Histone-lysine N-methyltransferase

Overview
NameHistone-lysine N-methyltransferase
Smed IDSMED30005879
Length (bp)4364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase (SMED30005879) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30005879) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase (SMED30005879) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30005879) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005879

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30005879SMESG000071222.1 DN309269.1ncbi_smed_estsPMID:30194301
Mihaylova et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30005879SMESG000071222.1 DN309269.1ncbi_smed_estsPMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005879SMESG000071222.1 DN309269.1ncbi_smed_estsPMID:30194301
Mihaylova et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30005879SMESG000071222.1 DN309269ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005879SMESG000071222.1 DN309269ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005879SMESG000071222.1 DN309269ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30005879SMESG000071222.1 HO004937ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005879SMESG000071222.1 HO004937ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005879SMESG000071222.1 HO004937ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 536.954 bits (1382), Expect = 1.628e-164
Identity = 311/820 (37.93%), Postives = 464/820 (56.59%), Query Frame = 2
Query: 1799 SEPKIDAINYERNHTITPIVSYTESETKLITELHPTKSQELNRNYIQLSGSF-LKRTKINGKSFSNI---HIEEAVSIASLSASKNQNTCYYCYAFL-NGISFIKKNSKLFGMDSAE-------DLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNYKK-VCDFEQYVRRRFPSEGQGDSS---------------VKP-AVVVTDSIKKRLLGLNYSYFKTEPL-------------------KTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKT---ALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            S P + ++    +H I P + Y +    L+    P  S     N  +L  S+ LK+  +     SN    + + +  IA  +A + Q  C+     L +G+    K+  L   DS E       D++FCS++C+  + S    + +  K+S  +      +  ++ TP K    Y   +   + +   + P +    +S                KP  + VT  +K RL  ++  +    PL                   K  +K   +++ +  LKK   S  KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T  +K          ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct:  734 SAPDVPSMGLVSSHRINPGLEYRQ---HLLLRGPPPGSA----NPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPS----LPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSL-KPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHT-FRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRPHTLNSTSTSK----------SFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 1524          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2D (lysine methyltransferase 2D [Source:HGNC Symbol;Acc:HGNC:7133])

HSP 1 Score: 523.857 bits (1348), Expect = 9.363e-155
Identity = 258/532 (48.50%), Postives = 347/532 (65.23%), Query Frame = 2
Query: 2513 KPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNH-PMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +PD V  D+R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET  G+LM V+ +L + + T C+ C  TGA   C R +C NVYH  CA +  C+F+ D+ M CP H +       L S  V RRV I RDE   IA ++   + + + FR G L  + IGQLLP Q+   +++S + +YPVGY +TRIYWS    N+RC Y C I E++  P F +K I+ G E+ V TD S   +W  I+  +A +R+++ + RLFP YL GE+L+GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RL+ EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 5021 RPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM-FRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5537          

HSP 2 Score: 53.1434 bits (126), Expect = 6.322e-6
Identity = 26/81 (32.10%), Postives = 32/81 (39.51%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDR-GMYCPNH 2854
            W H  CA W   V+      L  VD ++   I   C+ C   GA I C    C  +YH PCA   G         + CP H
Sbjct:  137 WAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGASIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEH 217          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 521.161 bits (1341), Expect = 7.213e-154
Identity = 295/740 (39.86%), Postives = 431/740 (58.24%), Query Frame = 2
Query: 2030 SASKNQNTCYYCYAFLNGISFIK--KNSKLFGMDSAE-------DLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNY-KKVCDFEQYVRRRFPSEGQGDSS---------------VKP-AVVVTDSIKKRLLGLNYSYFKTEPL-------------------KTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            SA+     C +C   + G    K  K+  L   DS E       D++FCS++C+  + S    + N E K +  +  Q     ++ TP K    Y   +   + +   + P +    +S                KP  + VT  +K RL  ++  +    PL                   K  +K   +++ +  LKK   S  KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T      +     + ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4190 SAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAK-NSENKESIPSLPQSP---MRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSL-KPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4911          

HSP 2 Score: 55.8398 bits (133), Expect = 9.104e-7
Identity = 26/82 (31.71%), Postives = 36/82 (43.90%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHV 2857
            W H  C  W   V +     L+ VD ++       C  C   GA I+C   KCT +YH PCA   G    ++   + CP H+
Sbjct:  250 WAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHI 331          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 521.161 bits (1341), Expect = 7.213e-154
Identity = 295/740 (39.86%), Postives = 431/740 (58.24%), Query Frame = 2
Query: 2030 SASKNQNTCYYCYAFLNGISFIK--KNSKLFGMDSAE-------DLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNY-KKVCDFEQYVRRRFPSEGQGDSS---------------VKP-AVVVTDSIKKRLLGLNYSYFKTEPL-------------------KTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            SA+     C +C   + G    K  K+  L   DS E       D++FCS++C+  + S    + N E K +  +  Q     ++ TP K    Y   +   + +   + P +    +S                KP  + VT  +K RL  ++  +    PL                   K  +K   +++ +  LKK   S  KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T      +     + ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4190 SAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAK-NSENKESIPSLPQSP---MRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSL-KPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4911          

HSP 2 Score: 55.8398 bits (133), Expect = 9.104e-7
Identity = 26/82 (31.71%), Postives = 36/82 (43.90%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHV 2857
            W H  C  W   V +     L+ VD ++       C  C   GA I+C   KCT +YH PCA   G    ++   + CP H+
Sbjct:  250 WAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHI 331          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT2C (lysine methyltransferase 2C [Source:HGNC Symbol;Acc:HGNC:13726])

HSP 1 Score: 485.723 bits (1249), Expect = 2.597e-142
Identity = 289/791 (36.54%), Postives = 438/791 (55.37%), Query Frame = 2
Query: 1799 SEPKIDAINYERNHTITPIVSYTESETKLITELHPTKSQELNRNYIQLSGSF-LKRTKINGKSFSNI---HIEEAVSIASLSASKNQNTCYYCYAFLNGISFIK--KNSKLFGMDSAE-------DLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNYKK-VCDFEQYVRRRFPSEGQGDSS---------------VKP-AVVVTDSIKKRLLGLNYSYFKTEPL-------------------KTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKT---ALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEEL 4003
            S P + ++    +H I P + Y +    L+    P  S     N  +L  S+ LK+  +     SN    + + +  IA  +A + Q  C +C   + G    K  K+  L   DS E       D++FCS++C+  + S    + +  K+S  +      +  ++ TP K    Y   +   + +   + P +    +S                KP  + VT  +K RL  ++  +    PL                   K  +K   +++ +  LKK   S  KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T  +K          ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEE+
Sbjct: 1678 SAPDVPSMGLVSSHRINPGLEYRQ---HLLLRGPPPGSA----NPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQ-WCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPS----LPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSL-KPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHT-FRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRPHTLNSTSTSK----------SFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEEV 2439          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 207.223 bits (526), Expect = 2.496e-53
Identity = 116/358 (32.40%), Postives = 185/358 (51.68%), Query Frame = 2
Query: 2450 YKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNG--CENVLTDKSCDKLWKTILNKIAKLR--QDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMR 3511
            + +I++   + +L         P  +D R CV C  +GDG+   CGRLI++    WVH+NCALW  EVFE  +G L  VD ++ +A +T C  C   GA ++C++  C   YHV CA +    F  DR   C  H  +++   +  L   RR+ + RDE+ ++  +        +  R G+ T   IG + P+QL    +++   I+P  Y  TR++WS     +R  +EC+I++ ++ P+F VK +++   C   +   S  K W+ I  K+ +LR  Q     + F   + GE L+GL E  I ++ ESLPG + I  Y  +     ++ E+PLA N  G AR EP+ RT  +  R
Sbjct: 1874 FVNIQQQHAHHILSPKIGVPHPPYHLDKRICVFCGGIGDGETTRCGRLISLTEFYWVHVNCALWSAEVFENQTGGLTNVDRAVLRAAQTACDHCKRPGASVKCHKMNCGVNYHVLCAMQNNGFFIKDRTFICKQHEKVSNQAIVGRLDALRRIYVKRDENTMLTRLFELTDGPTLCMRLGAFTFYKIGSITPKQL--KRFHTKDYIFPNNYRITRLFWSPKSHRERMMFECIIEDRNNQPIFVVKSLEDPTICYKAV---SASKAWQPIYEKVHQLREQQQGDSLKFFGSQICGETLFGLNENAITKITESLPGFDTIFTYQHRHQNSPVL-ELPLAENLMGCARAEPRNRTIGQHFR 2225          

HSP 2 Score: 176.022 bits (445), Expect = 8.924e-44
Identity = 83/154 (53.90%), Postives = 107/154 (69.48%), Query Frame = 2
Query: 3641 YKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSR---IIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            Y++++ EW++ V L+RS+I GLGL+A  D      IIEY GEIIR+EV   RE  Y A+N  +YMFR++E+ +IDAT+ GG ARYINHSC+PNC  + L    G+R   IIIT  + I   EELTYDY+F+ E    DKIPCLCG+ NC KWMN
Sbjct: 2323 YQKMRREWKDRVYLARSRIAGLGLYAKVDISMGDFIIEYKGEIIRSEVCEVREIRYVAQNRGVYMFRIDEEWVIDATMAGGPARYINHSCDPNCSTQILDAGSGAREKKIIITANRPISANEELTYDYQFELE-GTTDKIPCLCGAPNCVKWMN 2475          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 146.747 bits (369), Expect = 1.271e-35
Identity = 72/163 (44.17%), Postives = 107/163 (65.64%), Query Frame = 2
Query: 3611 TALLNSKTQQYKRLKYEWRNNVI-LSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            T+L ++    +K  + ++R  +I  +RS+I G GL+A +      MI+EY+G+ IR+ V   REK Y+ R   S Y+FR++   +IDAT  G  AR+INHSC PNC A+ L+++   RI+I +R +I++GEE+TYDYKF  ED   DKI CLCG+  CR ++N
Sbjct:  580 TSLGDANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIED---DKIDCLCGAKTCRGYLN 739          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 144.436 bits (363), Expect = 2.653e-34
Identity = 72/163 (44.17%), Postives = 107/163 (65.64%), Query Frame = 2
Query: 3611 TALLNSKTQQYKRLKYEWRNNVI-LSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            T+L ++    +K  + ++R  +I  +RS+I G GL+A +      MI+EY+G+ IR+ V   REK Y+ R   S Y+FR++   +IDAT  G  AR+INHSC PNC A+ L+++   RI+I +R +I++GEE+TYDYKF  ED   DKI CLCG+  CR ++N
Sbjct: 1348 TSLGDANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIED---DKIDCLCGAKTCRGYLN 1507          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 144.436 bits (363), Expect = 2.657e-34
Identity = 72/163 (44.17%), Postives = 107/163 (65.64%), Query Frame = 2
Query: 3611 TALLNSKTQQYKRLKYEWRNNVI-LSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            T+L ++    +K  + ++R  +I  +RS+I G GL+A +      MI+EY+G+ IR+ V   REK Y+ R   S Y+FR++   +IDAT  G  AR+INHSC PNC A+ L+++   RI+I +R +I++GEE+TYDYKF  ED   DKI CLCG+  CR ++N
Sbjct: 1351 TSLGDANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIED---DKIDCLCGAKTCRGYLN 1510          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: met-1 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:A4LBC2])

HSP 1 Score: 85.8853 bits (211), Expect = 1.986e-16
Identity = 56/180 (31.11%), Postives = 91/180 (50.56%), Query Frame = 2
Query: 3590 DNGNLNKTAL--------LNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDL-IIDATVNGGLARYINHSCNPNCVAETLSLDCG----SRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWM 4090
            DN  +N+  L        +  K Q++ + KY          +K  G GL A KD +K   IIEY+GE++  +    R+  Y A     + +  +  +  IDATV G  +R++NHSC+PN + E  S+       +R+   +++ I+ GEE+T+DY+  F +   D   C CGS +C  W+
Sbjct:  638 DNTCVNRAMLTECPSSCQVKCKNQRFAKKKYAAVEAFHTGTAK--GCGLRAVKDIKKGRFIIEYIGEVVERDDYEKRKTKYAADKKHKHHYLCDTGVYTIDATVYGNPSRFVNHSCDPNAICEKWSVPRTPGDVNRVGFFSKRFIKAGEEITFDYQ--FVNYGRDAQQCFCGSASCSGWI 813          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trr (gene:FBgn0023518 transcript:FBtr0070363)

HSP 1 Score: 504.212 bits (1297), Expect = 6.430e-149
Identity = 248/548 (45.26%), Postives = 345/548 (62.96%), Query Frame = 2
Query: 2522 LVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPM---------------------HLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNG---CENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L D R CV C   GDG  D   RL+N D D WVHLNCALW   V+ETVSG+LM   ++L+  +   C+ C++ GA I+C++S+C ++YH+PCA +  C+FY ++ ++C  H   +  +                      L SL V RRV + RDE+  +A  V    ++    R G++T  N+GQLLP QL +  +++   IYP+GY  +R YW   + N+RC+Y C I E+   P F+++  D G    E      S   +W+ IL  I +LR+     +LFP ++SGE L+GLTEP I+R++ESLPG+E + +Y FK+G+  L+ E PLAINP+G+ARTEPK R  +   + + +     C   +     N   I  +         ++SK+ QYK++K EWRNNV L+RSKIQGLGL+AA+D EK TMIIEY+GE+IR EV   REK Y+++N  IYMFRL+ED ++DAT++GGLARYINHSCNPNCV E + +D   RIII  ++ I RGEEL+YDYKFD ED ++ KIPC CG+ NCRKWMN
Sbjct: 1892 LEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVA-TVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSCSTQRMA---NSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIED-ESHKIPCACGAPNCRKWMN 2431          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trr (gene:FBgn0023518 transcript:FBtr0070362)

HSP 1 Score: 503.827 bits (1296), Expect = 6.508e-149
Identity = 248/548 (45.26%), Postives = 345/548 (62.96%), Query Frame = 2
Query: 2522 LVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPM---------------------HLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNG---CENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L D R CV C   GDG  D   RL+N D D WVHLNCALW   V+ETVSG+LM   ++L+  +   C+ C++ GA I+C++S+C ++YH+PCA +  C+FY ++ ++C  H   +  +                      L SL V RRV + RDE+  +A  V    ++    R G++T  N+GQLLP QL +  +++   IYP+GY  +R YW   + N+RC+Y C I E+   P F+++  D G    E      S   +W+ IL  I +LR+     +LFP ++SGE L+GLTEP I+R++ESLPG+E + +Y FK+G+  L+ E PLAINP+G+ARTEPK R  +   + + +     C   +     N   I  +         ++SK+ QYK++K EWRNNV L+RSKIQGLGL+AA+D EK TMIIEY+GE+IR EV   REK Y+++N  IYMFRL+ED ++DAT++GGLARYINHSCNPNCV E + +D   RIII  ++ I RGEEL+YDYKFD ED ++ KIPC CG+ NCRKWMN
Sbjct: 1871 LEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVA-TVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSCSTQRMA---NSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIED-ESHKIPCACGAPNCRKWMN 2410          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082948)

HSP 1 Score: 150.984 bits (380), Expect = 4.981e-36
Identity = 70/152 (46.05%), Postives = 102/152 (67.11%), Query Frame = 2
Query: 3638 QYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +Y+ LK  +++ V + RS I G GL+  KD E   M+IEY GE+IR+ + + RE+ Y +R    YMF+++++L++DAT+ G  AR+INH C PNC ++ + +     III   + I +GEELTYDYKF FED   +KIPC CGS  CRK++N
Sbjct: 3210 KYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFED---EKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 127.487 bits (319), Expect = 7.445e-29
Identity = 70/215 (32.56%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2525 VDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHL---PSLRVERR--------VNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKY 3136
            +D R C+ CR  G+G      RL+    D WVH NCA+W  EVFE + GSL  V S++ +     CT C   GA + C    C   YH PCA  + C F TD+ MYCP H    + +     PS+  E          V + R    LI       +  +++F  GSL +  +G ++P    S +Y +   + P+ +  +R+YWSS +  K  +Y
Sbjct: 1364 LDTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKLI-------EPARVQFHIGSLEVRQLGAIVPR--FSDSYEA---VVPINFLCSRLYWSSKEPWKIVEY 1566          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0082949)

HSP 1 Score: 150.984 bits (380), Expect = 4.981e-36
Identity = 70/152 (46.05%), Postives = 102/152 (67.11%), Query Frame = 2
Query: 3638 QYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +Y+ LK  +++ V + RS I G GL+  KD E   M+IEY GE+IR+ + + RE+ Y +R    YMF+++++L++DAT+ G  AR+INH C PNC ++ + +     III   + I +GEELTYDYKF FED   +KIPC CGS  CRK++N
Sbjct: 3210 KYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFED---EKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 127.487 bits (319), Expect = 7.445e-29
Identity = 70/215 (32.56%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2525 VDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHL---PSLRVERR--------VNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKY 3136
            +D R C+ CR  G+G      RL+    D WVH NCA+W  EVFE + GSL  V S++ +     CT C   GA + C    C   YH PCA  + C F TD+ MYCP H    + +     PS+  E          V + R    LI       +  +++F  GSL +  +G ++P    S +Y +   + P+ +  +R+YWSS +  K  +Y
Sbjct: 1364 LDTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKLI-------EPARVQFHIGSLEVRQLGAIVPR--FSDSYEA---VVPINFLCSRLYWSSKEPWKIVEY 1566          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: trx (gene:FBgn0003862 transcript:FBtr0100277)

