GRANULINS domain-containing protein

Overview
NameGRANULINS domain-containing protein
Smed IDSMED30005855
Length (bp)949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GRANULINS domain-containing protein (SMED30005855) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GRANULINS domain-containing protein (SMED30005855) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005855

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
sperm ductSMED30005855SMESG000049067.1 DN304193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
seminal vesicleSMED30005855SMESG000049067.1 DN304193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
sperm ductSMED30005855SMESG000049067.1 DN304193.1ncbi_smed_estsPMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
seminal vesicleSMED30005855SMESG000049067.1 DN304193.1ncbi_smed_estsPMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GRANULINS domain-containing protein vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 78.5666 bits (192), Expect = 1.095e-15
Identity = 58/201 (28.86%), Postives = 80/201 (39.80%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            CP++ VCD    KC+ K+N                    ++L K P   VG  +C +E   PD Y      CC ++   +GCCP+   +CC D++HCC +   CDT    C      V +           +EK                +   N   C    TCC  + QG  CCP +  VCC D+  CCP  F C   G
Sbjct:  247 CPQDTVCDLIQSKCLSKENATT-----------------DLLTKLPAHTVGDVKCDMEVSCPDGY-----TCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPW-----------MEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARG 414          

HSP 2 Score: 68.1662 bits (165), Expect = 3.586e-12
Identity = 55/207 (26.57%), Postives = 75/207 (36.23%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +CI                  T P  + +  +     V     +  PD    C +   CC +    YGCCP     CCSD+LHCC     CD +  KC+   +A + D+  +     V +                 +    +  C    TCC   +    CCP   AVCC D I CCP  F C
Sbjct:  154 QASCCEDRVHCCPHGAFCDLVHTRCI--------------TPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATT-DLLTKLPAHTVGD-----------------VKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 3 Score: 59.3066 bits (142), Expect = 3.362e-9
Identity = 43/143 (30.07%), Postives = 58/143 (40.56%), Query Frame = 1
Query:  415 IENPDVYDECEE--KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI--LALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            I+ PD   EC +   CC +    +GCCP     CC D +HCC     CD V+ +CI       ++  +  QR  R V                   +    + RC    TCC   +    CCP  NA CC D + CCP +  C
Sbjct:  124 IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSS-------------VMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVC 253          
BLAST of GRANULINS domain-containing protein vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 72.7886 bits (177), Expect = 9.933e-14
Identity = 58/206 (28.16%), Postives = 81/206 (39.32%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP-GGCQKN 855
            CP++ VCD    KC+ K+N                    ++L K P   VG  +C +E   PD Y      CC ++   +GCCP+   +CC D++HCC +   CDT    C      V +           +EK                +   N   C    TCC   +    CCP   AVCC D   CCP  + C+  G CQ+ 
Sbjct:   61 CPQDTVCDLIQSKCLSKENATT-----------------DLLTKLPAHTVGDVKCDMEVSCPDGY-----TCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPW-----------MEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRG 233          

HSP 2 Score: 60.077 bits (144), Expect = 1.605e-9
Identity = 44/148 (29.73%), Postives = 58/148 (39.19%), Query Frame = 1
Query:  394 IVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
             V     +  PD    C +   CC +    YGCCP     CCSD+LHCC     CD +  KC+   +A + D+  +     V +                 +    +  C    TCC   +    CCP   AVCC D I CCP  F C
Sbjct:   13 AVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATT-DLLTKLPAHTVGD-----------------VKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 142          

HSP 3 Score: 52.7582 bits (125), Expect = 3.507e-7
Identity = 39/129 (30.23%), Postives = 51/129 (39.53%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
             + CC +    +GCCP    +CCSD+ HCC          Y C+        + + QR   IV    K      S       I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  189 SDTCCQLTSGEWGCCPIPEAVCCSDHQHCC-------PQGYTCVA-------EGQCQRGSEIVAGLEKMPARRASLSHPR-DIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTC 302          
BLAST of GRANULINS domain-containing protein vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 72.7886 bits (177), Expect = 1.305e-13
Identity = 58/206 (28.16%), Postives = 81/206 (39.32%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP-GGCQKN 855
            CP++ VCD    KC+ K+N                    ++L K P   VG  +C +E   PD Y      CC ++   +GCCP+   +CC D++HCC +   CDT    C      V +           +EK                +   N   C    TCC   +    CCP   AVCC D   CCP  + C+  G CQ+ 
Sbjct:  247 CPQDTVCDLIQSKCLSKENATT-----------------DLLTKLPAHTVGDVKCDMEVSCPDGY-----TCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPW-----------MEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRG 419          

