DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30005863
Length (bp)777
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30005863) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30005863) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30005863) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30005863) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005863

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005863SMESG000028183.1 Contig1963GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005863SMESG000074396.1 SMESG000074378.1 Contig3234GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005863SMESG000074396.1 SMESG000074378.1 Contig1963GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30005863SMESG000074396.1 SMESG000074378.1 SmedASXL_006358SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005863SMESG000074396.1 SMESG000074378.1 Contig51297uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005863SMESG000074396.1 SMESG000074378.1 Contig51297newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v6_11_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v4_11_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v6_11_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v6_11_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30005863SMESG000074396.1 SMESG000074378.1 dd_Smed_v6_11_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 102.064 bits (253), Expect = 1.785e-25
Identity = 59/145 (40.69%), Postives = 87/145 (60.00%), Query Frame = 1
Query:  301 SWVKAN-NGSIPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGAL-VGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            +W+  N  GS+PP A+ AG  +     FV RA H+G+ +P K V G  + +V +GG E +K+ +E+LV     G H  + W  ++G +VP  A+ VG   +G PLYV R + +  +  GK +P H C Y+PYGG+EHR+E  EVL
Sbjct:    5 TWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-----GDH--FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVL 142          

HSP 2 Score: 82.4185 bits (202), Expect = 3.823e-18
Identity = 49/147 (33.33%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  298 LSWVKANNGSIPPKAVRAGGQT------FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 717
             SW+ ++ GS+PP A++ G QT      +V R    G   PGK    +  +++ +GG EH    YE+LV+           W  ++G  +  G +VGG + DG  +YV R++ E  ++  K  P  GCAY+PYGG E    + E+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVG-QTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET--------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 77.411 bits (189), Expect = 2.511e-16
Identity = 48/144 (33.33%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  301 SWVKANNGSIPPKAV-----RAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGA-LVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            +W+ ++   I P  V       G Q +V RA H+G  +P K +      +V +GG E  K+ YE+L          GY W   +  NVP  A L G  +DG PL++ R+     +  GK +  H C Y+P+ GEE R+++ EVL
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAG-------YGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 102.064 bits (253), Expect = 1.785e-25
Identity = 59/145 (40.69%), Postives = 87/145 (60.00%), Query Frame = 1
Query:  301 SWVKAN-NGSIPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGAL-VGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            +W+  N  GS+PP A+ AG  +     FV RA H+G+ +P K V G  + +V +GG E +K+ +E+LV     G H  + W  ++G +VP  A+ VG   +G PLYV R + +  +  GK +P H C Y+PYGG+EHR+E  EVL
Sbjct:    5 TWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV-----GDH--FSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVL 142          

HSP 2 Score: 82.4185 bits (202), Expect = 3.823e-18
Identity = 49/147 (33.33%), Postives = 76/147 (51.70%), Query Frame = 1
Query:  298 LSWVKANNGSIPPKAVRAGGQT------FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 717
             SW+ ++ GS+PP A++ G QT      +V R    G   PGK    +  +++ +GG EH    YE+LV+           W  ++G  +  G +VGG + DG  +YV R++ E  ++  K  P  GCAY+PYGG E    + E+L 
Sbjct:   76 FSWIPSSGGSVPPHAIQVG-QTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET--------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 77.411 bits (189), Expect = 2.511e-16
Identity = 48/144 (33.33%), Postives = 72/144 (50.00%), Query Frame = 1
Query:  301 SWVKANNGSIPPKAV-----RAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGA-LVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            +W+ ++   I P  V       G Q +V RA H+G  +P K +      +V +GG E  K+ YE+L          GY W   +  NVP  A L G  +DG PL++ R+     +  GK +  H C Y+P+ GEE R+++ EVL
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLAG-------YGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 96.6709 bits (239), Expect = 2.745e-23
Identity = 53/142 (37.32%), Postives = 76/142 (53.52%), Query Frame = 1
Query:  301 SWVKANNGSIPPKAVRAG----GQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGG-LNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEV 711
             WV A NG +PP A+  G     Q ++ARA+H+G  IPGK    +   +V++GG EH    YE+L          G +W   +  N+P  AL  G   +G PL++ R+  +  + VGK  P HGC Y+PYGGEE   +  E+
Sbjct:  158 CWVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAG-------GGQWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          