HSP 1 Score: 150.984 bits (380), Expect = 4.981e-36
Identity = 70/152 (46.05%), Postives = 102/152 (67.11%), Query Frame = 2
Query: 3638 QYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +Y+ LK  +++ V + RS I G GL+  KD E   M+IEY GE+IR+ + + RE+ Y +R    YMF+++++L++DAT+ G  AR+INH C PNC ++ + +     III   + I +GEELTYDYKF FED   +KIPC CGS  CRK++N
Sbjct: 3210 KYRTLKETYKDYVGVFRSHIHGRGLYCTKDIEAGEMVIEYAGELIRSTLTDKRERYYDSRGIGCYMFKIDDNLVVDATMRGNAARFINHCCEPNCYSKVVDILGHKHIIIFALRRIVQGEELTYDYKFPFED---EKIPCSCGSKRCRKYLN 3358          

HSP 2 Score: 127.487 bits (319), Expect = 7.445e-29
Identity = 70/215 (32.56%), Postives = 103/215 (47.91%), Query Frame = 2
Query: 2525 VDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHL---PSLRVERR--------VNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKY 3136
            +D R C+ CR  G+G      RL+    D WVH NCA+W  EVFE + GSL  V S++ +     CT C   GA + C    C   YH PCA  + C F TD+ MYCP H    + +     PS+  E          V + R    LI       +  +++F  GSL +  +G ++P    S +Y +   + P+ +  +R+YWSS +  K  +Y
Sbjct: 1364 LDTRMCLFCRKSGEGLSGEEARLLYCGHDCWVHTNCAMWSAEVFEEIDGSLQNVHSAVARGRMIKCTVCGNRGATVGCNVRSCGEHYHYPCARSIDCAFLTDKSMYCPAHAKNGNALKANGSPSVTYESNFEVSRPVYVELDRKRKKLI-------EPARVQFHIGSLEVRQLGAIVPR--FSDSYEA---VVPINFLCSRLYWSSKEPWKIVEY 1566          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2d (lysine (K)-specific methyltransferase 2D [Source:ZFIN;Acc:ZDB-GENE-060223-2])

HSP 1 Score: 519.235 bits (1336), Expect = 1.536e-153
Identity = 257/535 (48.04%), Postives = 351/535 (65.61%), Query Frame = 2
Query: 2513 KPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMH--LPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            KPD +  D R C  C   GDG  D   RL+NID D WVHLNCALW  EV+ET  G+L+ V+ +LR+ ++T C  C +TGA   C R +C NVYH  CA +  C+F+ D+ M C  H  L  P    L S  V RRV I RDE   IA ++     + + FR G L  + +GQLLP Q+    ++S S IYPVGY +TRIYWS+   N+RC+Y C I E D  PLF+V+ +++G E++   D + D +W  I++++AKLR ++ + +LF  ++ GE++YGLT   ++R+ ESLPGVE  ++Y F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ      G +N       ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARY+NHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 2809 KPDKLPRDKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCAYCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHK-LKGPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHL-FRVGGLIFHAVGQLLPSQM--AVFHSPSAIYPVGYEATRIYWSTRVPNRRCRYRCRISEQDGRPLFEVRVLEHGYEDLHFRDSTPDGIWAKIVHQVAKLRDEAAMLKLFTEHVRGEEMYGLTVHAVMRITESLPGVESCQDYTFRYGRHPLM-ELPLMINPTGCARSEPKILTHCKRPHTLNSTSMSKA----------YQSTF--TGEINTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 3325          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 515.768 bits (1327), Expect = 2.634e-152
Identity = 250/549 (45.54%), Postives = 357/549 (65.03%), Query Frame = 2
Query: 2483 LLKKYSCSYR-KPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV----------VLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            LLKK   S R +P   D+R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ +   C  C +TGA   C+R +CTN YH  CA K  C F+ D+ M C  H           +L     L    V RRV + RDES  IA ++   +  +  FR GSL L+ +GQLLP+Q+++  ++S + I+PVGY ++RIYWS    N+RC Y C I+E+D  P F ++ ++ G ++ +LT  S   +W  +L  +A+ R ++G  RLFPVYL GE L+GLT   + R++ESLPGVE  + Y F++G+  L+ ++PLAINP+G AR+EPK  T+++R   +  T  +K       P     P    +        ++SK+ QY+R+  EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIR+EV N +EK+Y+A+N  +YMFR++ + +IDAT+ GG ARYINHSC PNC+ E ++L+ G +III++ + I+RGEEL YDYKFD ED++  KIPC CG++NCRKWMN
Sbjct: 3154 LLKKLGTSLRPEPMPKDMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGER-EHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSINENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEPKACTHIKR--PHTLTSTSKALQSPGNPAEIGVPPYSKH-------FVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCYDYKFDLEDDQ-HKIPCHCGAVNCRKWMN 3688          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 515.768 bits (1327), Expect = 2.648e-152
Identity = 250/549 (45.54%), Postives = 357/549 (65.03%), Query Frame = 2
Query: 2483 LLKKYSCSYR-KPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV----------VLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            LLKK   S R +P   D+R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ +   C  C +TGA   C+R +CTN YH  CA K  C F+ D+ M C  H           +L     L    V RRV + RDES  IA ++   +  +  FR GSL L+ +GQLLP+Q+++  ++S + I+PVGY ++RIYWS    N+RC Y C I+E+D  P F ++ ++ G ++ +LT  S   +W  +L  +A+ R ++G  RLFPVYL GE L+GLT   + R++ESLPGVE  + Y F++G+  L+ ++PLAINP+G AR+EPK  T+++R   +  T  +K       P     P    +        ++SK+ QY+R+  EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIR+EV N +EK+Y+A+N  +YMFR++ + +IDAT+ GG ARYINHSC PNC+ E ++L+ G +III++ + I+RGEEL YDYKFD ED++  KIPC CG++NCRKWMN
Sbjct: 3188 LLKKLGTSLRPEPMPKDMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGER-EHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSINENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEPKACTHIKR--PHTLTSTSKALQSPGNPAEIGVPPYSKH-------FVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCYDYKFDLEDDQ-HKIPCHCGAVNCRKWMN 3722          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2ca (lysine (K)-specific methyltransferase 2Ca [Source:ZFIN;Acc:ZDB-GENE-080520-3])

HSP 1 Score: 515.383 bits (1326), Expect = 3.731e-152
Identity = 251/551 (45.55%), Postives = 359/551 (65.15%), Query Frame = 2
Query: 2483 LLKKYSCSYR-KPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV----------VLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRR--MRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            LLKK   S R +P   D+R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ +   C  C +TGA   C+R +CTN YH  CA K  C F+ D+ M C  H           +L     L    V RRV + RDES  IA ++   +  +  FR GSL L+ +GQLLP+Q+++  ++S + I+PVGY ++RIYWS    N+RC Y C I+E+D  P F ++ ++ G ++ +LT  S   +W  +L  +A+ R ++G  RLFPVYL GE L+GLT   + R++ESLPGVE  + Y F++G+  L+ ++PLAINP+G AR+EPK  T+++R  +R +  T  +K       P     P    +        ++SK+ QY+R+  EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIR+EV N +EK+Y+A+N  +YMFR++ + +IDAT+ GG ARYINHSC PNC+ E ++L+ G +III++ + I+RGEEL YDYKFD ED++  KIPC CG++NCRKWMN
Sbjct: 4408 LLKKLGTSLRPEPMPKDMRRCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLSVRCAYCQQTGATSGCHRLRCTNAYHFTCALKAQCTFFKDKTMLCHLHRPRGTSLIGGGLLGTEHELRCFAVFRRVYVQRDESRQIASIIQRGER-EHTFRVGSLVLHAVGQLLPQQMLA--FHSMTAIFPVGYEASRIYWSMRHGNRRCHYVCSINENDGSPEFVIRVVEQGYDDLILTGSSPKGVWDKVLEPVAERRNETGFLRLFPVYLKGEDLFGLTVSAVTRIVESLPGVEACERYTFRYGRNPLM-QLPLAINPSGCARSEPKACTHIKRFVLRPHTLTSTSKALQSPGNPAEIGVPPYSKH-------FVHSKSAQYRRMNAEWKSNVYLARSRIQGLGLYAARDIEKYTMVIEYIGTIIRSEVANRKEKMYEAQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCITEVVALERGHKIIISSNRRIQRGEELCYDYKFDLEDDQ-HKIPCHCGAVNCRKWMN 4946          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt2cb (lysine (K)-specific methyltransferase 2Cb [Source:ZFIN;Acc:ZDB-GENE-070705-340])

HSP 1 Score: 441.039 bits (1133), Expect = 2.138e-127
Identity = 230/550 (41.82%), Postives = 330/550 (60.00%), Query Frame = 2
Query: 2486 LKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNH--------VVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNN---YQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            LK+ + S R P L   D R C  C+ +GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V  + ++     C  C   GA   C+R +C N+YH  CA + GC F+ D+ M C  H          L+    L    V RRV + RDE   +A  V + +     FR GSL  + +GQL P  + +  ++S + I+P GY +TR+YWS     KRC+Y C ++E +    F ++ I+ G E+ VLTD S   +W+ +L  +A+ R ++G+ RLFP+YL GE L+GLT   + R+ ESLPGVE    Y F++G+  L+  +PL++N +GSAR+E  L+TY +  R           IL + P  +       +  + + +    ++SK+ QY+RL  +W++NV L+ S+IQGLGLFAA+  EK TM+IEY+G+I+R EV   RE LY+A+N   YMF ++ + +IDAT +G  ARYINHSC+PNCVAE ++ + G +III+    IERGEEL YDYK     N   KIPC CG+  CRKW+N
Sbjct: 4347 LKQLTTSLR-PCLTIRDQRRCCFCQQIGDGMTDGPARLLNLDLDTWVHLNCALWSSEVYETQAGALINVGLARQRGQTVVCAFCQRLGATSGCHRLRCLNIYHFTCALQAGCTFFKDKTMLCHQHRPRGAGAAAGLHVEHQLRCFSVFRRVYVQRDELRQLAAAVQQPERGH-TFRVGSLLFHAMGQLPPALMPT--FHSSTAIFPPGYEATRLYWSMRHGQKRCRYVCSVEEHEGRAEFSIRVIEQGYEDLVLTDTSAKGVWEKVLGPVAERRAETGMLRLFPIYLKGEDLFGLTISAVTRIAESLPGVEACSRYRFRYGRNPLLV-LPLSMNSSGSARSE--LQTYPQHER---------VKILSSWPRISRCIQNSTVAASASSHSKHFVHSKSSQYRRLASDWKSNVYLAHSRIQGLGLFAARAIEKQTMVIEYMGDILRTEVAMRRELLYKAKNRPAYMFCIDSERVIDATNSGSPARYINHSCSPNCVAEVVTFERGYKIIISAACRIERGEELCYDYKLT-PVNDQSKIPCHCGAAKCRKWIN 4879          

HSP 2 Score: 56.6102 bits (135), Expect = 2.787e-7
Identity = 27/84 (32.14%), Postives = 36/84 (42.86%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHVVL 2863
            W H +CALW   V +    SL+ VD ++       C  C   GA I+C    C   YH PC    G    +  R + C  H+ L
Sbjct:  239 WAHQSCALWSNFVCQAEDQSLLYVDKAIHSGSTEHCAYCKRLGASIKCCEEGCDRSYHYPCVGAAGTFQDFRRRSVLCTEHIEL 322          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: rab9b (RAB9B, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-491211])

HSP 1 Score: 532.717 bits (1371), Expect = 8.204e-158
Identity = 255/531 (48.02%), Postives = 357/531 (67.23%), Query Frame = 2
Query: 2516 PDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            P   D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M C  H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+   N++S + ++PVG+ ++R+YWS    N+RC+Y C I+E+D +PLF V+ I+ G E  VL D S   +W  IL  +A  R+ S + RLFPV+L GE LYGLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLAINP+GSAR+EPK+ ++V+R      T      +     + ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ + +IDAT+ GG ARYINHSC PNCVAE ++ + G RIII++ + I++GEEL+YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4010 PLCKDYRKCCFCHEEGDGLTDGSARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCGFCHKTGATSSCHRLRCTNIYHFTCAIKAQCMFFKDKTMLCTMHKPKGLHEQELTYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHAIGQLLPQQM--QNFHSATALFPVGFEASRLYWSMRYANRRCRYLCSIEENDGLPLFVVRVIEPGHEELVLMDSSLKGVWDKILEPVANCRKGSEILRLFPVFLKGEDLYGLTASAVTRIAESLPGVEACENYTFRYGRNPLM-ELPLAINPSGSARSEPKMNSHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNEHVIDATLTGGPARYINHSCAPNCVAEVVTFEKGHRIIISSNRRIQKGEELSYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4527          

HSP 2 Score: 58.9214 bits (141), Expect = 1.014e-7
Identity = 28/84 (33.33%), Postives = 36/84 (42.86%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRG---MYCPNHV 2857
            W HL CA W   V +     L+ VD ++       C  C   GA I+C    CT  YH PCA   G   + D     + CP H+
Sbjct:  147 WAHLRCAQWSPGVHQNEEQELVSVDKAVLSGSTERCAYCKHLGATIKCCEETCTQTYHYPCAAGAGT--FQDLNCLTLLCPEHI 228          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 498.819 bits (1283), Expect = 1.733e-146
Identity = 255/526 (48.48%), Postives = 346/526 (65.78%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHP--MHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D+R C  C   GDG  D  GRL+N+D D WVHLNCALW  EV+ET  G+L+ V+ +L + + T C+ C +TGA   C R +C NVYH  CA +  C+F+ D+ M CP H  L  P    L    V RRV I RDE + IA ++     + + FR G L  + IGQLLP Q+   +++S + +YPVGY STRIYWS    ++RC Y C + +++  P F V+ I+ G E+V LTD S   LW  +   +A++R+++G+ RLFP YL GE+++GLT   ++R+ ESLPGVE  +NY F++GK  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+A+KD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 3836 DLRKCCFCHEEGDGPTDGPGRLLNLDLDLWVHLNCALWSTEVYETQGGALINVEVALHRGLLTKCSLCQKTGATNSCNRLRCPNVYHFACAIRAKCMFFKDKTMLCPMHK-LKGPCEQELSCFTVFRRVYIERDEISQIASIIQRGDRIHM-FRVGGLVFHAIGQLLPHQM--QDFHSVTALYPVGYESTRIYWSMRHSHRRCCYRCRVCDNNGRPEFTVQVIEYGYEDVILTDSSPQALWNRVAEPVARMRRETGMLRLFPEYLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLM-ELPLMINPTGCARSEPKIMTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 4345          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 498.049 bits (1281), Expect = 3.873e-146
Identity = 255/526 (48.48%), Postives = 345/526 (65.59%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHP--MHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN-KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D+R C  C   GDG  D  GRL+N+D D WVHLNCALW  EV+ET  G+L+ V+ +L + + T C+ C +TGA   C R +C NVYH  CA +  C+F+ D+ M CP H  L  P    L    V RRV I RDE + IA ++     + + FR G L  + IGQLLP Q+   +++S + +YPVGY STRIYWS    ++RC Y C + +++  P F V+ I+ G E+V LTD S   LW  +   +A++R+++G+ RLFP YL GE+++GLT   ++R+ ESLPGVE  +NY F++GK  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N       ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+A+KD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 3915 DLRKCCFCHEEGDGPTDGPGRLLNLDLDLWVHLNCALWSTEVYETQGGALINVEVALHRGLLTKCSLCQKTGATNSCNRLRCPNVYHFACAIRAKCMFFKDKTMLCPMHK-LKGPCEQELSCFTVFRRVYIERDEISQIASIIQRGDRIHM-FRVGGLVFHAIGQLLPHQM--QDFHSVTALYPVGYESTRIYWSMRHSHRRCCYRCRVCDNNGRPEFTVQVIEYGYEDVILTDSSPQALWNRVAEPVARMRRETGMLRLFPEYLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLM-ELPLMINPTGCARSEPKIMTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 4424          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 447.203 bits (1149), Expect = 2.785e-129
Identity = 232/496 (46.77%), Postives = 320/496 (64.52%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHP--MHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEEL 4003
            D+R C  C   GDG  D  GRL+N+D D WVHLNCALW  EV+ET  G+L+ V+ +L + + T C+ C +TGA   C R +C NVYH  CA +  C+F+ D+ M CP H  L  P    L    V RRV I RDE + IA ++     + + FR G L  + IGQLLP Q+   +++S + +YPVGY STRIYWS    ++RC Y C + +++  P F V+ I+ G E+V LTD S   LW  +   +A++R+++G+ RLFP YL GE+++GLT   ++R+ ESLPGVE  +NY F++GK  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+A+KD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEE+
Sbjct: 5285 DLRKCCFCHEEGDGPTDGPGRLLNLDLDLWVHLNCALWSTEVYETQGGALINVEVALHRGLLTKCSLCQKTGATNSCNRLRCPNVYHFACAIRAKCMFFKDKTMLCPMHK-LKGPCEQELSCFTVFRRVYIERDEISQIASIIQRGDRIHM-FRVGGLVFHAIGQLLPHQM--QDFHSVTALYPVGYESTRIYWSMRHSHRRCCYRCRVCDNNGRPEFTVQVIEYGYEDVILTDSSPQALWNRVAEPVARMRRETGMLRLFPEYLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLM-ELPLMINPTGCARSEPKIMTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEEV 5765          