HSP 2 Score: 67.781 bits (164), Expect = 5.972e-12
Identity = 55/207 (26.57%), Postives = 75/207 (36.23%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +CI                  T P  + +  +     V     +  PD    C +   CC +    YGCCP     CCSD+LHCC     CD +  KC+   +A + D+  +     V +                 +    +  C    TCC   +    CCP   AVCC D I CCP  F C
Sbjct:  154 QASCCEDRVHCCPHGAFCDLVHTRCI--------------TPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATT-DLLTKLPAHTVGD-----------------VKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 3 Score: 58.5362 bits (140), Expect = 6.708e-9
Identity = 43/143 (30.07%), Postives = 58/143 (40.56%), Query Frame = 1
Query:  415 IENPDVYDECEE--KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI--LALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            I+ PD   EC +   CC +    +GCCP     CC D +HCC     CD V+ +CI       ++  +  QR  R V                   +    + RC    TCC   +    CCP  NA CC D + CCP +  C
Sbjct:  124 IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSS-------------VMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVC 253          

HSP 4 Score: 53.1434 bits (126), Expect = 3.446e-7
Identity = 47/194 (24.23%), Postives = 73/194 (37.63%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CDT+   C    +++  W + +   +++ P  + +    P + V        P       + CC +    +GCCP    +CCSD+ HCC          Y C+           +  LE++   +   S            I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  322 CPAGFTCDTQKGTCEQGPHQVP-W-MEKAPAHLSLPDPQALKRDVPCDNVS-----SCPS-----SDTCCQLTSGEWGCCPIPEAVCCSDHQHCC-------PQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRD--------IGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTC 488          

HSP 5 Score: 48.9062 bits (115), Expect = 8.601e-6
Identity = 48/203 (23.65%), Postives = 76/203 (37.44%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKC---ILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            C +++ C  +   C+ +    +   +   ++ M  P RR  L   P +I          D +  C   + CC      + CC     +CC D  HCC +   C+     C   +++    +F  R   +    +E  +  F                   C  +QTCC  + QG  CCP +  VCC D+  CCP  F C   G
Sbjct:  397 CSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKM--PARRASL-SHPRDI--------GCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHF-------------------CHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARG 569          
BLAST of GRANULINS domain-containing protein vs. Ensembl Human
Match: GRN (granulin precursor [Source:HGNC Symbol;Acc:HGNC:4601])

HSP 1 Score: 58.151 bits (139), Expect = 8.060e-9
Identity = 44/150 (29.33%), Postives = 59/150 (39.33%), Query Frame = 1
Query:  415 IENPDVYDECEE--KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP-GGCQKN 855
            I+ PD   EC +   CC +    +GCCP    +CC D++HCC +   CDT    C      V +           +EK                +   N   C    TCC   +    CCP   AVCC D   CCP  + C+  G CQ+ 
Sbjct:  124 IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPW-----------MEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRG 262          

HSP 2 Score: 53.1434 bits (126), Expect = 3.129e-7
Identity = 49/194 (25.26%), Postives = 73/194 (37.63%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CDT+   C    +++    + +   +++ P  + +    P + V        P       + CC +    +GCCP    +CCSD+ HCC          Y C+        + + QR   IV    K      S       I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  165 CPAGFTCDTQKGTCEQGPHQVPW--MEKAPAHLSLPDPQALKRDVPCDNVS-----SCPS-----SDTCCQLTSGEWGCCPIPEAVCCSDHQHCC-------PQGYTCVA-------EGQCQRGSEIVAGLEKMPARRASLSHPR-DIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTC 331          

HSP 3 Score: 48.9062 bits (115), Expect = 6.129e-6
Identity = 48/203 (23.65%), Postives = 76/203 (37.44%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKC---ILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            C +++ C  +   C+ +    +   +   ++ M  P RR  L   P +I          D +  C   + CC      + CC     +CC D  HCC +   C+     C   +++    +F  R   +    +E  +  F                   C  +QTCC  + QG  CCP +  VCC D+  CCP  F C   G
Sbjct:  240 CSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKM--PARRASL-SHPRDI--------GCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHF-------------------CHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARG 412          
BLAST of GRANULINS domain-containing protein vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 68.5514 bits (166), Expect = 8.295e-13
Identity = 52/189 (27.51%), Postives = 81/189 (42.86%), Query Frame = 1
Query:  301 DNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENP--DVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKN 855
             +KI + ++     + +  F   I+      +  F CR+     D   EC  +E CC +  + +GCCP    +CC D  HCC +   CD    +CI A D     ++ ++  R  +E+++F+            +      +C    TCC        CCP  NAVCC D + CCP  F C    C +N
Sbjct:   55 SDKIGVLSVCPLHSSFSFIFSIKIMRLILLFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGA-DEKHVPMKKKKPARKTVERNQFNE----------VVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQN 232          

