598505:-... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO387202.218e-8142.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil domain containing 81 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil domain containing 81 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000036887.10.000e+099.77SMESG000036887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005883 ID=SMED30005883|Name=Coiled-coil domain containing 81|organism=Schmidtea mediterranea sexual|type=transcript|length=1980bp
CTTCATTCATTCTGTGAGATAATGGACATCATGAATATTTAATCGAAACA
TTACAATCAATTGCTTCGTCATTTCTCAAGAGTAAATTACTTAACGCAAT
TTCATTCGCTGTTATTGGACATTAGTATCCATTATGGATTCACCAATTGC
AAGCAGTTGGACACATTTATTAATTTATATTTATTCTCGATTTGTTGGTT
TTTGATCGTTTCTTCGATACTTTCACCACTGATTATGAATCAAACATTTC
CGGAAAAAATTACCCGACTATATAACTTAAAAGAGATTCCATTTGTCTAT
TCATTGCCACAGATTAAGAATGGAAATCGGAATTTGTATTATAATTCTCA
AAAGGATTCATGGACCATTCTTGAAAAAGATCGTCGTAGACAGAATCGGT
TAACTTACGAGCAGTTTTTATATCAATCATTTCCTGCCAATAATTATGGA
CTTAATGATGACCTACCGGAAATAATTAGCAAACATTCTTGCAATAAATT
TCGTTTTTCTAAGAGAAAGAAACCTTTGACGGAACAAGAAACCAATCCAA
CCTTTGAAAATCATCCAATATATATTGAATCAGTAAATTCAGAAGAATTA
AGTAGGAGGGATTTTAATGATAATGACCAGACGGAACAAATCAACAAATA
TAATCAGATAGAGGAAGAATTCGACACTCAGTTCAAACCATTACCAACTC
CACAACCTCCATCAAAATCATTTTTATTACCTGAACCCAAAAAACCTTCA
TCAATTTGTTCTAACAATAGACCATCAACATCTGCATCTTCAATTTGTGG
ACATCCGGGACCCTTCGGGCAAGATTTGTGTTATGTCTGTTATCAACGCG
AAAAAAGAAACGTACCAATATCCTTTGCTGAACAGTTGAAAGAACGAGAA
AAGGAAGAAGAACGAGTTATCCAAGCTTATCAAAACATGAAAGATTCTGA
ACACTTAATGAAAGAACAAGATACTTTACTTTCAAAAAAATATGACAGCC
AAAAGATTTCAGCATTCAATGCGGGAGTGGCAGAAGCTATAAAGTCACAA
CAAAAAGCAAAAGATCCAAATATGTATCGATCATATTTATTTGAAAAAAG
GCCACTTACACCACCTAAATTTATTAAACAAACTCAACTGAGTTCGGAAC
TTGGAAAACAAGTAGATAGAAAAGTTACAACACGGAAAAAAAATGAGGAA
GACGAGGCTTTTATGGAGAGATTAGAGCAAATGCAATTAGCAGAAGATCT
AGCTAAACAAAGAGATCAGTATTTAAAAGACAAAGAAAAATCAAAAGATC
TTTATAAGAAAGCTCTGGATACTCAAGTGACCTCCAAATCTTTACCATTA
CCGAAACTCGAACCAGATTCAGAGGAACCAGTATTTGGTAAGAATGATGT
GACCCAAGAAAAATTGATTGAAAAACGAATGAAAGCACAAGACATTTTAA
AAAACCAAATGGAATGCGCTGAACAGAAAAAGAAGGAAATGTTGATGAGT
AAATTACAAGAACAGATTCACGAAGAAAAAGTACTCGACAAAGTTAAACA
TGATTTGATTGAAGATAGAGCAAGGCGTTATCAGAGAGCTTTACAGAATC
GCATAAGATTGGAAAGTGAATGGGAAAAAGCAAAAGAAGAAAAGAAAGAA
AGAGATCTAATTGAAAGATTGAAAATTTCAATGCCTGACAGCACATTGCT
CCATGAACAATGCGACAAATACACTCGGTGTGCACAATGTAAAAGGAAAA
CGCAAAATATGGGTCAAAGTAACATATGGAAAGAAACGTATTTCATTCCA
GGAACTCGCTATATTTATTAGAATGATGTGTGATGTTATTTATATGATTT
AGTCGAACTTCAATTGCAACGCCTTTTGAAATGTGTGATTGTTTTATTTT
GTGCACTACTGATACTAATTCCTATTTTAGACAAGAATTTATCAAGAGCC
TAGTTAGTTTCTCTATAATAACTGGTGTAG
back to top

protein sequence of SMED30005883-orf-1

>SMED30005883-orf-1 ID=SMED30005883-orf-1|Name=SMED30005883-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MNQTFPEKITRLYNLKEIPFVYSLPQIKNGNRNLYYNSQKDSWTILEKDR
RRQNRLTYEQFLYQSFPANNYGLNDDLPEIISKHSCNKFRFSKRKKPLTE
QETNPTFENHPIYIESVNSEELSRRDFNDNDQTEQINKYNQIEEEFDTQF
KPLPTPQPPSKSFLLPEPKKPSSICSNNRPSTSASSICGHPGPFGQDLCY
VCYQREKRNVPISFAEQLKEREKEEERVIQAYQNMKDSEHLMKEQDTLLS
KKYDSQKISAFNAGVAEAIKSQQKAKDPNMYRSYLFEKRPLTPPKFIKQT
QLSSELGKQVDRKVTTRKKNEEDEAFMERLEQMQLAEDLAKQRDQYLKDK
EKSKDLYKKALDTQVTSKSLPLPKLEPDSEEPVFGKNDVTQEKLIEKRMK
AQDILKNQMECAEQKKKEMLMSKLQEQIHEEKVLDKVKHDLIEDRARRYQ
RALQNRIRLESEWEKAKEEKKERDLIERLKISMPDSTLLHEQCDKYTRCA
QCKRKTQNMGQSNIWKETYFIPGTRYIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026295Coiled-coil_dom_cont_p_81
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 214..234
NoneNo IPR availableCOILSCoilCoilcoord: 448..468
NoneNo IPR availableCOILSCoilCoilcoord: 335..355
IPR026295Coiled-coil domain-containing protein 81PANTHERPTHR14362FAMILY NOT NAMEDcoord: 177..526