HSP 2 Score: 57.3806 bits (137), Expect = 2.547e-7
Identity = 25/66 (37.88%), Postives = 30/66 (45.45%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVG 2812
            W H  CA W   V       L+ VD ++   I   C  CN  GA IQC+ + C   YH PCA   G
Sbjct:   91 WAHHWCASWSAGVIHVEGTGLINVDKAVYSGISQKCEYCNRMGATIQCHSTGCLRRYHFPCAAASG 156          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: c1orf50 (chromosome 1 open reading frame 50 [Source:Xenbase;Acc:XB-GENE-1004912])

HSP 1 Score: 380.563 bits (976), Expect = 3.579e-119
Identity = 206/423 (48.70%), Postives = 280/423 (66.19%), Query Frame = 2
Query: 2837 MYCPNHVVLNHP--MHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKT-ALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            M CP H  L  P    L    V RRV I RDE + IA ++     + + FR G L  + IGQLLP Q+   +++S + +YPVGY STRIYWS    ++RC Y C + +++  P F V+ I+ G E+V LTD S   LW  +   +A++R+++G+ RLFP YL GE+++GLT   ++R+ ESLPGVE  +NY F++GK  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+A+KD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct:    1 MLCPMHK-LKGPCEQELSCFTVFRRVYIERDEISQIASIIQRGDRIHM-FRVGGLVFHAIGQLLPHQM--QDFHSVTALYPVGYESTRIYWSMRHSHRRCCYRCRVCDNNGRPEFTVQVIEYGYEDVILTDSSPQALWNRVAEPVARMRRETGMLRLFPEYLKGEEMFGLTVHAVLRIAESLPGVENCQNYLFRYGKHPLM-ELPLMINPTGCARSEPKIMTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYASKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 407          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 528.865 bits (1361), Expect = 1.263e-161
Identity = 287/709 (40.48%), Postives = 419/709 (59.10%), Query Frame = 2
Query: 2084 ISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSVECNLEKKS-------------------TNNT---NVQC-TKVLIKITP-YKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKP-----AVVVTD--SIKKRLLGLNYSYFKTE---PLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKT---ALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            ++F+ K S+       +D++FCS++C+  + S    + +  K+S                   +NN    +V C  +   K++P   P  ++     FE       P E +    +KP      V + D   + K+  G+ +  +      P  T     E      L K  +C    P   D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T  N     K+     +Q  +   G LN       ++SK+ QY+R+K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct:  831 LTFVNKGSRENTKRMEKDIVFCSNNCFILYSSAAQAKNSDNKESLPSLPQSPMKEPSKAFHQYSNNISTLDVHCLPQFQEKVSPPASPPISFPPA--FEAAKVESKPDELKVTVKLKPRLRTVPVGLEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTCLKPDPVPKDCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHT-FRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT-LNSTSTSKS-----FQSTV--TGELNAPYSKQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 1524          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 532.332 bits (1370), Expect = 2.375e-161
Identity = 286/709 (40.34%), Postives = 419/709 (59.10%), Query Frame = 2
Query: 2084 ISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSVECNLEKKS-------------------TNNT---NVQC-TKVLIKITP-YKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKP-----AVVVTD--SIKKRLLGLNYSYFKTE---PLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKT---ALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            ++F+ K S+       +D++FCS++C+  + S    + +  K+S                   +NN    +V C  +   K++P   P  ++     FE       P E +    +KP      V + D   + K+  G+ +  +      P  T     E      L K  +C    P   D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T  +K          ++Q  +   G LN       ++SK+ QY+R+K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 1059 LTFVNKGSRENTKRMEKDIVFCSNNCFILYSSAAQAKNSDNKESLPSLPQSPMKEPSKAFHQYSNNISTLDVHCLPQFQEKVSPPASPPISFPPA--FEAAKVESKPDELKVTVKLKPRLRTVPVGLEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTCLKPDPVPKDCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDHT-FRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRPHTLNSTSTSK----------SFQSTV--TGELNAPYSKQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 1748          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2c (lysine (K)-specific methyltransferase 2C [Source:MGI Symbol;Acc:MGI:2444959])

HSP 1 Score: 526.554 bits (1355), Expect = 8.266e-156
Identity = 286/711 (40.23%), Postives = 420/711 (59.07%), Query Frame = 2
Query: 2084 ISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSVECNLEKKS-------------------TNNT---NVQC-TKVLIKITP-YKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKPAVVVTD-------SIKKRLLGLNYSYFKTE---PLKTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            ++F+ K S+       +D++FCS++C+  + S    + +  K+S                   +NN    +V C  +   K++P   P  ++     FE       P E +    +KP +            + K+  G+ +  +      P  T     E      L K  +C   KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T      +     + ++Q  +   G LN       ++SK+ QY+R+K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4211 LTFVNKGSRENTKRMEKDIVFCSNNCFILYSSAAQAKNSDNKESLPSLPQSPMKEPSKAFHQYSNNISTLDVHCLPQFQEKVSPPASPPISFPPA--FEAAKVESKPDELKVTVKLKPRLRTVPVGLEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTC--LKPDPVPKDCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4904          

HSP 2 Score: 55.8398 bits (133), Expect = 5.283e-7
Identity = 25/82 (30.49%), Postives = 36/82 (43.90%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHV 2857
            W H  C  W   + +     L+ VD ++       C  C   GA I+C   KCT +YH PCA   G    ++   + CP H+
Sbjct:  249 WAHHRCVEWSLGICQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHI 330          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 520.39 bits (1339), Expect = 8.392e-154
Identity = 255/525 (48.57%), Postives = 342/525 (65.14%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNH-PMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET  G+LM V+ +L + + T C+ C  TGA   C R +C NVYH  CA +  C+F+ D+ M CP H +       L S  V RRV I RDE   IA ++   + + + FR G L  + IGQLLP Q+   +++S + +YPVGY +TRIYWS    N+RC Y C I E++  P F +K I+ G E+ V TD S   +W  I+  +A +R+++ + RLFP YL GE+L+GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RL+ EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM-FRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSISENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5588          

HSP 2 Score: 52.373 bits (124), Expect = 6.499e-6
Identity = 25/81 (30.86%), Postives = 33/81 (40.74%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDR-GMYCPNH 2854
            W H  CA W   V+      L  VD ++   I   C+ C   GA + C    C+ +YH PCA   G         + CP H
Sbjct:  137 WAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCARFGASVPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEH 217          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt2d (lysine (K)-specific methyltransferase 2D [Source:MGI Symbol;Acc:MGI:2682319])

HSP 1 Score: 520.39 bits (1339), Expect = 8.392e-154
Identity = 255/525 (48.57%), Postives = 342/525 (65.14%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNH-PMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET  G+LM V+ +L + + T C+ C  TGA   C R +C NVYH  CA +  C+F+ D+ M CP H +       L S  V RRV I RDE   IA ++   + + + FR G L  + IGQLLP Q+   +++S + +YPVGY +TRIYWS    N+RC Y C I E++  P F +K I+ G E+ V TD S   +W  I+  +A +R+++ + RLFP YL GE+L+GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RL+ EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM-FRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSISENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5588          

HSP 2 Score: 52.373 bits (124), Expect = 6.499e-6
Identity = 25/81 (30.86%), Postives = 33/81 (40.74%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDR-GMYCPNH 2854
            W H  CA W   V+      L  VD ++   I   C+ C   GA + C    C+ +YH PCA   G         + CP H
Sbjct:  137 WAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCARFGASVPCRSPGCSRLYHFPCATASGSFLSMKTLQLLCPEH 217          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8BRH4|KMT2C_MOUSE (Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2)

HSP 1 Score: 526.554 bits (1355), Expect = 5.728e-155
Identity = 286/711 (40.23%), Postives = 420/711 (59.07%), Query Frame = 2
Query: 2084 ISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSVECNLEKKS-------------------TNNT---NVQC-TKVLIKITP-YKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKPAVVVTD-------SIKKRLLGLNYSYFKTE---PLKTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            ++F+ K S+       +D++FCS++C+  + S    + +  K+S                   +NN    +V C  +   K++P   P  ++     FE       P E +    +KP +            + K+  G+ +  +      P  T     E      L K  +C   KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T      +     + ++Q  +   G LN       ++SK+ QY+R+K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4210 LTFVNKGSRENTKRMEKDIVFCSNNCFILYSSAAQAKNSDNKESLPSLPQSPMKEPSKAFHQYSNNISTLDVHCLPQFQEKVSPPASPPISFPPA--FEAAKVESKPDELKVTVKLKPRLRTVPVGLEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTC--LKPDPVPKDCRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCATKAQCMFFKDKTMLCPMHKPKGIHEQQLSYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDSSPKDVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4903          

HSP 2 Score: 55.8398 bits (133), Expect = 3.695e-6
Identity = 25/82 (30.49%), Postives = 36/82 (43.90%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHV 2857
            W H  C  W   + +     L+ VD ++       C  C   GA I+C   KCT +YH PCA   G    ++   + CP H+
Sbjct:  249 WAHHRCVEWSLGICQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFSHFFLLCPEHI 330          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|O14686|KMT2D_HUMAN (Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2)

HSP 1 Score: 523.857 bits (1348), Expect = 4.496e-154
Identity = 258/532 (48.50%), Postives = 347/532 (65.23%), Query Frame = 2
Query: 2513 KPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNH-PMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +PD V  D+R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET  G+LM V+ +L + + T C+ C  TGA   C R +C NVYH  CA +  C+F+ D+ M CP H +       L S  V RRV I RDE   IA ++   + + + FR G L  + IGQLLP Q+   +++S + +YPVGY +TRIYWS    N+RC Y C I E++  P F +K I+ G E+ V TD S   +W  I+  +A +R+++ + RLFP YL GE+L+GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RL+ EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 5021 RPDKVPRDMRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM-FRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5537          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8NEZ4|KMT2C_HUMAN (Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3)

HSP 1 Score: 521.161 bits (1341), Expect = 3.464e-153
Identity = 295/740 (39.86%), Postives = 431/740 (58.24%), Query Frame = 2
Query: 2030 SASKNQNTCYYCYAFLNGISFIK--KNSKLFGMDSAE-------DLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNY-KKVCDFEQYVRRRFPSEGQGDSS---------------VKP-AVVVTDSIKKRLLGLNYSYFKTEPL-------------------KTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLN-HPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            SA+     C +C   + G    K  K+  L   DS E       D++FCS++C+  + S    + N E K +  +  Q     ++ TP K    Y   +   + +   + P +    +S                KP  + VT  +K RL  ++  +    PL                   K  +K   +++ +  LKK   S  KPD V  D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ +LR+ ++  C  C++TGA   C+R +CTN+YH  CA K  C+F+ D+ M CP H     H   L    V RRV + RDE   IA +V   +     FR GSL  + IGQLLP+Q+ +  ++S   ++PVGY ++R+YWS+   N+RC+Y C I+E D  P+F ++ ++ G E+ VL+D S   +W  IL  +A +R+ S + +LFP YL GE L+GLT   + R+ ESLPGVE  +NY F++G+  L+ E+PLA+NPTG AR+EPK+  +V+R      T      +     + ++Q  +   G LN       ++SK+ QY+++K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIRNEV N +EKLY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ + G +III++ + I++GEEL YDYKFDFED++  KIPC CG++NCRKWMN
Sbjct: 4190 SAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAK-NSENKESIPSLPQSP---MRETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTSL-KPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDH-TFRVGSLIFHTIGQLLPQQMQA--FHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLM-ELPLAVNPTGCARSEPKMSAHVKRFVLRPHT------LNSTSTSKSFQSTV--TGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQ-HKIPCHCGAVNCRKWMN 4911          

HSP 2 Score: 55.8398 bits (133), Expect = 4.372e-6
Identity = 26/82 (31.71%), Postives = 36/82 (43.90%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIF-YTDRGMYCPNHV 2857
            W H  C  W   V +     L+ VD ++       C  C   GA I+C   KCT +YH PCA   G    ++   + CP H+
Sbjct:  250 WAHHRCVEWSLGVCQMEEPLLVNVDKAVVSGSTERCAFCKHLGATIKCCEEKCTQMYHYPCAAGAGTFQDFSHIFLLCPEHI 331          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q6PDK2|KMT2D_MOUSE (Histone-lysine N-methyltransferase 2D OS=Mus musculus OX=10090 GN=Kmt2d PE=1 SV=2)

HSP 1 Score: 520.39 bits (1339), Expect = 5.870e-153
Identity = 255/525 (48.57%), Postives = 342/525 (65.14%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNH-PMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA-LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D R C  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET  G+LM V+ +L + + T C+ C  TGA   C R +C NVYH  CA +  C+F+ D+ M CP H +       L S  V RRV I RDE   IA ++   + + + FR G L  + IGQLLP Q+   +++S + +YPVGY +TRIYWS    N+RC Y C I E++  P F +K I+ G E+ V TD S   +W  I+  +A +R+++ + RLFP YL GE+L+GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ       N   +   ++SK+ QY+RL+ EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARYINHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 5079 DNRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPVHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQRGERLHM-FRVGGLVFHAIGQLLPHQM--ADFHSATALYPVGYEATRIYWSLRTNNRRCCYRCSISENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLM-ELPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKA----------YQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5588          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q8IRW8|TRR_DROME (Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2)