HSP 2 Score: 47.7506 bits (112), Expect = 6.135e-6
Identity = 33/103 (32.04%), Postives = 46/103 (44.66%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRC 552
            CP    CD +  +CI  D K      +  MK   KP R+ +      E+V        PD   +C +   CC + +  YGCCP    +CC+D LHCC +   C
Sbjct:  136 CPTGTTCDPQGARCIGADEK------HVPMKK-KKPARKTVERNQFNEVVC-------PDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTC 224          
BLAST of GRANULINS domain-containing protein vs. Ensembl Celegans
Match: pgrn-1 (ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:Q7JKP2])

HSP 1 Score: 67.781 bits (164), Expect = 1.333e-12
Identity = 52/191 (27.23%), Postives = 82/191 (42.93%), Query Frame = 1
Query:  304 NKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENP--DVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            +KI + ++     + +  F   I+      +  F CR+     D   EC  +E CC +  + +GCCP    +CC D  HCC +   CD    +CI A D     ++ ++  R  +E+++F+            +      +C    TCC        CCP  NAVCC D + CCP  F C    C +N  +
Sbjct:   56 DKIGVLSVCPLHSSFSFIFSIKIMRLILLFLAVFLCRVTAHQCDAETECSDDETCCKLGDNTWGCCPMPNAVCCDDRSHCCPTGTTCDPQGARCIGA-DEKHVPMKKKKPARKTVERNQFNE----------VVCPDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAM 235          

HSP 2 Score: 60.8474 bits (146), Expect = 3.148e-10
Identity = 64/219 (29.22%), Postives = 96/219 (43.84%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCD----TVNYKCILALD--AVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQG----TLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKN 855
            CP    CD +  +CI  D K      +  MK   KP R+ +      E+V        PD   +C +   CC + +  YGCCP    +CC+D LHCC +   C     + N+  I  L   A +   R   +E +  E+     E  +S +   +  +   C     C    TCC    +     T+CCP  NA+CC +  +CCP  +HC+ GG C+K+
Sbjct:  136 CPTGTTCDPQGARCIGADEK------HVPMKK-KKPARKTVERNQFNEVVC-------PDKASKCPDGSTCCLLEQGSYGCCPVPNAVCCADMLHCCPNGFTCHGQFCSQNFAMIPHLRKFASTSIHRKPAVEFLSEEEEDDDDEESTSSEDPESDVDPIACGVGKTCPAKTTCCNVRGKNGEPKTMCCPLSNAICCEN--TCCPAGYHCVDGGKCEKH 338          
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 66.2402 bits (160), Expect = 1.322e-11
Identity = 56/220 (25.45%), Postives = 85/220 (38.64%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLY----------------EEMKNMTKPF-------RRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE+ VCD +  KC+   N+ + MW  +                E  +   +P          N +   P E  G    +   D    C +   CC  +   + CCP    +CC D +HCC   ++CD     C     +VS+   ++++    + K K +    SS    +     +   C+   TCC T      CCP   AVCC D + CCP    C
Sbjct:  210 CPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTA-ACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSW---VEKVPVRPIRKQKVAVTQVSSVSSDVPC--NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKC 423          

HSP 2 Score: 63.929 bits (154), Expect = 8.865e-11
Identity = 58/202 (28.71%), Postives = 80/202 (39.60%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            CP +  C+  +  CI K + +  W  Y ++   + P  +  LG         +C  ++    D     CC + K   GCCP+   +CC D  HCC    RCD     C+         V I +L  I   K + S            +    QC     C   +TCC T      CCP+  AVCC D   CCP  + C PGG
Sbjct:  846 CPAHYKCNLSSVSCI-KGDVVIPW--YNKIAAESTPAPKLDLGVV-------KCDEQSSCSADS---TCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCV---KTTRLYVEITQLTHIRSNKPQPS-----------VVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGG 1020          