HSP 2 Score: 51.6026 bits (122), Expect = 1.942e-7
Identity = 28/61 (45.90%), Postives = 36/61 (59.02%), Query Frame = 1
Query:  535 NGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 717
            NGE VP  AL GG +    LY+AR+  E  ++ GK +P HG  Y+ +GG EH     EVLC
Sbjct:  164 NGE-VPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLC 223          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 92.4337 bits (228), Expect = 7.649e-22
Identity = 56/155 (36.13%), Postives = 83/155 (53.55%), Query Frame = 1
Query:  271 QYGAGVELSLSWVKANNGS-IPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            Q G  V +  +WV ++  S +PP AV  G  +     +V R+ H+G+ +P K V      +V++GG EH K +YE+LV        +G+ W  ++   VP  A+  G    G PLYV R      + VGK +P HGC Y+P+GG+E R+   EVL
Sbjct:    5 QPGGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVG-------QGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 2 Score: 77.7962 bits (190), Expect = 2.028e-16
Identity = 49/145 (33.79%), Postives = 68/145 (46.90%), Query Frame = 1
Query:  304 WVKANNGSIPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTN-GENVPKGALVGG-LNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 717
            WV A+    PP AV AG  +     +  RA H+G+ +P K V      +V FGG E  K  YE+L          GY + W N G ++P  A+  G   +G  LY  R   +  +  G       C Y+PYGG E R+ + E+LC
Sbjct:  160 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLT---------GYGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          

HSP 3 Score: 72.4034 bits (176), Expect = 1.451e-14
Identity = 45/145 (31.03%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  298 LSWVKANNGSIPPKAVRAGGQ-----TFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
             +WV +++G +PP AVR+G        +V R  H G    GK    +  +++ FGG E   N YE+L++       +   W   +    P GA++ G + D  P+Y  R+  E +M+  K  P  G AY+ +GG E +  + EVL
Sbjct:   86 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIK------QQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 90.5077 bits (223), Expect = 3.697e-21
Identity = 53/145 (36.55%), Postives = 79/145 (54.48%), Query Frame = 1
Query:  301 SWVKANNGS-IPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            +WV ++  S +PP AV  G  +     +V R+ H+G+ +P K V      +V++GG EH K +YE+LV        +G+ W  ++   VP  A+  G    G PLYV R      + VGK +P HGC Y+P+GG+E R+   EVL
Sbjct:    4 TWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLVG-------QGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 2 Score: 77.7962 bits (190), Expect = 1.558e-16
Identity = 49/145 (33.79%), Postives = 68/145 (46.90%), Query Frame = 1
Query:  304 WVKANNGSIPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTN-GENVPKGALVGG-LNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLC 717
            WV A+    PP AV AG  +     +  RA H+G+ +P K V      +V FGG E  K  YE+L          GY + W N G ++P  A+  G   +G  LY  R   +  +  G       C Y+PYGG E R+ + E+LC
Sbjct:  149 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLT---------GYGYVWMNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          