HSP 1 Score: 504.212 bits (1297), Expect = 6.445e-148
Identity = 248/548 (45.26%), Postives = 345/548 (62.96%), Query Frame = 2
Query: 2522 LVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPM---------------------HLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNG---CENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L D R CV C   GDG  D   RL+N D D WVHLNCALW   V+ETVSG+LM   ++L+  +   C+ C++ GA I+C++S+C ++YH+PCA +  C+FY ++ ++C  H   +  +                      L SL V RRV + RDE+  +A  V    ++    R G++T  N+GQLLP QL +  +++   IYP+GY  +R YW   + N+RC+Y C I E+   P F+++  D G    E      S   +W+ IL  I +LR+     +LFP ++SGE L+GLTEP I+R++ESLPG+E + +Y FK+G+  L+ E PLAINP+G+ARTEPK R  +   + + +     C   +     N   I  +         ++SK+ QYK++K EWRNNV L+RSKIQGLGL+AA+D EK TMIIEY+GE+IR EV   REK Y+++N  IYMFRL+ED ++DAT++GGLARYINHSCNPNCV E + +D   RIII  ++ I RGEEL+YDYKFD ED ++ KIPC CG+ NCRKWMN
Sbjct: 1892 LEDTRQCVFCNQRGDGQADGPSRLLNFDVDKWVHLNCALWSNGVYETVSGALMNFQTALQAGLSQACSACHQPGATIKCFKSRCNSLYHLPCAIREECVFYKNKSVHCSVHGHAHAGITMGAGAGATTGAGLGGSVADNELSSLVVHRRVFVDRDENRQVA-TVMHYSELSNLLRVGNMTFLNVGQLLPHQLEA--FHTPHYIYPIGYKVSRYYWCVRRPNRRCRYICSIAEAGCKPEFRIQVQDAGDKEPEREFRGSSPSAVWQQILQPITRLRKVHKWLQLFPQHISGEDLFGLTEPAIVRILESLPGIETLTDYRFKYGRNPLL-EFPLAINPSGAARTEPKQRQLLVWRKPHTQRTAGSCSTQRMA---NSAAIAGEVACPYSKQFVHSKSSQYKKMKQEWRNNVYLARSKIQGLGLYAARDIEKHTMIIEYIGEVIRTEVSEIREKQYESKNRGIYMFRLDEDRVVDATLSGGLARYINHSCNPNCVTEIVEVDRDVRIIIFAKRKIYRGEELSYDYKFDIED-ESHKIPCACGAPNCRKWMN 2431          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A430QCR3 (Histone-lysine N-methyltransferase MLL3 OS=Schistosoma bovis OX=6184 GN=DC041_0006177 PE=4 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 331/763 (43.38%), Postives = 468/763 (61.34%), Query Frame = 2
Query: 1970 INGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFK--------SYHSVECNLEKKSTNNTNVQCTKVLIKIT----PYKPAKNYKKVCDFEQYVR-RRFPSEGQGDSSVKPAVVVTDSIKK-------RLLG----LNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV--VLNHPMHLPSLRVERRVNILRDESALIAGMVTED---------QDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDES---DDM------PL---FKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKC------GILKAKPNNNYQPIIYDNGNLNK-TALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            I G + +  + EE +    L+   ++ TC YC      I   +K  K    D    L FCSSSC +  K        S+     N +   T  + ++   ++I +     P +  ++ K++   +  V  +R P+E    +S +    V+ ++K+       RL+G     +++  ++        D+  + ++ L KK+SC       +D R C LC  +GDG  D+  RL+N + D W+HLNC LWC+E +ETVSGSLM+V  S  KA KT CT C   GAG+ C+ S C  VYH+PCAY++ C F+ DRGMYCP H+    N P HL SL VER+V I RDE + +  +++++         ++ K+K R G+L L+ IGQLLPEQL SG +++ + IYPVGY ++RIYWS   + +RC+Y+C I++S   DD+      P+   F V+ I+   E +   D +CD +W+ I+N+I   R+ S L R+    + GE LYGLTEP IIR IESLPGV+ + NY FKFGK+QLI EMPLAINPTGSAR+EPKLRTY+RR         N C       +    P + Y   I     LN  +  + SK+QQY+RL+++W+ NV+L+RS+IQGLGL+AA+D  KST IIEYLGE+IRNEV N RE+LY+++N  IYMFR+++D I+DAT++GGLARYINHSC+PNC AE L  D  + I+I   + IE+G+ELTYDYKFD E+++ D+IPCLCGSINCRKWMN
Sbjct:  693 ITGHNSNQKYCEEVILCNRLNGETHE-TCSYCKM---QIMLPQKTFKWKSHDKESYLPFCSSSCLARLKRQGPNCMTSFVPDASNFDIPFTVTSTIESQPLIILLVKSNHPKRMKQSSKRLSSQDLQVNFKRSPNE----TSNRMLFGVSSTVKRWRNIRWRRLIGSPPVCSFNVLRSS------SDLPMSQKSFLSKKFSC-------IDTRVCQLCHQIGDGSNDVTSRLLNYNTDKWLHLNCILWCYETYETVSGSLMDVPCSSEKASKTPCTYCKNLGAGLPCFDSDCQAVYHLPCAYQINCSFHPDRGMYCPLHLKSASNIP-HLDSLAVERKVYISRDEHSQVEKIISDEDHFTSMQNVKEPKLKLRIGTLILHRIGQLLPEQLASGVFHTSNFIYPVGYWTSRIYWSFRHVGQRCRYDCRIEDSVRPDDVNQSLVDPILVKFTVEVIEPNEEKIFFEDTTCDGVWRKIINRINSSRKCSSLFRILQDNIQGEVLYGLTEPHIIRAIESLPGVDRLSNYLFKFGKLQLIQEMPLAINPTGSARSEPKLRTYIRRK---STGDVNTCTYIAHNHVFLETPGHPYSSDIGSPTYLNSLSPSMTSKSQQYRRLRWDWKTNVVLARSRIQGLGLYAARDISKSTFIIEYLGEVIRNEVANRRERLYESQNRGIYMFRVDDDWIVDATMSGGLARYINHSCDPNCTAEILHCDNSNHIVIIASKNIEKGDELTYDYKFDLEEDRWDRIPCLCGSINCRKWMN 1430          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183PG38 (Histone-lysine N-methyltransferase OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS13324 PE=4 SV=1)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 334/763 (43.77%), Postives = 467/763 (61.21%), Query Frame = 2
Query: 1970 INGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFK--------SYHSVECNLEKKSTNNTNVQCTKVLIKIT---PYKPAKNYKKVCDFEQYVR-RRFPSEGQGDSSVKPAVVVTDSIKK-------RLLGLNYSYFKTEPLKTI-----YKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV--VLNHPMHLPSLRVERRVNILRDESALIAGMVTED------QDVK---IKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDES---DDM------PL---FKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKC------GILKAKPNNNYQPIIYDNGNLNK-TALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            I G + +  + EE +    L+   +  TC YC      I   +K  K    D    L FCSSSC +  K        S+     N +   T  + ++   ++I +    P +  ++ K++   +  V  +R P+E    +S +    V+ ++K+       RL+G       + P+ +        D+  + ++ L KK+SC       +D R C LC  +GDG  D+  RL+N D D W+HLNC LWC+E +ETVSGSLM+V  S  KA KT CT C   GAG+ C+ S C  VYH+PCAY++ C F+ DRGMYCP H+    N P HL SL VER+V I RDE + +  +++++      Q+VK   +K R G+L L+ IGQLLPEQL SG +++ + IYPVGY ++RIYWS   + +RC+Y+C I++S   DD+      P+   F V+ I+   E +   D +CD +W+ I+N+I   R+ S  +R+    + GE LYGLTEP IIR IESLPGV+ + NY FKFGK+QLI EMPLAINPTGSAR+EPKLRTY+RR         N C       +    P + Y   I     LN  +  + SK+QQY+RL+++W+ NV+L+RS+IQGLGL+AA+D  KST IIEYLGE+IRNEV N RE+LY+++N  IYMFR+++D I+DAT++GGLARYINHSC+PNC AE L  D  + I+I   + IE+G+ELTYDYKFD E+++ D+IPCLCGSINCRKWMN
Sbjct:  693 ITGHNSNQKYCEEVILCNRLNGEAHA-TCSYCKM---QIMLPQKTFKWKSHDKESCLPFCSSSCLARLKRQGPNCMTSFVPDASNFDIPFTVTSTIESQPLIILVKSNHPKRMKQSSKRLSSQDLQVNFKRSPNE----TSNRMLFGVSSTVKRWRNIRWRRLIG-------SPPVCSFNVLQSSSDLPMSQKSFLSKKFSC-------IDTRVCQLCHQIGDGSNDVTSRLLNYDTDKWLHLNCILWCYETYETVSGSLMDVPCSSEKASKTPCTYCKNLGAGLPCFDSDCQAVYHLPCAYQINCSFHPDRGMYCPLHLKSTSNIP-HLDSLVVERKVYISRDEHSQVEKIISDEDHFNSMQNVKGPKLKLRIGTLILHRIGQLLPEQLASGVFHTSNFIYPVGYWTSRIYWSFRHVGQRCRYDCRIEDSVRPDDVNRSLVDPILVKFTVEVIEPNEEKIFFEDTTCDGVWRKIINRINSSRKCSSFSRILQDNIQGEVLYGLTEPHIIRAIESLPGVDRLSNYLFKFGKLQLIQEMPLAINPTGSARSEPKLRTYIRRK---STGDVNTCPYIAHNHVFLETPGHPYSSDIGSPTYLNSLSPGMTSKSQQYRRLRWDWKTNVVLARSRIQGLGLYAARDISKSTFIIEYLGEVIRNEVANRRERLYESQNRGIYMFRVDDDWIVDATMSGGLARYINHSCDPNCTAEILHCDNSNHIVIIASKNIEKGDELTYDYKFDLEEDRWDRIPCLCGSINCRKWMN 1429          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183JHW1 (Histone-lysine N-methyltransferase OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2285 PE=4 SV=1)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 330/763 (43.25%), Postives = 467/763 (61.21%), Query Frame = 2
Query: 1970 INGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFK--------SYHSVECNLEKKSTNNTNVQCTKVLIKIT----PYKPAKNYKKVCDFEQYVR-RRFPSEGQGDSSVKPAVVVTDSIKK-------RLLG----LNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV--VLNHPMHLPSLRVERRVNILRDESALIAGMVTED---------QDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDES---DDM------PL---FKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKC------GILKAKPNNNYQPIIYDNGNLNK-TALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            I G + +  + EE +    L+   ++ TC YC      I   +K  K    D    L FCSSSC +  K        S+ +   N +   T    ++   ++I +     P +  ++ K++   +  V  +R P+E    +S +    V+ ++K+       RL+G     +++  ++        D+  + ++ L KK+SC       +D R C LC  +GDG  D+  RL+N + D W+HLNC LWC+E +ETVSGSLM+V  S  KA KT CT C   GAG+ C+ S C  VYH+PCAY++ C F+ DRGMYCP H+    N P HL SL VER+V I RDE + +  +++++         ++ K+K R G+L L+ IGQLLPEQL SG +++ + IYPVGY ++RIYWS   + +RC+Y+C I++S   DD+      P+   F V+ I+   E +   D +CD +W+ I+N+I   R+ S   R+    + GE LYGLTEP IIR IESLPGV+ + NY FKFGK+QLI EMPLAINPTGSAR+EPKLRTY+RR         N C       +    P + Y   I     LN  +  + SK+QQY+RL+++W+ NV+L+RS+IQGLGL+AA+D  KST IIEYLGE+IRNEV N RE+LY+++N  IYMFR+++D I+DAT++GGLARYINHSC+PNC AE L  D  + I+I   + IE+G+ELTYDYKFD E+++ D+IPCLCGSINCRKWMN
Sbjct:  693 ITGHNSNQKYCEEVILCNRLNGEAHE-TCSYCKM---QIMLPQKTFKWKSHDKESYLPFCSSSCLARLKRQGPNCMTSFVTDANNFDSPITVTPTIESQPLIILLVKSNHPKRMKQSSKRLSSQDLQVNFKRSPNE----TSNRMLFGVSSTVKRWRNIRWRRLIGSPPVCSFNVLRSS------SDLPMSQKSFLSKKFSC-------IDTRVCQLCHQIGDGSNDVTSRLLNYNTDKWLHLNCILWCYETYETVSGSLMDVPCSSEKASKTPCTYCKNLGAGLPCFDSDCQAVYHLPCAYQINCSFHPDRGMYCPLHLKSASNIP-HLDSLAVERKVYISRDEHSQVEKIISDEDHFTSMQNVKEPKLKLRIGTLILHRIGQLLPEQLASGVFHTSNFIYPVGYWTSRIYWSFRHVGQRCRYDCRIEDSVRPDDVNQSLVDPILVKFTVEVIEPNEEKIFFEDTTCDGVWRKIINRINSSRKCSSFFRILQDNIQGEVLYGLTEPHIIRAIESLPGVDRLSNYLFKFGKLQLIQEMPLAINPTGSARSEPKLRTYIRRK---STGDVNTCPYIAHNHVFLETPGHPYSSDIGSPTYLNSLSPSMTSKSQQYRRLRWDWKTNVVLARSRIQGLGLYAARDISKSTFIIEYLGEVIRNEVANRRERLYESQNRGIYMFRVDDDWIVDATMSGGLARYINHSCDPNCTAEILHCDNSNHIVIIASKNIEKGDELTYDYKFDLEEDRWDRIPCLCGSINCRKWMN 1430          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183AN65 (Histone-lysine N-methyltransferase OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS8400 PE=4 SV=1)

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 299/592 (50.51%), Postives = 397/592 (67.06%), Query Frame = 2
Query: 2426 KTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNH--VVLNHPMHLPSLRVERRVNILRDESALIAGMVTE----------DQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDM--------------PLFKVKFIDNG-CENVLTDKSCDKLWKTILNKIAKLRQ--DSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNY---QPIIYDNGNL----NKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            K+  L++I + +     NLL  +    +      D+R C LC   GD  E++ GRL+N D D W+HLNC LWC++ +ETVSGSL+ V  SL+KA KT CT C  +GAG+ C+ S C +VYHVPCA+K+GC FY DRGMYCP H  +  ++P  L SL V+RRV I RDE A + G++ +            DV  + R G L L+N+GQLLPEQL SG Y++ S IYPVGY STRIYWS   +++RC+Y C I++S                   F V+  + G   +   D SCD +W+ IL +I + R+   +   R+F  YL GE LYGLTEP IIR IESLPGV+ + NYAFKFG++QLI EMPLAINPTG AR+EPKLRT+VRR R   E    +   L  KP   +    P+  + G+     + ++++ SK+QQY+RL  EW+ NV+L+RS+IQGLGLFAA+D  K T IIEYLGE+IRNEVGN RE+LY+++N  +YMFR+++D I+DAT+ GGLARYINHSC+PNC AE L+ D GS I+I  ++ IE+GEELTYDYKFD E+++ D+IPCLCG+ NCR+WMN
Sbjct:  900 KSRSLQSIQRTLNSCSSNLLSTRSGVDF----YPDIRICRLCHQTGDAAEEVAGRLLNYDFDVWLHLNCILWCYDTYETVSGSLVHVARSLKKAEKTQCTHCGLSGAGLPCFHSDCPSVYHVPCAHKIGCSFYGDRGMYCPEHDTIETSYP-RLNSLAVDRRVFIARDEDAQVGGIILKVNQLLDATSLKHDVSARLRVGGLVLHNVGQLLPEQLSSGLYHNTSFIYPVGYSSTRIYWSYRHVDRRCRYHCRIEDSGPTEGTASNDNRTSALGARFVVEVDETGEPPDSFEDVSCDGVWQQILTRINEKRRVPRTNYLRIFQNYLIGEVLYGLTEPHIIRAIESLPGVDRLNNYAFKFGRLQLIQEMPLAINPTGCARSEPKLRTHVRR-RQISEAHATQHVPLTRKPAGFHGTCTPLRSNPGSPVYLSSNSSMIQSKSQQYRRLGSEWKMNVVLARSRIQGLGLFAARDINKHTFIIEYLGELIRNEVGNRRERLYESQNRGVYMFRVDDDYIVDATMCGGLARYINHSCDPNCTAEVLTCDNGSHIVIIAKRNIEKGEELTYDYKFDIEEDRWDRIPCLCGASNCRQWMN 1485          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183LFW2 (Histone-lysine N-methyltransferase OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2687 PE=4 SV=1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 328/763 (42.99%), Postives = 465/763 (60.94%), Query Frame = 2
Query: 1970 INGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFK--------SYHSVECNLEKKSTNNTNVQCTKVLIKIT----PYKPAKNYKKVCDFEQYVR-RRFPSEGQGDSSVKPAVVVTDSIKK-------RLLG----LNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHV--VLNHPMHLPSLRVERRVNILRDESALIAGMVTED---------QDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDES---DDM------PL---FKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCG------ILKAKPNNNYQPIIYDNGNLNK-TALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            I G + +  + EE +    L+   +  TC YC      I   ++  K    D    L FCSSSC +  K        S+     N +   T  + ++   ++I +     P +  ++ K++   +  V  +R P+E    +S +    V+ ++K+       RL+G      ++  +T        D+  + ++ L KK+SC       +D R C LC  +GDG  D+  RL+N + D W+HLNC LWC+E +ETVSGSLM+V  S  KA KT CT C   GAG+ C+ S C  VYH+PCAY++ C F+ DRGMYCP H+    N P HL SL VER+V + RDE + +  +++++         ++ K+K R G+L L+ IGQLLPEQL SG +++ + IYPVGY ++RIYWS   + +RC+Y+C I++S   D +      P+   F V+ I+   E +   D +CD +W+ I+N+I   R+ S   R+    + GE LYGLTEP IIR IESLPGV+ + NY FKFGK+QLI EMPLAINPTGSAR+EPKLRTY+RR         N C       +    P + Y   I     LN  +  + SK+QQY+RL+++W+ NV+L+RS+IQGLGL+AA+D  KST IIEYLGE+IRNEV N RE+LY+++N  IYMFR+++D I+DAT++GGLARYINHSC+PNC AE L+ D  + I+I   + IE+G+ELTYDYKFD E+++ D+IPCLCGSINCRKWMN
Sbjct:  692 ITGHNSNQKYCEEVILCNRLNGEAHA-TCSYCKM---QIMLPQRTFKWKSHDKESYLPFCSSSCLARLKRQGPNCMTSFVPDASNFDIPFTVTSTIESQPLIIFLVKSNHPKRMKQSSKRLSSQDLQVNFKRSPNE----TSNRMLFGVSSTVKRWRNIRWRRLIGSPPVCTFNVLRTS------SDLPMSQKSFLSKKFSC-------IDTRVCQLCHQIGDGSNDVTSRLLNYNTDKWLHLNCILWCYETYETVSGSLMDVPCSSEKASKTPCTYCKNLGAGLPCFDSDCQAVYHLPCAYQINCSFHPDRGMYCPLHLKSASNLP-HLDSLAVERKVYVSRDEHSQVEKVISDEDHFTSMQNVKEPKLKLRIGTLILHRIGQLLPEQLASGVFHTSNFIYPVGYWTSRIYWSFRHVGQRCRYDCRIEDSVRPDGVNQSLVDPILVKFTVEVIEPNEEKIFFEDTTCDGVWRKIINRINSSRKCSSFFRILQDNIQGEVLYGLTEPHIIRAIESLPGVDRLSNYLFKFGKLQLIQEMPLAINPTGSARSEPKLRTYIRRK---STGDVNTCPYIAHNHVFLEAPGHPYSSDIGSPTYLNSLSPSMTSKSQQYRRLRWDWKTNVVLARSRIQGLGLYAARDISKSTFIIEYLGEVIRNEVANRRERLYESQNRGIYMFRVDDDWIVDATMSGGLARYINHSCDPNCTAEILNCDNSNHIVIIASKNIEKGDELTYDYKFDLEEDRWDRIPCLCGSINCRKWMN 1429          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2d (lysine methyltransferase 2D [Source:NCBI gene;Acc:103042576])