HSP 3 Score: 63.1586 bits (152), Expect = 1.684e-10
Identity = 41/126 (32.54%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      +GCCP+   +CC+D  HCC +  +C+  +  CI        DV I    +I  E                 +    Q  CS D TCC      T CCP   AVCCPD+  CCP  + C
Sbjct:  820 CCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKG------DVVIPWYNKIAAESTPAPKLDLG------VVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRC 933          

HSP 4 Score: 58.5362 bits (140), Expect = 4.230e-9
Identity = 38/126 (30.16%), Postives = 56/126 (44.44%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   +GCCP    +CC D +HCC   ++C+     C     +V +   + ++    ++K K +    SS    +     +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  564 CCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPW---MDKVPVRPIKKQKVAVTQASSASSDVPC--NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 684          

HSP 5 Score: 55.8398 bits (133), Expect = 3.795e-8
Identity = 36/126 (28.57%), Postives = 54/126 (42.86%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   + CCP    +CC D +HCC   ++CD     C  +  +V +   ++++    + K K +    S     +A    +   C    TCC        CCP   AVCC D I CCP+   C
Sbjct:  652 CCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDSSGSVPW---VEKVPVRPIRKQKVANTKVSPVSSDVAC--NDTVACPDGSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKC 772          

HSP 6 Score: 55.0694 bits (131), Expect = 5.571e-8
Identity = 66/246 (26.83%), Postives = 88/246 (35.77%), Query Frame = 1
Query:  136 RICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDP---CP--ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFR---------CRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            R+ V L    L+  S+    ++ E    +S C+ PT     CP    E C+ ++  C P+     +  L       T+P     L K P     FR           I  PD      E  C +  + YGCCP    L CSD  HCC +   C T +  C      V   V++Q +                       +       C  D TCC        CCP   AVCC DKI CCP +  C
Sbjct:    3 RLTVCLAVVTLVICSQCPNNEVCE--AGQSCCQDPTGGFSCCPFHHGECCE-DHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC------VKRKVKVQTV-----------------------LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVC 216          

HSP 7 Score: 55.0694 bits (131), Expect = 6.370e-8
Identity = 36/126 (28.57%), Postives = 54/126 (42.86%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   + CCP    +CC D +HCC   ++CD     C     +V +   ++++    + K K +  + S     +A    +   C    TCC        CCP   AVCC D I CCP+   C
Sbjct:  476 CCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPW---VEKVPVRPIRKQKVAVTTVSPVSSDIAC--NDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKC 596          

HSP 8 Score: 52.373 bits (124), Expect = 4.173e-7
Identity = 35/126 (27.78%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  + CCP    +CC D +HCC   ++C+    KC   L      V+   ++                      +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  391 CCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPN--------VIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 508          

HSP 9 Score: 52.373 bits (124), Expect = 4.768e-7
Identity = 43/156 (27.56%), Postives = 54/156 (34.62%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA--VSFDVRIQRLERIVLEKHKXXXXXXXXXXX-------------------------XLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            +  CC      +GCCP    +CC D +HCC     CD    KC+ + +     +D    RL R   E HK                                    S  +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  181 DTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARL-RAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 335          

HSP 10 Score: 49.2914 bits (116), Expect = 4.339e-6
Identity = 49/211 (23.22%), Postives = 72/211 (34.12%), Query Frame = 1
Query:  199 LPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            LPE V  + F       CP  + CD     C      +  W     ++ + K    N         V     +  PD        CC  +   +GCCP    +CC D +HCC   ++C+     C     +V +  ++    R           + +               C +  TCC   A    CCP   AVCC D   CCP ++ C
Sbjct:  665 LPEAVCCEDFIHC----CPHGKKCDVAAGSCEDSSGSVP-WVEKVPVRPIRKQKVANTKVSPVSSDVACNDTVACPD-----GSTCCKDKDGDWGCCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPWVEKVPVHLRAGQRPSGKVKCNATH-------------GCPESSTCCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKC 852          
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 66.2402 bits (160), Expect = 1.355e-11
Identity = 56/220 (25.45%), Postives = 85/220 (38.64%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLY----------------EEMKNMTKPF-------RRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE+ VCD +  KC+   N+ + MW  +                E  +   +P          N +   P E  G    +   D    C +   CC  +   + CCP    +CC D +HCC   ++CD     C     +VS+   ++++    + K K +    SS    +     +   C+   TCC T      CCP   AVCC D + CCP    C
Sbjct:  210 CPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTA-ACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSW---VEKVPVRPIRKQKVAVTQVSSVSSDVPC--NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKC 423          