HSP 3 Score: 72.4034 bits (176), Expect = 1.411e-14
Identity = 45/145 (31.03%), Postives = 72/145 (49.66%), Query Frame = 1
Query:  298 LSWVKANNGSIPPKAVRAGGQT-----FVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLN-DGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
             +WV +++G +PP AVR+G        +V R  H G    GK    +  +++ FGG E   N YE+L++       +   W   +    P GA++ G + D  P+Y  R+  E +M+  K  P  G AY+ +GG E +  + EVL
Sbjct:   75 FAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIK------QQHDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: Q5DHE4 (SJCHGC04453 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.677e-38
Identity = 65/154 (42.21%), Postives = 98/154 (63.64%), Query Frame = 1
Query:  268 SQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTK 729
            ++ G G+++ LSWV A +G++P  A+   G  +V R+KHDG +IPGK V G+N  +    G E     YE+L ++S+ G +KGYEW+  +G NVPK A++ G++   PLY+AR  +  ++ VGK +  H CAY P+GG EH V + EVL +  K
Sbjct:    2 AKIGKGIQIPLSWVPATDGNVPHNAINVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVLVWKKK 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A0R3T053 (DUF3421 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS165 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.190e-37
Identity = 67/155 (43.23%), Postives = 96/155 (61.94%), Query Frame = 1
Query:  268 SQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGL-NDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTK 729
            ++ G G ++ +SWV      +PP A+  G   +VAR   DG+ IPGK+VE Y   +VS+GG EH     EIL ++ +      YEW+  +G NVPK A+VGG+  DG PLY+ R+ ++ +  VGK +  H CAY+P+GGEEH VE+ +VLC   K
Sbjct:    2 AKVGKGFQIGVSWVPLKGRGVPPGAIDIGDGVYVARGCKDGEQIPGKYVEKYGTCYVSYGGAEHELKECEILCDTCISSTGCCYEWREDSGGNVPKNAIVGGIAEDGEPLYICRAKVDGEKCVGKVHNGHDCAYIPHGGEEHSVEDYKVLCLRKK 156          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A4Z2D8K2 (Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003361 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.478e-37
Identity = 65/149 (43.62%), Postives = 96/149 (64.43%), Query Frame = 1
Query:  268 SQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            ++ G G+++ LSWV A +G++P  AV   G  +V R+KHDG +IPGK V G+N  +    G E     YE+L ++S+ G +KGYEW+  +G NVPK A++ G++   PLY+AR  +  ++ VGK +  H CAY P+GG EH V + EVL
Sbjct:    2 AKIGKGIQIPLSWVPATDGNVPHNAVNVSGDIYVIRSKHDGHWIPGKAVIGHNTAYYPMNGQEIKTREYEVLCDTSLSGHNKGYEWESESGGNVPKNAIIAGMSGNDPLYIARGSVNGEVCVGKVHYGHNCAYFPWGGNEHSVNDYEVL 150          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A5J4NEV5 (DUF3421 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014321 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.522e-37
Identity = 67/150 (44.67%), Postives = 92/150 (61.33%), Query Frame = 1
Query:  268 SQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLND-GAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVL 714
            S+ G G ++ LSW+ A  G +PPKA+ AGG  +V R  H G  IPGK +  +   + S  G EH  + YE+L ++        Y W++ +G +VPK A+V GL D G+PLY+AR  I  + VVGK +  H CAY PYGGEEHR+ + EVL
Sbjct:    2 SKIGRGFQVGLSWIHAEGGHVPPKAIDAGGGVYVGRMHHAGDLIPGKVIPRFGHAYCSHAGQEHTHSSYEVLCDTCAPSTRHCYRWEYASGGHVPKSAIVAGLADNGSPLYIARVEINGERVVGKVHDGHPCAYFPYGGEEHRMPDYEVL 151          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H8B2 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012514g1 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.218e-36
Identity = 72/155 (46.45%), Postives = 101/155 (65.16%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHR-VENAEVL 714
            MS+V+     G+EL LSW  A+NG IP  AV+AG   +VARAKH+G+++PGK   G+   +V +G  E   + YE+LV S +     GY+W    G +VPKGALV G ++GAPLYVAR+  E ++  GK  P   CAY+ +GG+EH+ V++ EVL
Sbjct:    1 MSRVNHNDIEGIELCLSWHPASNGDIPAGAVKAGEDCYVARAKHEGEWVPGKLSAGHTSAYVPYGDEEVPYSEYEVLVSSEIGHFGCGYQWLPAKGNSVPKGALVSGYDNGAPLYVARATFEGEVCCGKAQPDLECAYISWGGKEHKIVDDYEVL 155          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 331.643 bits (849), Expect = 6.738e-117
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 735
            MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074378.1 (SMESG000074378.1)

HSP 1 Score: 331.643 bits (849), Expect = 6.738e-117
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 735
            MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074377.1 (SMESG000074377.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.701e-61
Identity = 92/159 (57.86%), Postives = 119/159 (74.84%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTK 729
            MSKVSSQYG GVE+ +SW KA+NG IP + V+AGG+ FV RA+ +GQYIPGK  EG+  V+VS+GG E   N YE LVE+++L  + G++WK+ +G NVP GA+VGG ++G PLY+ARS +  + VVGKY+P HGCAY P+GGEEHR    EVLC   K
Sbjct:    1 MSKVSSQYGKGVEICVSWQKASNGEIPHRTVKAGGKCFVGRAQQNGQYIPGKLYEGHKGVYVSYGGKEICVNNYEALVETNVL-HNDGFQWKYVDGNNVPSGAIVGGTDNGQPLYIARSEVNGEPVVGKYFPPHGCAYFPFGGEEHRKTGVEVLCCVAK 158          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029910.1 (SMESG000029910.1)