HSP 1 Score: 524.628 bits (1350), Expect = 2.315e-155
Identity = 266/590 (45.08%), Postives = 375/590 (63.56%), Query Frame = 2
Query: 2348 DSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMH--LPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D  ++P +     ++ + L L  +  K    K   +++ +     L+++   + R PD +  D R C  C   GDG  D   RL+NID D WVHLNCALW  EV+ET  G+L+ V+ +LR+ ++T C CC +TGA   C R +C NVYH  CA +  C+F+ D+ M C  H  L  P    L S  V RRV I RDE   IA ++     + + FR G L  + +GQLLP Q+ +  ++S + I+PVGY +TRIYWS+   N+RC+Y C I E D +PLF+V+ ++ G E++   D S D +W  I+ K+AKLR+D+ + +LF  ++ GE++YGLT   ++R+ ESLPGVE  ++Y F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ      G +N       ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARY+NHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 2840 DEEIRPKIKKWKGVRWKRLHLVITIRKGSSKKENSREVSE-----LMERLRITLR-PDKLPRDKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCACCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHK-LKGPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHL-FRVGGLIFHAVGQLLPSQMAA--FHSPTAIFPVGYEATRIYWSTRVPNRRCRYRCRISEQDGVPLFEVRVLEPGQEDLHFRDCSPDGIWDKIVQKVAKLREDAAMLKLFADHVKGEEMYGLTVHAVMRITESLPGVENCQDYTFRYGRHPLM-ELPLMINPTGCARSEPKILTHCKRPHTLNSTSMSKA----------YQSTF--TGEINTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 3405          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2d (lysine methyltransferase 2D [Source:NCBI gene;Acc:103042576])

HSP 1 Score: 524.628 bits (1350), Expect = 2.991e-155
Identity = 266/590 (45.08%), Postives = 375/590 (63.56%), Query Frame = 2
Query: 2348 DSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLV--DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMH--LPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D  ++P +     ++ + L L  +  K    K   +++ +     L+++   + R PD +  D R C  C   GDG  D   RL+NID D WVHLNCALW  EV+ET  G+L+ V+ +LR+ ++T C CC +TGA   C R +C NVYH  CA +  C+F+ D+ M C  H  L  P    L S  V RRV I RDE   IA ++     + + FR G L  + +GQLLP Q+ +  ++S + I+PVGY +TRIYWS+   N+RC+Y C I E D +PLF+V+ ++ G E++   D S D +W  I+ K+AKLR+D+ + +LF  ++ GE++YGLT   ++R+ ESLPGVE  ++Y F++G+  L+ E+PL INPTG AR+EPK+ T+ +R      T  +K           YQ      G +N       ++SK+ QY+RLK EW+ NV L+RS+IQGLGL+AAKD EK TM+IEY+G IIRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARY+NHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct: 4496 DEEIRPKIKKWKGVRWKRLHLVITIRKGSSKKENSREVSE-----LMERLRITLR-PDKLPRDKRKCCFCHEEGDGATDGPARLLNIDVDLWVHLNCALWSTEVYETQGGALINVEVALRRGLRTRCACCQKTGATNSCNRLRCPNVYHFACAIRARCMFFKDKTMLCTQHK-LKGPSEEELSSFAVFRRVYIERDEVKQIASILQRGDRIHL-FRVGGLIFHAVGQLLPSQMAA--FHSPTAIFPVGYEATRIYWSTRVPNRRCRYRCRISEQDGVPLFEVRVLEPGQEDLHFRDCSPDGIWDKIVQKVAKLREDAAMLKLFADHVKGEEMYGLTVHAVMRITESLPGVENCQDYTFRYGRHPLM-ELPLMINPTGCARSEPKILTHCKRPHTLNSTSMSKA----------YQSTF--TGEINTPYSKQFVHSKSSQYRRLKTEWKTNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 5061          

HSP 2 Score: 57.7658 bits (138), Expect = 1.056e-7
Identity = 26/82 (31.71%), Postives = 38/82 (46.34%), Query Frame = 2
Query: 2615 WVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDR-GMYCPNHV 2857
            WVH  CA+W   V +     L+ VD ++   I+  C  C   GA I+C    C+  YH PC+   G      +  + CP H+
Sbjct:  125 WVHYWCAVWSEGVRQGEGEELINVDEAVISGIQQPCDYCKRMGATIRCRAKGCSRFYHFPCSAASGSFQSMKQLALLCPEHI 206          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000041567.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001314.1:1300751:1307385:-1 gene:ENSAMXG00000036494.1 transcript:ENSAMXT00000041567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 367.851 bits (943), Expect = 1.327e-115
Identity = 171/351 (48.72%), Postives = 245/351 (69.80%), Query Frame = 2
Query: 3044 NYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +++S + I+PVGY ++RIYWS    N+RC+Y C IDE D  P F ++ I+ G E++L T  S   +W  +L  +A  R ++G+ +LFPVYL GE L+GLT P + R++ESLPGVE    Y F++G+  L+ E+PLAINP+G AR+EPK  T+V+R              +K    N   P        +K   ++SK+ QY+R+K EW++NV L+RS+IQGLGL+AA+D EK T++IEY+G IIRNEV N +EK+Y+++N  +YMFR++ + +IDAT+ GG ARYINHSC PNC+AE ++ +   +I+IT+ + I+RGEEL YDYKFD ED++  KIPC CG++NCRKWMN
Sbjct:    3 DFHSSAAIFPVGYEASRIYWSMRHGNRRCRYLCSIDEKDGEPEFSIRVIEQGYEDLLLTGSSPKGVWDKVLEPVADRRNETGILKLFPVYLKGEDLFGLTVPAVTRIVESLPGVEACSRYTFRYGRNPLM-ELPLAINPSGCARSEPKALTHVKRPH-----TLTSGSTIKTLQTNGGSPAELTGVPYSKQ-FVHSKSSQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKDTLVIEYIGTIIRNEVANRKEKMYESQNRGVYMFRIDSEHVIDATITGGPARYINHSCAPNCIAEVVTFEKDHKIMITSNRRIQRGEELCYDYKFDLEDDQ-HKIPCHCGAVNCRKWMN 345          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000033484.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:1968942:1979026:-1 gene:ENSAMXG00000036099.1 transcript:ENSAMXT00000033484.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 353.599 bits (906), Expect = 2.472e-109
Identity = 177/402 (44.03%), Postives = 260/402 (64.68%), Query Frame = 2
Query: 2894 VERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQ-PIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            V RRV + RDE   +A  V +  ++   FR GSL  + +GQL P  L   +++S S I+P GY ++R+YWS     +RC+Y C ++E    P F ++ ++ G E+ VLTD S   +W  +L  +A+ R ++G+ RLFPVYL GE L+GLT   + R+ ESLPGV+    Y F++G   ++ E+PL INPTG AR+E  LR + +  R    + +N+       P+   Q   + + G  +    ++SK+ QY+RL  EW++NV L+ S+IQGLGLFAA+D EK TM+IEYLG+++R EV   +E  Y+A+N   +MFR++ + +IDAT +G  ARYINHSC+PNCVAE ++ + G +III++ + IE+GEEL YDYK     N+  K PCLCG++NCRKWMN
Sbjct:   31 VFRRVYVQRDELRQLASAV-QRPELGHTFRVGSLLFHAMGQLPPALL--PHFHSASAIFPPGYEASRLYWSMRHGRRRCRYVCSVEEHQGRPEFSIRVLERGYEDLVLTDTSAKGVWDKVLGSVAERRAETGMLRLFPVYLKGEDLFGLTVSAVARIAESLPGVKACSRYRFRYGWNPML-ELPLCINPTGCARSE--LRVHPQNQRLKILSVWNR-------PSRILQNSALAEGGPSHSKHFVHSKSSQYRRLTSEWKSNVYLAHSRIQGLGLFAARDIEKQTMVIEYLGDVLRAEVAARKELHYKAKNRKAFMFRIDGEYVIDATCSGSPARYINHSCSPNCVAEVVTFERGYKIIISSNRRIEKGEELCYDYKLGLVKNQNQKTPCLCGAVNCRKWMN 419          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 167.548 bits (423), Expect = 4.624e-41
Identity = 100/319 (31.35%), Postives = 169/319 (52.98%), Query Frame = 2
Query: 3161 DMPLFKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYD--------NGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            D P  + K   +   +V  D S +  W+ +L+ + + R  + L +L    ++G ++ GL    ++ ++E L G      + F+F K Q   E  L INP+G AR+E  LR     M ++  ++  +       P+ +    +YD          +   T+L      +++ L+   +  V + RS I G GLF  ++ E   M+IEY G +IR+ + + REK Y  +    YMFR+++  ++DAT++G  AR+INHSC PNC +  ++++    I+I   + I RGEELTYDYKF  ED  ++K+ C CG+  CR+++N
Sbjct: 3692 DQPHLRFKITSDDGFSVEAD-SIEVAWRAVLDGVQEARAAAKLRQLSFTGMNGARMMGLLHDAVVYLVEQLQGASSCHRHPFRFHK-QASQEEDLPINPSGCARSEVYLRKSTFDMFNFLASQHRQL------PDTD----LYDEEEDDVLLKSSRRATSLELPMAMRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGCYMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIED-ASNKLGCNCGARRCRRFLN 3997          

HSP 2 Score: 130.954 bits (328), Expect = 7.698e-30
Identity = 69/211 (32.70%), Postives = 107/211 (50.71%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNH--VVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDE 3154
            D R CVLC+  GD      GRL+ +  + W H+NC++W  EVFE  +G LM V S++ +     C  CN+TGA + C  + C + YH  CA    C+F  D+ ++C  H  ++    +      V RRV +  +  +L    +T  +   I  + GSL ++ +G+L       G       + PVGY  +R YWS+   ++RCKY C + E
Sbjct: 2162 DERQCVLCQKYGDAKSADAGRLLYLGQNEWAHVNCSMWSAEVFEEDNGCLMHVHSAVARGRLMRCERCNQTGATVGCCLTSCQSNYHFMCARSRNCVFQDDKTVFCYKHRDLISGQIITGQGFEVLRRVYVDFEGISLRRKFLTGLEPESINMKIGSLLVSKLGKLNELSASQGK------LVPVGYECSRWYWSAVNPHRRCKYTCRVME 2366          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 510.375 bits (1313), Expect = 3.322e-151
Identity = 246/546 (45.05%), Postives = 355/546 (65.02%), Query Frame = 2
Query: 2483 LLKKYSCSYR-KPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHP-MHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVLTDKSCDK-LWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRR------MRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L++K   S R +P   D+RSC  C   GDG  D   RL+N+D D WVHLNCALW  EV+ET +G+L+ V+ + R+ + T C  C   GA   C R +C NVYH  CA ++ C+F+ D+ + CP H   +     L    V RRV + RDE   +A +V         FR GSL  + +GQ+LP Q  S  ++S + +YP+GY +TR+YWS+   NKRC+Y C + E++  P F V+ ++ G E+++   S  + +W  IL  + +LR+ + + RLFP Y+ GE+++GLT   ++R+ ESLPGVE  +NY F++G+  L+ E+PLA+NP+G ARTEP+LR++ +R        + +  +    G L A  +  +   +Y            SK+ QY+R+K EW+ NV L+RS+IQGLGL+A++D EK TM+IEY+GEIIRNEV N  EKLY++ N  +YMFRL+ + +IDAT+ GG ARYINHSC PNCVAE ++ D  ++III++ + I++GEELTYDY FDFED++ +KIPC CG+INCRKWMN
Sbjct: 3394 LMRKLGTSLRPEPAPPDMRSCSFCHLQGDGATDGPARLLNLDLDIWVHLNCALWSSEVYETQAGALINVEGARRRGLGTKCGACLRMGATTSCNRPRCPNVYHFACALRMRCMFFKDKTVLCPAHRPRSSTGQELGCFAVLRRVYVQRDEVRQLASLVRRGPMGGGTFRVGSLLFHALGQILPGQASSPYFHSRTALYPIGYQATRLYWSTRYTNKRCRYLCSVSEAEGRPQFTVRIVEQGHEDLVHAASTPQGVWDKILEPVVRLRKGAEMLRLFPDYMRGEEMFGLTVQAVLRITESLPGVECCQNYMFRYGRHPLM-ELPLAVNPSGCARTEPRLRSHFKRPHTLNSSSNSKSFQSTMSGELSAPYSKQF---VY------------SKSSQYRRMKTEWKINVYLARSRIQGLGLYASRDIEKHTMVIEYIGEIIRNEVANRHEKLYESTNRGVYMFRLDSEHVIDATITGGPARYINHSCAPNCVAELVTFDRENKIIISSCRRIQKGEELTYDYLFDFEDDQ-NKIPCHCGAINCRKWMN 3922          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 2.229e-55
Identity = 87/137 (63.50%), Postives = 110/137 (80.29%), Query Frame = 2
Query: 3686 RSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCG-SRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            R   QGLGL+AA+D EK TM+IEY+G IIRNEV N RE LY+A+N  +YMFR++ D +IDAT+ GG ARYINHSC+PNCVAE ++ D   S+III + + +++GEELTYDYKFDFED++  KIPC CG+ NCRKWMN
Sbjct:    1 RCATQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQNRGVYMFRIDGDHVIDATLTGGPARYINHSCSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTYDYKFDFEDDQ-HKIPCHCGAPNCRKWMN 136          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 145.206 bits (365), Expect = 5.546e-35
Identity = 71/160 (44.38%), Postives = 104/160 (65.00%), Query Frame = 2
Query: 3617 LLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L +S   ++ +LK+  +  +  ++S+I   GLFA +      M+IEY+G+ IR  V + REK Y+     S Y+FR++ D IIDAT  G LAR+INHSCNPNC A+ ++++   RI+I ++Q I   EE+TYDYKF  E+N   KIPCLCG+ +CR  +N
Sbjct: 1699 LADSDVFKFNQLKFR-KKKLRFTKSRIHEWGLFALEPIAAEEMVIEYVGQGIRQLVADMREKRYEVEGIGSSYLFRVDHDTIIDATKVGNLARFINHSCNPNCYAKVITVESQKRIVIYSKQAINVNEEITYDYKFPIEEN---KIPCLCGAEHCRGTLN 1854          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002229.1 (pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 gene:ENSPMAG00000002027.1 transcript:ENSPMAT00000002229.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 109.768 bits (273), Expect = 7.015e-25
Identity = 61/192 (31.77%), Postives = 91/192 (47.40%), Query Frame = 2
Query: 2585 GRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNH--VVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDE 3154
            GRL+ I  D W H NCA+W  EVFE   GSL  V +++ +  +  C  C   GA + C    C   +H  CA    C+F  D+ +YC  H  ++    +      V RRV +  +   L    ++  +  KI+   GSLT+  +G L    L  G       ++P+GY  TR+YWS+    + C Y C + E
Sbjct:  350 GRLLGIGQDEWTHSNCAVWSAEVFEDDDGSLKNVHAAVWRGKQLRCEHCGRMGATVGCCLPACQANFHFMCARARSCVFQDDKKLYCQRHKDLIRGEVVAEDGFEVLRRVFVDFEGIGLRRKFLSGLEPDKIQMMIGSLTIECLGVLNDLSLYEGK------LFPIGYQCTRVYWSTADARRLCVYTCKVLE 535          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 7.584e-18
Identity = 44/123 (35.77%), Postives = 72/123 (58.54%), Query Frame = 2
Query: 3665 RNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFED 4033
            + +++L+ S + G G+F     +K+  I EY GEII  +  + R K+Y     S ++F LN D ++DAT  G   R+ NHS +PNC A+ + ++   RI I  ++ I+ GEEL +DY++   D
Sbjct:  648 KKHLLLAPSDVAGWGIFIKVPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCS-FLFNLNNDFVVDATRKGNKIRFANHSVSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQAD 769          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 135.961 bits (341), Expect = 1.341e-32
Identity = 64/141 (45.39%), Postives = 90/141 (63.83%), Query Frame = 2
Query: 3674 VILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            V+ +RS I   GL+A        MIIEY+GE IR  V   REK Y      S Y+FR++E+ +IDAT  GG+AR+INH C+PNC A+ + +    RI+I   + I   EELTYDYKF+ E +  +++PCLCG+ NC+ ++N
Sbjct:  940 VMFARSAIHNWGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFLN 1080          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 78.5666 bits (192), Expect = 4.236e-15
Identity = 49/148 (33.11%), Postives = 73/148 (49.32%), Query Frame = 2
Query: 3638 QYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINC 4078
            Q +R + +    + + ++K +G G+ A +D E +  I EY GE+I       R   Y  R+    Y   L     IDAT+ G LAR+ NHSC+PN       +    R+ I  ++ I +GEE+T+DY  D    +A K  C C   NC
Sbjct:  110 QNQRFQKKQYAPIAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQK--CYCEEPNC 255          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET4 (Protein of unknown function, contains a SET domain; SET4 has a paralog, SET3, that arose from the whole genome duplication [Source:SGD;Acc:S000003641])