HSP 2 Score: 63.929 bits (154), Expect = 7.316e-11
Identity = 58/202 (28.71%), Postives = 80/202 (39.60%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            CP +  C+  +  CI K + +  W  Y ++   + P  +  LG         +C  ++    D     CC + K   GCCP+   +CC D  HCC    RCD     C+         V I +L  I   K + S            +    QC     C   +TCC T      CCP+  AVCC D   CCP  + C PGG
Sbjct:  670 CPAHYKCNLSSVSCI-KGDVVIPW--YNKIAAESTPAPKLDLGVV-------KCDEQSSCSADS---TCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCV---KTTRLYVEITQLTHIRSNKPQPS-----------VVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGG 844          

HSP 3 Score: 63.1586 bits (152), Expect = 1.636e-10
Identity = 41/126 (32.54%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      +GCCP+   +CC+D  HCC +  +C+  +  CI        DV I    +I  E                 +    Q  CS D TCC      T CCP   AVCCPD+  CCP  + C
Sbjct:  644 CCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKG------DVVIPWYNKIAAESTPAPKLDLG------VVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRC 757          

HSP 4 Score: 55.4546 bits (132), Expect = 4.930e-8
Identity = 66/246 (26.83%), Postives = 88/246 (35.77%), Query Frame = 1
Query:  136 RICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDP---CP--ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFR---------CRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            R+ V L    L+  S+    ++ E    +S C+ PT     CP    E C+ ++  C P+     +  L       T+P     L K P     FR           I  PD      E  C +  + YGCCP    L CSD  HCC +   C T +  C      V   V++Q +                       +       C  D TCC        CCP   AVCC DKI CCP +  C
Sbjct:    3 RLTVCLAVVTLVICSQCPNNEVCE--AGQSCCQDPTGGFSCCPFHHGECCE-DHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC------VKRKVKVQTV-----------------------LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVC 216          

HSP 5 Score: 54.6842 bits (130), Expect = 7.304e-8
Identity = 36/126 (28.57%), Postives = 54/126 (42.86%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   + CCP    +CC D +HCC   ++CD     C     +V +   ++++    + K K +  + S     +A    +   C    TCC        CCP   AVCC D I CCP+   C
Sbjct:  476 CCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPW---VEKVPVRPIRKQKVAVTTVSPVSSDIAC--NDTVACPDGSTCCKDKDGEWGCCPLPEAVCCEDFIHCCPHGKKC 596          

HSP 6 Score: 52.373 bits (124), Expect = 4.383e-7
Identity = 35/126 (27.78%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  + CCP    +CC D +HCC   ++C+    KC   L      V+   ++                      +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  391 CCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPN--------VIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 508          

HSP 7 Score: 51.9878 bits (123), Expect = 5.331e-7
Identity = 43/156 (27.56%), Postives = 55/156 (35.26%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA--VSFDVRIQRLERIVLEKHKX-------------------------XXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            +  CC      +GCCP    +CC D +HCC     CD    KC+ + +     +D    RL R   E HK                          +         S  +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  181 DTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARL-RAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 335          
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 66.2402 bits (160), Expect = 1.355e-11
Identity = 56/220 (25.45%), Postives = 85/220 (38.64%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLY----------------EEMKNMTKPF-------RRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE+ VCD +  KC+   N+ + MW  +                E  +   +P          N +   P E  G    +   D    C +   CC  +   + CCP    +CC D +HCC   ++CD     C     +VS+   ++++    + K K +    SS    +     +   C+   TCC T      CCP   AVCC D + CCP    C
Sbjct:  210 CPEDTVCDVKALKCVSSTNQELPMWDKFPARLRAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTA-ACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVSW---VEKVPVRPIRKQKVAVTQVSSVSSDVPC--NDTAACADGTTCCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKC 423          

HSP 2 Score: 63.929 bits (154), Expect = 7.120e-11
Identity = 58/202 (28.71%), Postives = 80/202 (39.60%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            CP +  C+  +  CI K + +  W  Y ++   + P  +  LG         +C  ++    D     CC + K   GCCP+   +CC D  HCC    RCD     C+         V I +L  I   K + S            +    QC     C   +TCC T      CCP+  AVCC D   CCP  + C PGG
Sbjct:  670 CPAHYKCNLSSVSCI-KGDVVIPW--YNKIAAESTPAPKLDLGVV-------KCDEQSSCSADS---TCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRCDLRRRSCV---KTTRLYVEITQLTHIRSNKPQPS-----------VVVKDVQCGGGFSCHDGETCCLTSQTTWGCCPSPKAVCCDDMQHCCPAGYKCGPGG 844          