HSP 1 Score: 176.792 bits (447), Expect = 9.767e-56
Identity = 80/161 (49.69%), Postives = 116/161 (72.05%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 735
            MSKV +QYG  VE+S+SW +A++GSIP  AV+A G  FVARAKH+G+YIPGK V G++ VFV + G E  K++Y++LV++S+L    GYEWKW+    +P  A++GG ++G PL++ +S +E + VVGK++P HGCA++PY G E      E+LC   KH+
Sbjct:    1 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPT-TGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSIVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 160          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029913.1 (SMESG000029913.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.487e-55
Identity = 82/161 (50.93%), Postives = 114/161 (70.81%), Query Frame = 1
Query:  253 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 735
            MSK+ S+YG  VE+S+SW+   +G+IP KAV AG   +VARAKH  +YIPGKFV+G+   +VS+ G E AK+ Y+ILV+SS+LGG    EW +T G  +P  ++VGG ++  PLY+A+S I  ++VVGKY P+  C + PYGG+EHR    E+LC TTK +
Sbjct:    1 MSKIVSEYGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGG-PSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMVEILCCTTKQL 160          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133211.785e-2540.69gene:FBgn0033787 transcript:FBtr0345371[more]
CG133211.785e-2540.69gene:FBgn0033787 transcript:FBtr0087792[more]
CG105272.745e-2337.32gene:FBgn0034583 transcript:FBtr0071541[more]
CG442507.649e-2236.13gene:FBgn0265185 transcript:FBtr0339105[more]
CG442503.697e-2136.55gene:FBgn0265185 transcript:FBtr0339104[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q5DHE43.677e-3842.21SJCHGC04453 protein OS=Schistosoma japonicum OX=61... [more]
A0A0R3T0531.190e-3743.23DUF3421 domain-containing protein OS=Rodentolepis ... [more]
A0A4Z2D8K21.478e-3743.62Natterin-4 OS=Schistosoma japonicum OX=6182 GN=EWB... [more]
A0A5J4NEV55.522e-3744.67DUF3421 domain-containing protein OS=Paragonimus w... [more]
A0A1I8H8B21.218e-3646.45DUF3421 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074396.16.738e-117100.00SMESG000074396.1[more]
SMESG000074378.16.738e-117100.00SMESG000074378.1[more]
SMESG000074377.11.701e-6157.86SMESG000074377.1[more]
SMESG000029910.19.767e-5649.69SMESG000029910.1[more]
SMESG000029913.12.487e-5550.93SMESG000029913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005863 ID=SMED30005863|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=777bp
CTTTAACTTTCGACCTAGGCCTTTCATAGCCGACTTATTTACGACGTGCA
CAATAGTGATTATTTTGCAAGGGCAAAGTTCAAAATTATTAATCAAGTAT
TATTATTAAACTGTTGTTAAGTTTTGCGGACTTACAGTCAATGATCGGAC
GCACGAGAATTTACTGAAAAGGATCAACTAAACCATTCAATTGGTGCATG
CATTTGCTATATATAGTAATAGAATGTTACAGGCAGTTCAGTTGATTTCA
AAATGAGTAAAGTGTCTAGCCAATATGGAGCAGGAGTTGAATTGTCCTTG
TCTTGGGTAAAAGCTAACAATGGGAGCATTCCCCCTAAAGCTGTCCGTGC
TGGAGGTCAAACCTTTGTAGCAAGAGCCAAACATGACGGACAGTACATTC
CTGGAAAATTTGTCGAAGGTTATAATGAAGTCTTTGTTTCATTTGGTGGA
GTTGAACATGCTAAAAATTACTATGAAATATTGGTTGAGTCGAGCATGTT
GGGAGGTCACAAGGGTTACGAATGGAAATGGACAAATGGAGAGAATGTAC
CTAAGGGTGCACTTGTTGGTGGACTTAATGACGGAGCGCCACTTTACGTA
GCAAGAAGTTTTATCGAAGATCAAATGGTTGTTGGAAAATACTATCCTCA
ACATGGATGTGCTTATATGCCATACGGTGGTGAGGAGCATCGTGTGGAGA
ATGCTGAAGTCTTATGTTTTACAACCAAGCACGTTTAATATTGGAAAATA
AAGAAAAATAATATCAAGATCGGAAGA
back to top

protein sequence of SMED30005863-orf-1

>SMED30005863-orf-1 ID=SMED30005863-orf-1|Name=SMED30005863-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=162bp
MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIP
GKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVP
KGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVEN
AEVLCFTTKHV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0000421tail
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 15..80
e-value: 1.9E-9
score: 47.4
coord: 88..157
e-value: 5.2E-21
score: 85.8
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 34..148
e-value: 1.9E-30
score: 105.2
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 11..159