HSP 1 Score: 54.6842 bits (130), Expect = 8.463e-8
Identity = 39/134 (29.10%), Postives = 61/134 (45.52%), Query Frame = 2
Query: 3689 SKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIY----------MFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSL---------DCGSRIIITTRQLIERGEELTYDYKFDFED 4033
            S  +  G+FAA    K  +I EYLG+I         +K YQ   N+ Y          +F  +  L ID+   GGL RYI  SC PN    T+           DC  + ++   + I +GEE++ ++++D  +
Sbjct:  354 SNERDFGVFAADSCVKGELIQEYLGKI-------DFQKNYQTDPNNDYRLMGTTKPKVLFHPHWPLYIDSRETGGLTRYIRRSCEPNVELVTVRPLDEKPRGDNDCRVKFVLRAIRDIRKGEEISVEWQWDLRN 480          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO37589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA7])

HSP 1 Score: 383.259 bits (983), Expect = 4.896e-120
Identity = 212/470 (45.11%), Postives = 296/470 (62.98%), Query Frame = 2
Query: 2720 CTCCNETGAGIQCYRS------KCTNVYHVPCAYKVGCIFYTDRGMYCPNHVV-LNHPMHLPSLRVERRVNILRDESALIAGMVTEDQ----DVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            C  C++ GA + C R       +C+N YH  CA +  C+F+ D+ M C  H    +    LPS  V R+V I RDE   IA M+  +Q    D     R GSL + ++GQLL  QL +  +++ + +YPVG++S R YWS  +INKRC+Y C ++E + MPLF ++  + G E+ V   KS   +WK +L  I KLR+++ L  L+P Y++GE L+GLTE  ++R+IES+PGV+ ++ Y  ++G    I EMPLAINPTG AR E  ++T+ R  R       +      +    N      ++ +L     + SK  QY++LK EWR NV L RS IQGLGLFA +D E   M+IEY+G IIRNEV N +E +Y+++N  IYMFR++ D +IDAT+ GG ARYINHSC PNCVAE ++ +   +III + + IE+GEELTYDYKFDFED++  KI CLCG+ NCRKWMN
Sbjct:    3 CCMCHKMGATVVCNRVNFYNKVRCSNTYHFGCAIRNNCMFFKDKTMLCHEHRPDGDREDRLPSYAVFRKVFIHRDEIEQIARMLRHNQESGGDKLQTLRIGSLVVKSLGQLLLHQLQT--FHTRNAVYPVGFNSIRFYWSMREINKRCQYHCKVEECEGMPLFTLRVNEQGHEDTVFKGKSPRDVWKQVLEPIHKLRKEAVLVNLWPAYITGEDLFGLTEQFVLRIIESMPGVDYMQGYNMRYGPSS-IMEMPLAINPTGCARAEALIKTHFRSTRS-----VSSISTAGSNAAGNSSREAEESTSLYMKQFVYSKASQYRKLKTEWRQNVFLGRSNIQGLGLFANRDMEPGCMVIEYIGSIIRNEVANKKESIYESQNRGIYMFRIDSDSVIDATIAGGPARYINHSCMPNCVAEVVTFEKEQKIIIISSRKIEKGEELTYDYKFDFEDDE-HKISCLCGAPNCRKWMN 463          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 157.532 bits (397), Expect = 2.174e-42
Identity = 95/297 (31.99%), Postives = 152/297 (51.18%), Query Frame = 2
Query: 3239 WKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGK---MQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDN---GNLN----KTALLNSKTQQYKRLKYEWRN--NVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            W+ I + +   R    L  L  + +S   + G+T+  +  ++E L    +++NY F++           + L  NPTG  RTEP  R  +  M  +  +++     L    ++NY  +       GN+      T L      +Y+ LK    N   + + RS I G GL+  +      M+IEY G +IR+ + + RE  Y+++    YMFR++   ++DAT +G  AR+INHSC PNC +  +++D   +I+I   + I RGEELTYDYKF  ED   +K+PC C S  CRK++N
Sbjct:   25 WRMIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDGLELKENPTGCCRTEPHHRRLMYDMFAFLASEYRTPPQL----DDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLED---EKLPCHCKSKRCRKYLN 314          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 152.91 bits (385), Expect = 5.197e-41
Identity = 94/294 (31.97%), Postives = 150/294 (51.02%), Query Frame = 2
Query: 3248 ILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGK---MQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDN---GNLN----KTALLNSKTQQYKRLKYEWRN--NVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            I + +   R    L  L  + +S   + G+T+  +  ++E L    +++NY F++           + L  NPTG  RTEP  R  +  M  +  +++     L    ++NY  +       GN+      T L      +Y+ LK    N   + + RS I G GL+  +      M+IEY G +IR+ + + RE  Y+++    YMFR++   ++DAT +G  AR+INHSC PNC +  +++D   +I+I   + I RGEELTYDYKF  ED   +K+PC C S  CRK++N
Sbjct:    2 IFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNPPFGTNGEDGLELKENPTGCCRTEPHHRRLMYDMFAFLASEYRTPPQL----DDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLED---EKLPCHCKSKRCRKYLN 288          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO31259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF5])

HSP 1 Score: 143.28 bits (360), Expect = 1.608e-37
Identity = 93/303 (30.69%), Postives = 149/303 (49.17%), Query Frame = 2
Query: 3239 WKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTY-VRRMRDYQETKFNKCGILKAKPNNNYQPIIYDN-----------GNLN----KTALLNSKTQQYKRLKYEWRN--NVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            W+ I + +   R    L  L  + +S   + G+T+  +  ++E L    +++NY F++         P   N  G     P+  TY V     Y++  ++    L ++      P + DN           GN+      T L      +Y+ LK    N   + + RS I G GL+  +      M+IEY G +IR+ + + RE  Y+++    YMFR++   ++DAT +G  AR+INHSC PNC +  +++D   +I+I   + I RGEELTYDYKF  ED   +K+PC C S  CRK++N
Sbjct:   25 WRMIFDLVRDSRSSHLLKDLPFIGVSDRCMIGVTDEPVTYILEQLADAHLLRNYRFQYNP-------PFGTN--GEDGLTPE--TYCVNAFCGYRKKMYDMFAFLASEYRT--PPQLDDNYDELEAAEQAWGNMTTIKRPTTLDLPMAMRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGCYMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLED---EKLPCHCKSKRCRKYLN 311          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO44546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVC2])

HSP 1 Score: 135.576 bits (340), Expect = 6.751e-36
Identity = 64/139 (46.04%), Postives = 92/139 (66.19%), Query Frame = 2
Query: 3680 LSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
             ++S I   GLFA +      M+IEY+GE+IR  + + RE+ Y+ R   S YMFRL+E  IIDAT  G  AR+INH C+PNC A+ ++++   +I+I +++ I+  EE+TYDYKF  ED   +KIPCLCG+  CR  +N
Sbjct:   78 FAKSSIHDWGLFALEPIAADEMVIEYVGEVIRQAIADYRERCYEERGIGSSYMFRLDETTIIDATTMGNFARFINHCCDPNCYAKVIAVENMKKIVIYSKRDIQVDEEITYDYKFPIED---EKIPCLCGAPQCRGTLN 213          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000033878.1 (pep primary_assembly:ASM223467v1:7:12278136:12280872:-1 gene:ENSORLG00000024034.1 transcript:ENSORLT00000033878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 395.201 bits (1014), Expect = 7.947e-125
Identity = 202/409 (49.39%), Postives = 277/409 (67.73%), Query Frame = 2
Query: 2879 LPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENV-LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            L +  V RRV I RDE   IA ++     + + FR G L  + +GQLLP Q+   N++S + I+PVGY +TRIYWS+   NKRC+Y C I E D  PLF+V+ +++G E++   D S D +W+ I+ ++AKLR DS + +LF   L GE+++GLT   ++R+ ESLPGVE  ++Y F++G+  L+ E+PL INPTG AR+EPK+ T  +R      T  +K           YQ      G LN       ++SK+ QY+RLK EW+NNV L+RS+IQGLGL+AAKD EK TM+IEY+G +IRNEV N REK+Y+ +N  IYMFR+N + +IDAT+ GG ARY+NHSC PNCVAE ++ D   +III + + I +GEELTYDY+FDFED++  KIPC CG+ NCRKWMN
Sbjct:   16 LSTFAVLRRVYIERDEVKQIASILQRGDRIHL-FRVGGLIFHAVGQLLPSQM--ANFHSATAIFPVGYEATRIYWSTRVPNKRCRYRCRISEDDGRPLFEVRVLEHGMEDLHYRDASPDGIWERIVQQVAKLRTDSSMLKLFTENLKGEEMFGLTIHAVMRITESLPGVENCQSYQFRYGRHPLM-ELPLMINPTGCARSEPKVSTQCKRPHTLNSTSVSKA----------YQSTF--TGELNTPYSKQFVHSKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTVIRNEVANRREKIYELQNRGIYMFRINNEQVIDATLTGGPARYVNHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQ-HKIPCHCGAWNCRKWMN 407          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000028985.1 (pep primary_assembly:ASM223467v1:20:4868775:4873089:-1 gene:ENSORLG00000027146.1 transcript:ENSORLT00000028985.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 387.111 bits (993), Expect = 7.544e-122
Identity = 198/422 (46.92%), Postives = 278/422 (65.88%), Query Frame = 2
Query: 2855 VVLNHPM--HLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFN-KCGILKAKPNNNYQPIIYDNGNLNKTALL-----NSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +VL+ P    L    V RRV + RDE+  IA +V   +  +  FR GSL    +G+LLP Q+    +++ + I+PVGYH+ R+YWS    N+RCKY C I+E    PLFKVK ++ G E+ VLT  S   +W  IL  +A++R  SG  +LFP YL GE L+GLT   + R+IESLPGVE  + Y F++G+  L+ E PLA NP+GSAR+EPKL T     R Y  T    +C                  G++ ++        +SK  QY+R+K EW++NV L+RS+IQGLGL+AA+D EK TM+IEY+G IIR+EV N +E+LY+++N  +YMFR++ D +IDAT+ GG ARYINHSC PNC+ E ++++  ++III++ + I+RGEEL+YDYKFD ED++  KIPC CG++NCRKWMN
Sbjct:    1 MVLSDPYDSELRCFSVFRRVFVQRDEARQIAAIVQRGER-QHTFRVGSLLFRTVGRLLPHQI--STFHNETAIFPVGYHANRLYWSMRHSNRRCKYMCHIEEVGGQPLFKVKVVEKGYEDLVLTGPSPKAVWDQILEPVAQMRSSSGTLKLFPAYLKGEDLFGLTTSAVSRIIESLPGVEACERYTFRYGRNPLM-EWPLAFNPSGSARSEPKL-TSASLFRPYLLTSVAPRC-----------------QGSVGESVAAAHQGRHSKAAQYRRMKAEWKSNVYLARSRIQGLGLYAARDIEKCTMVIEYIGAIIRSEVANRKERLYESQNRGVYMFRIDNDYVIDATITGGPARYINHSCAPNCITEVVNVEKENKIIISSCRRIQRGEELSYDYKFDLEDDQ-HKIPCHCGAVNCRKWMN 399          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000036251.1 (pep primary_assembly:ASM223467v1:17:25405391:25409583:1 gene:ENSORLG00000025059.1 transcript:ENSORLT00000036251.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 353.984 bits (907), Expect = 1.615e-109
Identity = 173/403 (42.93%), Postives = 260/403 (64.52%), Query Frame = 2
Query: 2894 VERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVL-TDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNL--NKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            V RRV + RDE   IA  V +  ++   FR GSL L+ IGQL P Q+ S  ++S + I+PVGY + R+YWS    N+RC+Y C ++++D +P F ++ I+ G  ++L TD S   +W  +L  +A+ R +SG  +LFPVYL GE L+GLT P + ++ ESLPGVE    Y+F++G+   +  +PL  NP G AR +P+  +       Y         +L      + Q +    G +  +KT +++ ++ QY+ +K EWR NV L RS+IQGLGLFAA+D EK +M+IEY G I+RNEV   +EK+Y+++N +++MFR++ + ++DAT  GGLARYINHSC PNCVAE ++ + G +III+  + +E+GEEL +DY+FD  + +  +I C CG+  CRKWMN
Sbjct:   25 VFRRVYVQRDEMRQIATAV-QQPELGFTFRVGSLVLHAIGQLTPLQMAS--FHSSTAIFPVGYEACRVYWSMRHGNRRCRYVCSVEDNDGLPEFTIRVIERGYPDLLLTDASPKGVWDKVLGPVAEKRSESGTLQLFPVYLKGEDLFGLTVPAVTKITESLPGVESCDRYSFRYGRNPRLV-LPLVFNPAGCARAQPRTSS------PYTSLVIRLGHVLHLSSARSNQNVAQGEGGVPHSKTPVVHPRSSQYRWMKSEWRANVYLGRSQIQGLGLFAARDIEKQSMVIEYNGTILRNEVAIRKEKVYRSQNRAVFMFRIDSEHVVDATRTGGLARYINHSCAPNCVAEVVTFERGYKIIISCVRRVEKGEELCFDYQFDAVEGR-HRIACHCGAPKCRKWMN 416          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 179.874 bits (455), Expect = 9.903e-45
Identity = 104/297 (35.02%), Postives = 165/297 (55.56%), Query Frame = 2
Query: 3212 LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +  +S +  WK + +K+ + R  + L+ L    ++G ++ G+    ++ ++E L G +  ++Y+F+F K +   + PL  NP GSAR E   R  V  M ++  +K       +  P    Q    D G L    + ++      ++K+LK   +  V + RS I G GLF  K  E   M+IEY G +IR+ + + REK Y A+    YMFR+++  ++DATV+G  AR+INHSC PNC +  L++D    I+I   + I  GEELTYDYKF  ED  ++K+PC CG+  CRK++N
Sbjct: 3879 IRSESIEDAWKCLTDKVKEARSHARLSDLSFDGVNGLRMLGIVHEAVVFLLEQLCGSKHCRSYSFRFHKPEESEDPPL--NPHGSARAEIHHRRSVFDMFNFLASKH------RQPPEYRPQEEEEDEGQLRIIRRASMELPLAVRFKQLKAMSKETVGVYRSPIHGRGLFCKKTIEAGEMVIEYSGNVIRSVLTDKREKYYDAKGIGCYMFRIDDYEVVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIED-ASNKLPCNCGTKKCRKFLN 4166          

HSP 2 Score: 129.413 bits (324), Expect = 1.930e-29
Identity = 71/214 (33.18%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2522 LVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNI----LRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCS-IIYPVGYHSTRIYWSSTQINKRCKYECLI 3148
            + D R CV C   GD   + CGRL+ I  + W H+NCALW  EVFE    SL  V  ++ +  K  C  C +TGA + C  + CT  YH  CA +  C F  D+ +YCP H  +     +    V RR+ +    +  +   +AG+  E   + I    GS+ ++ +G       I    + C   ++P+GY  +R+YWS+    KRC Y C I
Sbjct: 2046 VTDNRKCVFCFKYGDEKINECGRLLYIGQNEWTHVNCALWSAEVFEDDDASLKNVHMAVLRGKKMCCERCQKTGATVSCCFTSCTRNYHFMCARQCQCTFLEDKKIYCPKHRDV-----VSGFEVTRRILVDMEGINFKRKFLAGLEPESVHMMI----GSMKIDCLG-------ILTELSDCKRKLFPLGYQCSRVYWSTLDARKRCVYTCRI 2243          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: KMT2A (lysine methyltransferase 2A [Source:NCBI gene;Acc:101171020])

HSP 1 Score: 179.104 bits (453), Expect = 1.503e-44
Identity = 104/297 (35.02%), Postives = 165/297 (55.56%), Query Frame = 2
Query: 3212 LTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLN---KTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +  +S +  WK + +K+ + R  + L+ L    ++G ++ G+    ++ ++E L G +  ++Y+F+F K +   + PL  NP GSAR E   R  V  M ++  +K       +  P    Q    D G L    + ++      ++K+LK   +  V + RS I G GLF  K  E   M+IEY G +IR+ + + REK Y A+    YMFR+++  ++DATV+G  AR+INHSC PNC +  L++D    I+I   + I  GEELTYDYKF  ED  ++K+PC CG+  CRK++N
Sbjct: 4252 IRSESIEDAWKCLTDKVKEARSHARLSDLSFDGVNGLRMLGIVHEAVVFLLEQLCGSKHCRSYSFRFHKPEESEDPPL--NPHGSARAEIHHRRSVFDMFNFLASKH------RQPPEYRPQEEEEDEGQLRIIRRASMELPLAVRFKQLKAMSKETVGVYRSPIHGRGLFCKKTIEAGEMVIEYSGNVIRSVLTDKREKYYDAKGIGCYMFRIDDYEVVDATVHGNAARFINHSCEPNCYSRVLTVDGQKHIVIFASRRICCGEELTYDYKFPIED-ASNKLPCNCGTKKCRKFLN 4539          