HSP 3 Score: 62.7734 bits (151), Expect = 1.712e-10
Identity = 41/126 (32.54%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      +GCCP+   +CC+D  HCC +  +C+  +  CI        DV I    +I  E                 +    Q  CS D TCC      T CCP   AVCCPD+  CCP  + C
Sbjct:  644 CCKNIAGEWGCCPFSQAVCCTDGEHCCPAHYKCNLSSVSCIKG------DVVIPWYNKIAAESTPAPKLDLG------VVKCDEQSSCSADSTCCLLSKDETGCCPFPEAVCCPDQKHCCPEGYRC 757          

HSP 4 Score: 60.077 bits (144), Expect = 1.603e-9
Identity = 38/126 (30.16%), Postives = 56/126 (44.44%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   + CCP    +CC D +HCC   ++CD     C     +V +   ++++    + K K +  + SS    +     +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  476 CCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCDVAAGSCEDPSGSVPW---VEKVPVRPIRKQKVAVTTASSASSDVPC--NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 596          

HSP 5 Score: 55.4546 bits (132), Expect = 4.843e-8
Identity = 66/246 (26.83%), Postives = 88/246 (35.77%), Query Frame = 1
Query:  136 RICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDP---CP--ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFR---------CRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            R+ V L    L+  S+    ++ E    +S C+ PT     CP    E C+ ++  C P+     +  L       T+P     L K P     FR           I  PD      E  C +  + YGCCP    L CSD  HCC +   C T +  C      V   V++Q +                       +       C  D TCC        CCP   AVCC DKI CCP +  C
Sbjct:    3 RLTVCLAVVTLVICSQCPNNEVCE--AGQSCCQDPTGGFSCCPFHHGECCE-DHLHCCPEGMLCSVKDLTCTNATHTQPLADRTLAKKPDLPKSFRMIFSMPASESDITCPDGSSCPAEFSCLLMSTSYGCCPVAQGLACSDGKHCCPNDHECSTDSSLC------VKRKVKVQTV-----------------------LCGNGTSECPADTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVC 216          

HSP 6 Score: 52.373 bits (124), Expect = 4.706e-7
Identity = 35/126 (27.78%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  + CCP    +CC D +HCC   ++C+    KC   L      V+   ++                      +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  391 CCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPN--------VIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 508          

HSP 7 Score: 51.9878 bits (123), Expect = 5.426e-7
Identity = 43/156 (27.56%), Postives = 55/156 (35.26%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA--VSFDVRIQRLERIVLEKHKX-------------------------XXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            +  CC      +GCCP    +CC D +HCC     CD    KC+ + +     +D    RL R   E HK                          +         S  +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  181 DTTCCQADDGQWGCCPMPKAVCCDDKIHCCPEDTVCDVKALKCVSSTNQELPMWDKFPARL-RAEWEDHKQKRPETQRTTARPTGTTSTTTAANQMTTLPAEHQGVSSDVACNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 335          
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Match: grnb (granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393])

HSP 1 Score: 64.6994 bits (156), Expect = 3.932e-11
Identity = 60/232 (25.86%), Postives = 86/232 (37.07%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRILK*TICYINISV----FGILVSVTLI 927
            CP+   CD  +  C+        + L +      KP  +N +   P E+   R  +  PD   +C E   CC +    YGCCP    +CCSD  HCC     CD ++  C+ A        +I  +  +  ++                +       CS   TCC T      CCP   AVCC D       + HC P G         T+C +  S      G+ VSV  +
Sbjct:  134 CPQGTTCDLVHSMCVSTTYGSSPF-LRKFDARRRKPLEKNAV-DLPAEVNNIR-EVICPDKISKCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTCDLIHSTCLSANGVSEMATKIPAVTVLKPKEE--------------VVPCNETVACSSGTTCCKTPEGSWACCPLPKAVCCED-------HIHCCPEG---------TLCNVAASSCDDPAGLSVSVPWM 332          

HSP 2 Score: 64.6994 bits (156), Expect = 4.004e-11
Identity = 41/127 (32.28%), Postives = 55/127 (43.31%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQ-RLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      YGCCP     CCSD+LHCC+    CD  + KC+     + +  +++ +L+ +V                        +  C  D TCC     G  CCP KNAVCC D+  CCP    C
Sbjct:   34 CCLTPSGGYGCCPLPHAECCSDHLHCCYQGTLCDLEHSKCVNKTHVLDWVEKVEAKLQAVVCPD--------------------GESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTC 140          

HSP 3 Score: 58.151 bits (139), Expect = 5.344e-9
Identity = 43/139 (30.94%), Postives = 61/139 (43.88%), Query Frame = 1
Query:  424 PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVS-FDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            PD   EC +   CC +    +GCCP    +CC D  HCC     CD V+  C+      S F  +     R  LEK+     ++ ++   +   ++   +C +D TCC        CCP   AVCC D+  CCP    C
Sbjct:   96 PDGESECPDDTTCCQMPDGGWGCCPMKNAVCCDDRKHCCPQGTTCDLVHSMCVSTTYGSSPFLRKFDARRRKPLEKNAVDLPAEVNNIREVICPDKIS-KCPEDTTCCLLETGSYGCCPMPKAVCCSDQKHCCPEGTTC 233          

HSP 4 Score: 52.373 bits (124), Expect = 4.563e-7
Identity = 48/198 (24.24%), Postives = 72/198 (36.36%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD  +  C+  +   +M T    +  + KP           E+V       N  V       CC   +  + CCP    +CC D++HCC     C+     C    D     V +  +E++  +               +A     +C     C  + TCC   +    CCP   AVCC D + CCP+   C
Sbjct:  227 CPEGTTCDLIHSTCLSANGVSEMATKIPAV-TVLKPKE---------EVVPC-----NETVACSSGTTCCKTPEGSWACCPLPKAVCCEDHIHCCPEGTLCNVAASSCD---DPAGLSVSVPWMEKVSTKP--------------IAPPPNKKCDESSSCPGESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVC 392          

HSP 5 Score: 51.6026 bits (122), Expect = 7.785e-7
Identity = 39/135 (28.89%), Postives = 51/135 (37.78%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP--GGCQK 852
            CC +    +GCCP +  +CC D+ HCC     C      C  A   VS  +   ++  I  +                        RC+  Q+CC        CCP   AVCC D   CCP  + C P   GC K
Sbjct:  605 CCILPTGQWGCCPLVKAVCCEDHEHCCPQGYICKLELGTCEKASADVSVSLTAVQMPEIQCDTFT---------------------RCAHTQSCCRLADSTWACCPYTQAVCCKDMKHCCPMGYKCDPKVQGCTK 718          

HSP 6 Score: 51.6026 bits (122), Expect = 8.212e-7
Identity = 34/134 (25.37%), Postives = 55/134 (41.04%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQ-----CRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            E  CC +    +GCCP    +CC D++HCC     C+     C    D+    + +  +++I                 ++++ ++ Q       C    TCC   +    CCP   AVCC D+  CCP  + C
Sbjct:  357 ESTCCKLSSGDWGCCPLPEAVCCEDHVHCCPHGSVCNVAAETCETVSDS-GLRISVPMVKKI----------------PAVSVPSQKQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTC 473          

HSP 7 Score: 50.8322 bits (120), Expect = 1.247e-6
Identity = 60/241 (24.90%), Postives = 87/241 (36.10%), Query Frame = 1
Query:  133 SRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI-LALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTL-CCPTKNAVCCPDKISCCPYNFHC 831
            S  C     C  L+        LPE V     CE     CP   VC+   + C          T+ +    ++ P  + I        V    + +N D    C     CC +    + CCP    +CC+D  HCC     CD     C+   L ++++     R E  + E  +              + +R+ C     C +D TCC  +  G   CCP   AVCC D   CCP  + C
Sbjct:  351 SSSCPGESTCCKLSSGDWGCCPLPEAVC----CEDHVHCCPHGSVCNVAAETCE---------TVSDSGLRISVPMVKKI------PAVSVPSQKQNCDETSSCPTGTTCCKLTSGSWACCPMPQAVCCADQEHCCPQGYTCDLAQSSCVRSGLPSMAW----FRKEPALRETQR--------------VEDRHMCDAQTSCPRDDTCCFINRIGKWGCCPLPKAVCCKDGDHCCPSGYTC 554          
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 58.9214 bits (141), Expect = 1.238e-9
Identity = 37/126 (29.37%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   + CCP    +CC D +HCC   ++C+     C     +V +   + ++    ++K K +    SS    +     +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:  142 CCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKCNVAAGSCDDPSGSVPW---MDKVPVRPIKKQKVAVTQASSASSDVPC--NDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 262          