HSP 2 Score: 130.568 bits (327), Expect = 8.857e-30
Identity = 71/214 (33.18%), Postives = 105/214 (49.07%), Query Frame = 2
Query: 2522 LVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNI----LRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCS-IIYPVGYHSTRIYWSSTQINKRCKYECLI 3148
            + D R CV C   GD   + CGRL+ I  + W H+NCALW  EVFE    SL  V  ++ +  K  C  C +TGA + C  + CT  YH  CA +  C F  D+ +YCP H  +     +    V RR+ +    +  +   +AG+  E   + I    GS+ ++ +G       I    + C   ++P+GY  +R+YWS+    KRC Y C I
Sbjct: 2116 VTDNRKCVFCFKYGDEKINECGRLLYIGQNEWTHVNCALWSAEVFEDDDASLKNVHMAVLRGKKMCCERCQKTGATVSCCFTSCTRNYHFMCARQCQCTFLEDKKIYCPKHRDVIRGEVVSGFEVTRRILVDMEGINFKRKFLAGLEPESVHMMI----GSMKIDCLG-------ILTELSDCKRKLFPLGYQCSRVYWSTLDARKRCVYTCRI 2318          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000071222.1 (SMESG000071222.1)

HSP 1 Score: 2653.63 bits (6877), Expect = 0.000e+0
Identity = 1326/1334 (99.40%), Postives = 1327/1334 (99.48%), Query Frame = 2
Query:   92 MTTEYFDAANSLCSNSFELIKRRRLMSDDFKNSDLDGENLMDYSGDNFQXXXXXXXXXXXXXXXXTNMSNSHSTPEDTFSEITLSSPTSKHCKPDSDIKDYEPSIDQYLSNSNNDVVGNQNCNDIVKQLPTSSINLKSIDDTIELVLSKIREENNFSKNLDSSDSCYKIKLDNYNSSDLSNCSSNINVQNNTLVSIARITSAKTGSHGSDNMSYSKGIISSASCLNSSIRNYGMSNYSKSYSQFYNYNYGISPQMAANFSNQITAPNYLEYNKMDYTRSNYLKEADKNKFFFPYQCQNPTYRQYLPNSYNNQPFYKPDSPNIQIHNQNYQMYQKPVKRNVYPDQIYVDDDTRLCKDNSKNPNYNIYFKTPQPNAHGLLEQGNSVRKKRTSSDSTKLTPSKKRKLANQFSITNNYEELIRKLKISNYNSLLMNPTVSQSVIVLSPKGFIENSKAVNLKKSARXXXXXXXXXXXXXXXIFSDSTQEDRYLSHYVDESIAGSCILSQKKNLDNDELLDIICGSPGSNKVTEKSENFCLHNLATDNVDYDPASPELTSSCSKKKNDQSNEINFSEPKIDAINYERNHTITPIVSYTESETKLITELHPTKSQELNRNYIQLSGSFLKRTKINGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSVECNLEKKSTNNTNVQCTKVLIKITPYKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            MTTEYFDA NSLCSNSFELIKRRRLMSDDFKNSDLDGENLMDYSGDNFQSEISAKASSSSIHESITNMSNSHSTPEDTFSEITLSSPTSKHCKPDSDIKDYEPSIDQYLSNSNNDVVGNQNCNDIVKQLPTSSINLKSIDDTIELVLSKIREENNFSKN DSSDSCYKIK DNYNSSDLSNCSSNINVQNNTLVSIARITSAKTGSHGSDNMSYSKGIISSASCLNSSIRNYGMSNYSKSYSQFYNYNYGISPQMAANFSNQITAPNYLEYNKMDYTRSNYLKEADKNKFFFPYQCQNPTYRQYLPNSYNNQPFYKPDSPNIQIHNQNYQMYQKPVKRNVYPDQIYVDDDTRLCKDNSKNPNYNIYFKTPQPNAHGLLEQGNSVRKKRTSSDSTKLTPSKKRKLANQFSITNNYEELIRKLKISNYNSLLMNPTVSQSVIVLSPKGFIENSKAVNLKKSARYKKYKSTLFKLKKPKIFSDSTQEDRYLSHYVDES AGSCILSQKKNLDNDELLDIICGSPGSNKVTEKSENFCLHNLATDNVDYDPASPELTSSCSKKKNDQSNEINFSEPKIDAINYERNHTITPIVSYTESETKLITELHPTKSQELNRNYIQLSGSFLKRTKINGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDS EDLLFCSSSCYSNFKSYHSVECNLEKKST+N NVQCTKVLIKITPYKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKT CTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN
Sbjct:    1 MTTEYFDATNSLCSNSFELIKRRRLMSDDFKNSDLDGENLMDYSGDNFQSEISAKASSSSIHESITNMSNSHSTPEDTFSEITLSSPTSKHCKPDSDIKDYEPSIDQYLSNSNNDVVGNQNCNDIVKQLPTSSINLKSIDDTIELVLSKIREENNFSKNFDSSDSCYKIKSDNYNSSDLSNCSSNINVQNNTLVSIARITSAKTGSHGSDNMSYSKGIISSASCLNSSIRNYGMSNYSKSYSQFYNYNYGISPQMAANFSNQITAPNYLEYNKMDYTRSNYLKEADKNKFFFPYQCQNPTYRQYLPNSYNNQPFYKPDSPNIQIHNQNYQMYQKPVKRNVYPDQIYVDDDTRLCKDNSKNPNYNIYFKTPQPNAHGLLEQGNSVRKKRTSSDSTKLTPSKKRKLANQFSITNNYEELIRKLKISNYNSLLMNPTVSQSVIVLSPKGFIENSKAVNLKKSARYKKYKSTLFKLKKPKIFSDSTQEDRYLSHYVDESNAGSCILSQKKNLDNDELLDIICGSPGSNKVTEKSENFCLHNLATDNVDYDPASPELTSSCSKKKNDQSNEINFSEPKIDAINYERNHTITPIVSYTESETKLITELHPTKSQELNRNYIQLSGSFLKRTKINGKSFSNIHIEEAVSIASLSASKNQNTCYYCYAFLNGISFIKKNSKLFGMDSTEDLLFCSSSCYSNFKSYHSVECNLEKKSTSNNNVQCTKVLIKITPYKPAKNYKKVCDFEQYVRRRFPSEGQGDSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTICTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 1334          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000064115.1 (SMESG000064115.1)

HSP 1 Score: 550.436 bits (1417), Expect = 2.429e-170
Identity = 283/580 (48.79%), Postives = 365/580 (62.93%), Query Frame = 2
Query: 2375 VTDSIKKRLLGLNYSYFKTEPLK--TIYKDIEKNDQNLLLKKYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHVPCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHSTRIYWSSTQINKRCKYEC--LIDESDDMPLFKVKFIDNGCEN-VLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLITEMPLAINPTGSARTEP--KLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            V  S +K   G  YS F + P+   T    I ++    L  K     RK   VD R+C LC   GD  E+  GRL+  D D W+H+NCALWC  VFE   G+L  V  S   ++K+ C+ C + GAGI CY  +CT  YHVPCA + GC+F+ DR MYC  H   +   HL +L V+RRV I RDE + +AG +  ++D     R GSL + +IGQLLP Q+ SGN+++ + +YP G+ S RI+WSS  IN R  YEC  L+D    MPLFKV   D   EN      +C + WK IL KI+ LR+   + + FP ++  E LYGLTEP ++R IESLPG+E + +YAFKFGKMQLI EMPL IN +GS RTEP  KL  ++ +   +Q   F +  +L A         I DN   N    L+SK QQY++LK+E + NV+L RSKIQG GL+AAKD EK TMIIEY+GE+IRNEV N REK Y+++   IYMFRL+   +IDAT  G LARYINH C+PNC  E L  +  S I+I + + IE+GEELTYDYKFD +D K DKIPCLCG+ NCR+WMN
Sbjct:  887 VKSSPQKIHKGSKYSVFHSNPIPEPTSISIISESQFKKLSMKSKSVLRKTGFVDKRTCSLCHRTGDLPENGPGRLLCFDVDKWLHINCALWCNNVFEMQCGALNNVPESFEASLKSICSSCGKPGAGIVCYYPRCTLKYHVPCAQEKGCLFFADRAMYCQLHQTKDLGPHLTTLNVDRRVYISRDEYSQVAGTIN-NEDQNFFLRIGSLVVLSIGQLLPHQIHSGNFHNLNHVYPTGFKSHRIHWSSRVINTRSVYECEILMDRDQKMPLFKVTATDENMENECYFGSTCSETWKKILTKISNLRKSHKVVKFFPEHIKAEDLYGLTEPHVLRAIESLPGLESLNDYAFKFGKMQLIVEMPLPINMSGSIRTEPFVKLYRHIHKPAIHQSPNFLR-HLLAAAAATATSGKIPDNILFNNKTTLSSKWQQYRKLKFETKFNVVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGIYMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIPCLCGARNCRRWMN 1464          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000027630.1 (SMESG000027630.1)

HSP 1 Score: 167.933 bits (424), Expect = 2.412e-41
Identity = 109/322 (33.85%), Postives = 168/322 (52.17%), Query Frame = 2
Query: 3173 FKVKFIDNGCENVLTDKSCDKLWKTILNKIAKLRQDSGLTRLFPVY-LSGEQLYGLTEPQIIRVIESLPGVEMIKNYAFKFGKMQLI----TEMPLAINPTGSAR----TEPKLRTYVRRMRDYQETKFNKCGILKAKPNNNYQPIIYDNGNLNKTA---LLNSKTQQYKRLK--YEWRNNVI-LSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            F ++F  +G +   + KS    W  I+ +I ++R+  GL   +PV    G   +GL    +I ++E +       NY FKF K ++       +   ++P G  R    T+ K     R    +  +K N        P  N+ P+  D  + N       L +   Q++ L+   + R   + +  S I G GLFA + F+   +IIEY+GE+IR+ + + RE  YQ      YMFRL++DLI+DAT  G  AR+INHSC+PNC A+ +  +    III  ++ I +GEELTYDY+F  ED   DK+PC CGS +C+K++N
Sbjct: 2367 FCLRFTIHGFKGSKSPKSG---WGLIVKRITQMRKSQGLME-YPVRNGDGWAKFGLDHRHVIYLVEQMVSAFQCNNYEFKFHKTRVTKLRNQYLADVVSPRGCVRFNQWTKTKPDHIARDPLAFLHSKSNY-------PPKNHAPLNADQLDDNPDPDEDYLRTLADQFRNLRNGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGVDCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIED---DKLPCTCGSFSCKKYLN 2674          

HSP 2 Score: 98.9821 bits (245), Expect = 2.862e-20
Identity = 68/223 (30.49%), Postives = 107/223 (47.98%), Query Frame = 2
Query: 2528 DVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALWCFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYR--------SKCTNVYHVPCAYKV--GCIFYTDRGMYCP----NHVVLNHPMHLPSLRVERRVNILRDESALIAGMVTED-QDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCS-----IIYPVGYHSTRIYWSSTQINKRCKY 3136
            D+R C LC   G GD+ + GRLI    D WVH+NCALW  +V+E   G+L+ VD ++RK  K  C  C + GA ++C          S C NVYH  CA+ +    +F   R  YC     N V     + L  + + RR+ + +   A ++   T+      I    G+L +N +G++          + CS      + P+GY + R++WS  +++    Y
Sbjct: 1724 DIRHCALC--AGSGDDRLEGRLIYGGLDVWVHVNCALWSDDVYEREDGALVNVDIAIRKGEKALCAACQKYGATLRCSAPDSLDGCGSSCPNVYHFACAFNMLPDPVFTELRTFYCSESHDNCVTDVQQLTLVDMPILRRIYLPQGCLANVSMACTDGVASDNIVVTIGNLRINCMGKI----------DECSDYLRVYLCPIGYQARRLFWSMYELDSLVMY 1934          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 136.732 bits (343), Expect = 5.510e-32
Identity = 62/141 (43.97%), Postives = 95/141 (67.38%), Query Frame = 2
Query: 3674 VILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +  ++S I   GL A +      M+IEY+G+++R  +   REK Y+ +   S Y+FR+++DL+IDAT+ G  AR+INHSC PNC+A  +++D   +I+I +++ I   EE+TYDYKF +E+   DKIPCLCGS+ CR  +N
Sbjct: 1276 MTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE---DKIPCLCGSVGCRGTLN 1413          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 136.732 bits (343), Expect = 5.596e-32
Identity = 62/141 (43.97%), Postives = 95/141 (67.38%), Query Frame = 2
Query: 3674 VILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 4093
            +  ++S I   GL A +      M+IEY+G+++R  +   REK Y+ +   S Y+FR+++DL+IDAT+ G  AR+INHSC PNC+A  +++D   +I+I +++ I   EE+TYDYKF +E+   DKIPCLCGS+ CR  +N
Sbjct: 1258 MTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE---DKIPCLCGSVGCRGTLN 1395          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT2C1.628e-16437.93lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2D9.363e-15548.50lysine methyltransferase 2D [Source:HGNC Symbol;Ac... [more]
KMT2C7.213e-15439.86lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C7.213e-15439.86lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
KMT2C2.597e-14236.54lysine methyltransferase 2C [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-162.496e-5332.40Histone-lysine N-methyltransferase [Source:UniPro... [more]
set-21.271e-3544.17Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-22.653e-3444.17Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-22.657e-3444.17Histone-lysine N-methyltransferase set-2 [Source:... [more]
met-11.986e-1631.11Histone-lysine N-methyltransferase [Source:UniPro... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trr6.430e-14945.26gene:FBgn0023518 transcript:FBtr0070363[more]
trr6.508e-14945.26gene:FBgn0023518 transcript:FBtr0070362[more]
trx4.981e-3646.05gene:FBgn0003862 transcript:FBtr0082948[more]
trx4.981e-3646.05gene:FBgn0003862 transcript:FBtr0082949[more]
trx4.981e-3646.05gene:FBgn0003862 transcript:FBtr0100277[more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d1.536e-15348.04lysine (K)-specific methyltransferase 2D [Source:Z... [more]
kmt2ca2.634e-15245.54lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2ca2.648e-15245.54lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2ca3.731e-15245.55lysine (K)-specific methyltransferase 2Ca [Source:... [more]
kmt2cb2.138e-12741.82lysine (K)-specific methyltransferase 2Cb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab9b8.204e-15848.02RAB9B, member RAS oncogene family [Source:Xenbase;... [more]
c1orf501.733e-14648.48chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf503.873e-14648.48chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf502.785e-12946.77chromosome 1 open reading frame 50 [Source:Xenbase... [more]
c1orf503.579e-11948.70chromosome 1 open reading frame 50 [Source:Xenbase... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt2c1.263e-16140.48lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2c2.375e-16140.34lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2c8.266e-15640.23lysine (K)-specific methyltransferase 2C [Source:M... [more]
Kmt2d8.392e-15448.57lysine (K)-specific methyltransferase 2D [Source:M... [more]
Kmt2d8.392e-15448.57lysine (K)-specific methyltransferase 2D [Source:M... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BRH4|KMT2C_MOUSE5.728e-15540.23Histone-lysine N-methyltransferase 2C OS=Mus muscu... [more]
sp|O14686|KMT2D_HUMAN4.496e-15448.50Histone-lysine N-methyltransferase 2D OS=Homo sapi... [more]
sp|Q8NEZ4|KMT2C_HUMAN3.464e-15339.86Histone-lysine N-methyltransferase 2C OS=Homo sapi... [more]
sp|Q6PDK2|KMT2D_MOUSE5.870e-15348.57Histone-lysine N-methyltransferase 2D OS=Mus muscu... [more]
sp|Q8IRW8|TRR_DROME6.445e-14845.26Histone-lysine N-methyltransferase trr OS=Drosophi... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QCR30.000e+043.38Histone-lysine N-methyltransferase MLL3 OS=Schisto... [more]
A0A183PG380.000e+043.77Histone-lysine N-methyltransferase OS=Schistosoma ... [more]
A0A183JHW10.000e+043.25Histone-lysine N-methyltransferase OS=Schistosoma ... [more]
A0A183AN650.000e+050.51Histone-lysine N-methyltransferase OS=Echinostoma ... [more]
A0A183LFW20.000e+042.99Histone-lysine N-methyltransferase OS=Schistosoma ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt2d2.315e-15545.08lysine methyltransferase 2D [Source:NCBI gene;Acc:... [more]
kmt2d2.991e-15545.08lysine methyltransferase 2D [Source:NCBI gene;Acc:... [more]
ENSAMXT00000041567.11.327e-11548.72pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033484.12.472e-10944.03pep primary_assembly:Astyanax_mexicanus-2.0:16:196... [more]
kmt2bb4.624e-4131.35lysine (K)-specific methyltransferase 2Bb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002322.13.322e-15145.05pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
ENSPMAT00000010827.12.229e-5563.50pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
setd1a5.546e-3544.38SET domain containing 1A, histone lysine methyltra... [more]
ENSPMAT00000002229.17.015e-2531.77pep scaffold:Pmarinus_7.0:GL477110:4214:18323:-1 g... [more]
ENSPMAT00000004922.17.584e-1835.77pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SET11.341e-3245.39Histone methyltransferase, subunit of the COMPASS ... [more]
SET24.236e-1533.11Histone methyltransferase with a role in transcrip... [more]
SET48.463e-829.10Protein of unknown function, contains a SET domain... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO375894.896e-12045.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308582.174e-4231.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308575.197e-4131.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312591.608e-3730.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445466.751e-3646.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033878.17.947e-12549.39pep primary_assembly:ASM223467v1:7:12278136:122808... [more]
ENSORLT00000028985.17.544e-12246.92pep primary_assembly:ASM223467v1:20:4868775:487308... [more]
ENSORLT00000036251.11.615e-10942.93pep primary_assembly:ASM223467v1:17:25405391:25409... [more]
KMT2A9.903e-4535.02lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
KMT2A1.503e-4435.02lysine methyltransferase 2A [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071222.10.000e+099.40SMESG000071222.1[more]
SMESG000064115.12.429e-17048.79SMESG000064115.1[more]
SMESG000027630.12.412e-4133.85SMESG000027630.1[more]
SMESG000062296.15.510e-3243.97SMESG000062296.1[more]
SMESG000062296.15.596e-3243.97SMESG000062296.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005879 ID=SMED30005879|Name=Histone-lysine N-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=4364bp
ATAAATCTTATATGATTAACTTATATTTTACCTATTTTATTTCTTTCGGA
ACAATATTTTATTTGTTAACATATCGATGACATGATATAAAATGACAACA
GAATATTTTGATGCAGCAAATTCTTTGTGTTCTAATTCATTTGAGTTGAT
CAAAAGAAGAAGGTTAATGTCAGATGATTTTAAGAATAGTGATTTAGATG
GTGAAAATTTAATGGATTATTCTGGTGATAATTTTCAATCAGAAATATCT
GCAAAAGCATCTTCCAGTTCAATTCACGAATCTATCACTAACATGTCTAA
TTCGCATTCGACTCCCGAAGATACATTTTCCGAAATCACTTTATCTTCAC
CAACATCTAAGCATTGTAAACCAGATTCCGATATTAAAGATTATGAACCA
TCTATTGATCAGTATTTGTCAAATTCTAATAATGACGTTGTTGGCAATCA
GAATTGTAACGATATCGTTAAACAATTACCGACATCTTCCATTAATCTTA
AAAGTATTGATGATACAATCGAACTAGTTCTTTCAAAAATTAGAGAAGAA
AATAACTTTTCAAAGAATTTGGATTCTTCTGATTCGTGTTATAAAATTAA
ATTGGATAATTATAATTCCAGTGATTTATCTAATTGTTCTTCCAATATTA
ATGTACAAAATAATACTCTGGTTTCTATAGCACGTATCACTTCAGCGAAA
ACTGGATCTCATGGTTCAGATAATATGTCGTATTCAAAAGGAATTATTTC
TAGCGCATCTTGTCTTAATTCATCTATTCGTAATTATGGTATGTCTAATT
ATTCAAAATCGTATTCTCAATTTTATAATTATAATTATGGAATTTCACCT
CAGATGGCAGCAAATTTTTCTAATCAGATCACTGCTCCTAATTATTTAGA
ATATAACAAAATGGATTATACTCGCTCAAATTATCTCAAAGAAGCTGATA
AAAATAAATTTTTCTTTCCTTATCAATGTCAAAACCCTACTTATAGACAG
TACCTTCCAAATTCGTATAATAATCAACCATTTTATAAACCAGATTCTCC
TAATATACAAATTCACAATCAGAATTATCAAATGTATCAAAAGCCTGTTA
AAAGGAATGTTTACCCTGATCAAATTTATGTTGATGATGATACTCGGCTT
TGTAAAGATAATTCCAAAAACCCAAATTATAATATTTATTTCAAAACTCC
TCAACCAAATGCACATGGTTTATTGGAACAAGGGAATTCTGTTCGTAAAA
AACGCACAAGTTCAGATTCTACAAAATTAACACCTAGTAAAAAGCGGAAA
TTAGCCAATCAATTTTCCATAACAAATAATTACGAAGAGTTAATAAGAAA
ATTAAAAATTTCTAATTATAATTCCTTATTAATGAATCCAACAGTGTCTC
AGTCTGTTATTGTTCTTTCACCAAAAGGATTTATAGAAAATTCTAAAGCT
GTCAATCTTAAAAAGTCTGCCAGGTATAAAAAATATAAATCAACTTTGTT
TAAACTTAAGAAGCCAAAAATCTTTTCGGATTCCACACAAGAAGATCGTT
ATTTATCACATTATGTGGATGAAAGTATTGCTGGGAGTTGTATATTGTCA
CAGAAAAAGAATTTAGATAACGATGAATTGTTAGACATCATTTGTGGATC
TCCGGGAAGTAACAAAGTCACAGAGAAATCAGAAAACTTTTGTTTGCATA
ATCTTGCAACAGACAACGTCGATTATGATCCTGCCAGTCCGGAATTGACA
AGTTCTTGTTCTAAAAAGAAAAATGATCAATCTAATGAAATCAATTTTTC
CGAGCCTAAAATTGATGCGATTAATTATGAGAGAAATCATACAATTACTC
CAATAGTTTCTTATACAGAAAGTGAAACCAAATTAATAACTGAATTACAT
CCGACTAAATCTCAAGAATTGAACAGAAATTACATTCAATTATCTGGCAG
CTTTCTGAAACGTACGAAAATCAATGGAAAATCATTTTCGAATATTCACA
TCGAAGAAGCCGTCAGTATAGCGTCGTTGTCAGCGTCTAAAAATCAAAAC
ACGTGTTATTACTGCTACGCATTTCTTAATGGAATATCTTTCATTAAAAA
AAACAGCAAATTATTTGGAATGGATTCTGCAGAAGATTTATTATTCTGCA
GCTCGAGTTGTTATTCAAATTTCAAGTCATACCATTCGGTTGAATGTAAT
TTAGAGAAAAAGTCCACCAACAATACTAACGTCCAGTGCACTAAAGTTTT
GATTAAAATTACTCCCTATAAACCGGCTAAAAATTATAAAAAAGTTTGTG
ATTTTGAACAATATGTTCGTCGACGATTTCCCAGTGAAGGCCAAGGAGAC
AGTTCGGTAAAACCGGCTGTTGTCGTTACTGATTCAATCAAGAAAAGATT
GCTCGGTTTAAATTATTCCTATTTCAAAACCGAGCCATTGAAAACAATTT
ATAAAGACATTGAAAAAAACGATCAAAATCTATTGCTGAAGAAGTATTCC
TGTTCTTATCGGAAACCGGACTTAGTTGATGTTCGGTCGTGTGTGTTATG
TAGGAATGTGGGAGATGGTGATGAGGATATCTGTGGCAGACTTATCAATA
TCGATGCCGATAATTGGGTCCATCTGAATTGCGCGTTGTGGTGTTTCGAA
GTATTCGAAACTGTTAGTGGATCGCTAATGGAAGTTGATTCGTCTTTACG
GAAAGCAATTAAGACCACTTGTACGTGTTGCAATGAAACCGGTGCCGGAA
TCCAATGTTATCGCAGCAAATGTACGAATGTTTACCATGTGCCTTGTGCA
TATAAAGTCGGTTGCATATTCTACACCGATCGTGGTATGTATTGTCCAAA
CCATGTCGTTTTGAATCATCCTATGCATTTGCCATCGTTGAGAGTTGAAC
GACGAGTCAATATCCTGCGAGATGAAAGTGCTCTTATTGCCGGAATGGTA
ACAGAAGATCAGGACGTGAAAATCAAATTTCGTACCGGATCTTTGACATT
GAATAATATCGGTCAATTGCTTCCTGAACAACTGATCAGTGGAAATTATA
ATTCGTGTTCAATAATCTATCCAGTCGGTTATCATTCAACTCGGATTTAT
TGGTCGTCAACTCAAATCAACAAGCGATGCAAATATGAATGTCTAATCGA
CGAATCCGATGACATGCCTTTATTTAAAGTGAAATTTATCGACAATGGCT
GTGAAAATGTTTTGACTGATAAATCTTGTGATAAATTGTGGAAAACAATA
CTGAATAAAATTGCAAAATTGCGCCAGGATTCCGGACTAACAAGGCTGTT
TCCTGTGTATCTGTCAGGTGAACAGTTGTACGGTTTGACTGAACCCCAAA
TCATTCGAGTTATTGAATCTCTTCCGGGAGTGGAAATGATTAAAAACTAT
GCTTTCAAATTCGGTAAAATGCAACTGATTACCGAAATGCCTTTAGCCAT
CAATCCAACCGGTTCTGCTCGAACAGAACCAAAACTGCGGACGTATGTGA
GACGAATGAGAGATTATCAGGAAACCAAATTTAACAAGTGTGGAATTTTG
AAAGCGAAACCCAACAACAACTATCAACCAATCATTTATGACAATGGCAA
TTTAAACAAAACCGCTTTACTCAACTCAAAAACTCAACAGTACAAACGAC
TGAAATACGAATGGAGAAACAATGTAATTCTATCGAGATCTAAAATCCAA
GGACTGGGATTATTTGCTGCTAAAGATTTTGAGAAATCGACAATGATTAT
TGAATATCTCGGTGAAATAATCCGAAACGAGGTGGGAAATAGTCGGGAAA
AACTCTATCAGGCTCGAAATAACAGTATCTACATGTTTCGGTTGAATGAA
GATTTGATCATAGACGCTACAGTAAACGGAGGATTGGCACGATATATCAA
CCATTCCTGCAATCCGAATTGTGTCGCGGAGACCTTGTCACTGGATTGTG
GAAGTCGGATCATCATCACGACGCGTCAACTCATCGAAAGGGGTGAAGAG
TTGACTTACGATTATAAATTCGATTTCGAAGACAATAAAGCCGACAAAAT
CCCTTGTTTGTGCGGATCAATCAATTGCCGGAAGTGGATGAATTGATCGT
CTGTTGAATGAATTTGCTTTCCTCAAATGTATTAATATTATTCTTTACTT
TCAAGATTCCTTTTAACACAAATTGTAAATCTTGTGCATATATTTTGTGT
AATTAAGAATTTGTACATTATTTTGTTATTAATCTGTAGATGTTACTTTC
GGAATTACGTTATGTGATGATTAATAGTTATGTTTTAAAAATTTTTTTCA
CGATTGTATCATAGTTTAATACATAATTTCTATCATTTTTTTTATTTGTA
CCCGAACATAATCA
back to top

protein sequence of SMED30005879-orf-1

>SMED30005879-orf-1 ID=SMED30005879-orf-1|Name=SMED30005879-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1335bp
MTTEYFDAANSLCSNSFELIKRRRLMSDDFKNSDLDGENLMDYSGDNFQS
EISAKASSSSIHESITNMSNSHSTPEDTFSEITLSSPTSKHCKPDSDIKD
YEPSIDQYLSNSNNDVVGNQNCNDIVKQLPTSSINLKSIDDTIELVLSKI
REENNFSKNLDSSDSCYKIKLDNYNSSDLSNCSSNINVQNNTLVSIARIT
SAKTGSHGSDNMSYSKGIISSASCLNSSIRNYGMSNYSKSYSQFYNYNYG
ISPQMAANFSNQITAPNYLEYNKMDYTRSNYLKEADKNKFFFPYQCQNPT
YRQYLPNSYNNQPFYKPDSPNIQIHNQNYQMYQKPVKRNVYPDQIYVDDD
TRLCKDNSKNPNYNIYFKTPQPNAHGLLEQGNSVRKKRTSSDSTKLTPSK
KRKLANQFSITNNYEELIRKLKISNYNSLLMNPTVSQSVIVLSPKGFIEN
SKAVNLKKSARYKKYKSTLFKLKKPKIFSDSTQEDRYLSHYVDESIAGSC
ILSQKKNLDNDELLDIICGSPGSNKVTEKSENFCLHNLATDNVDYDPASP
ELTSSCSKKKNDQSNEINFSEPKIDAINYERNHTITPIVSYTESETKLIT
ELHPTKSQELNRNYIQLSGSFLKRTKINGKSFSNIHIEEAVSIASLSASK
NQNTCYYCYAFLNGISFIKKNSKLFGMDSAEDLLFCSSSCYSNFKSYHSV
ECNLEKKSTNNTNVQCTKVLIKITPYKPAKNYKKVCDFEQYVRRRFPSEG
QGDSSVKPAVVVTDSIKKRLLGLNYSYFKTEPLKTIYKDIEKNDQNLLLK
KYSCSYRKPDLVDVRSCVLCRNVGDGDEDICGRLINIDADNWVHLNCALW
CFEVFETVSGSLMEVDSSLRKAIKTTCTCCNETGAGIQCYRSKCTNVYHV
PCAYKVGCIFYTDRGMYCPNHVVLNHPMHLPSLRVERRVNILRDESALIA
GMVTEDQDVKIKFRTGSLTLNNIGQLLPEQLISGNYNSCSIIYPVGYHST
RIYWSSTQINKRCKYECLIDESDDMPLFKVKFIDNGCENVLTDKSCDKLW
KTILNKIAKLRQDSGLTRLFPVYLSGEQLYGLTEPQIIRVIESLPGVEMI
KNYAFKFGKMQLITEMPLAINPTGSARTEPKLRTYVRRMRDYQETKFNKC
GILKAKPNNNYQPIIYDNGNLNKTALLNSKTQQYKRLKYEWRNNVILSRS
KIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARNNSIYMFR
LNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIER
GEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0042800histone methyltransferase activity (H3-K4 specific)
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
GO:0018024histone-lysine N-methyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002142parenchyma
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR013083Znf_RING/FYVE/PHD
IPR037877KMT2C
IPR034732EPHD
IPR001214SET_dom
IPR003889FYrich_C
IPR003888FYrich_N
IPR003616Post-SET_dom
Vocabulary: cellular component
TermDefinition
GO:0044666MLL3/4 complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0032259methylation
GO:0051568histone H3-K4 methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003616Post-SET domainSMARTSM00508PostSET_3coord: 1318..1334
e-value: 1.5E-5
score: 34.4
IPR003616Post-SET domainPROSITEPS50868POST_SETcoord: 1318..1334
score: 9.74
IPR003888FY-rich, N-terminalSMARTSM00541fyrn_3coord: 980..1021
e-value: 2.3E-7
score: 40.5
IPR003888FY-rich, N-terminalPFAMPF05964FYRNcoord: 966..1019
e-value: 6.4E-16
score: 57.9
IPR003888FY-rich, N-terminalPROSITEPS51542FYRNcoord: 960..1022
score: 24.596
IPR001214SET domainSMARTSM00317set_7coord: 1193..1315
e-value: 9.1E-34
score: 128.2
IPR001214SET domainPFAMPF00856SETcoord: 1204..1308
e-value: 1.2E-14
score: 55.1
IPR001214SET domainPROSITEPS50280SETcoord: 1193..1309
score: 17.139
IPR003889FY-rich, C-terminalSMARTSM00542fyrc_3coord: 1027..1113
e-value: 5.8E-18
score: 75.7
IPR003889FY-rich, C-terminalPFAMPF05965FYRCcoord: 1026..1108
e-value: 2.6E-23
score: 82.0
IPR003889FY-rich, C-terminalPROSITEPS51543FYRCcoord: 1023..1107
score: 27.332
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 1125..1334
e-value: 1.2E-49
score: 171.2
NoneNo IPR availablePFAMPF13832zf-HC5HC2H_2coord: 816..912
e-value: 5.8E-11
score: 42.5
NoneNo IPR availableGENE3DG3DSA:3.30.160.360coord: 962..1100
e-value: 3.9E-36
score: 125.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 381..399
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 381..400
NoneNo IPR availablePANTHERPTHR45888FAMILY NOT NAMEDcoord: 794..1334
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 1180..1334
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 812..923
e-value: 9.5E-24
score: 85.8
IPR037877Histone-lysine N-methyltransferase 2CPANTHERPTHR45888:SF1HISTONE-LYSINE N-METHYLTRANSFERASE 2Ccoord: 794..1334
IPR034732Extended PHD (ePHD) domainPROSITEPS51805EPHDcoord: 814..922
score: 22.855