HSP 2 Score: 53.1434 bits (126), Expect = 1.107e-7
Identity = 35/126 (27.78%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  + CCP    +CC D +HCC   ++C+    KC   L      V+   ++                      +   +   C    TCC T   G  CCP   AVCC D I CCP+   C
Sbjct:   57 CCKTKEGDWACCPLPEAVCCEDFVHCCPKGKKCNIAAMKCEDPLCTEEPLVKQTPVQSTTTPN--------VIGTQKSDVPCNDTAACPDGSTCCKTKDGGWACCPLPEAVCCEDFIHCCPHGKKC 174          
BLAST of GRANULINS domain-containing protein vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 68.9366 bits (167), Expect = 2.873e-12
Identity = 66/237 (27.85%), Postives = 92/237 (38.82%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIV---GFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGC 846
             L   C++ + S      +P+ V     C+     CP N  CD +  +CI   + I  W      +  ++  +   LG     +    G  C    PD        CC      YGCC  L+ +CCSD+LHCC     CD V+ KC+            Q  E  +L +     E  ++     A  +     C    TCC   ++   CCP   AVCC D I CCP  F C  G C
Sbjct:  130 TLTTCCMMSDMSSWGCCPMPQAVC----CDDHMHCCPHNSECDVQQGRCISNQDHIP-WMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFC----PD-----GSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV-----------SQTGEGPLLPQMPAIREESANQVPCDATTS-----CPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSC 336          

HSP 2 Score: 62.003 bits (149), Expect = 5.423e-10
Identity = 54/205 (26.34%), Postives = 82/205 (40.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
            CP    CD  +KKC+ +  +     L  +M  +    R     + P +          PD     +  CC++    +GCCPY   +CC D++HCC S   C      C+LA  ++ +      + + + +  K                 R QC     C + +TCC   +    CCP   AVCC D + CCP  + C  G C K
Sbjct:  248 CPGGTTCDLVHKKCVSQTGEGP---LLPQMPAI----REESANQVPCDAT-----TSCPD-----KNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS--GGSCVLAEHSIPW------MRKTLAQGLKT---------------TRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSK 412          

HSP 3 Score: 55.4546 bits (132), Expect = 6.554e-8
Identity = 36/137 (26.28%), Postives = 56/137 (40.88%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            + CC +    +GCCP    +CC D+ HCC     C     +C++   ++ +  +   L++   +                 +   +   C+  QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  519 QTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GSQCMIGEHSIPWFSKTPALKQKAKD-----------------VQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 636          

HSP 4 Score: 53.9138 bits (128), Expect = 1.896e-7
Identity = 38/138 (27.54%), Postives = 55/138 (39.86%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            +E CC +    +GCCP +  +CC+D+LHCC     C     +C     ++ +  +   L     +                 +   +   C   QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  370 KETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARD-----------------VECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 488          
BLAST of GRANULINS domain-containing protein vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 68.5514 bits (166), Expect = 3.420e-12
Identity = 66/237 (27.85%), Postives = 92/237 (38.82%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIV---GFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGC 846
             L   C++ + S      +P+ V     C+     CP N  CD +  +CI   + I  W      +  ++  +   LG     +    G  C    PD        CC      YGCC  L+ +CCSD+LHCC     CD V+ KC+            Q  E  +L +     E  ++     A  +     C    TCC   ++   CCP   AVCC D I CCP  F C  G C
Sbjct:  130 TLTTCCMMSDMSSWGCCPMPQAVC----CDDHMHCCPHNSECDVQQGRCISNQDHIP-WMSKLPARVKSEGLKLVGLGDEERRVPCLDGTFC----PD-----GSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCV-----------SQTGEGPLLPQMPAIREESANQVPCDATTS-----CPDKNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCSGGSC 336          

HSP 2 Score: 61.6178 bits (148), Expect = 7.249e-10
Identity = 54/205 (26.34%), Postives = 82/205 (40.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
            CP    CD  +KKC+ +  +     L  +M  +    R     + P +          PD     +  CC++    +GCCPY   +CC D++HCC S   C      C+LA  ++ +      + + + +  K                 R QC     C + +TCC   +    CCP   AVCC D + CCP  + C  G C K
Sbjct:  248 CPGGTTCDLVHKKCVSQTGEGP---LLPQMPAI----REESANQVPCDAT-----TSCPD-----KNTCCHLSSEKWGCCPYAQAVCCDDHIHCCPSGFTCS--GGSCVLAEHSIPW------MRKTLAQGLKT---------------TRVQCDDTASCPEKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSK 412          

HSP 3 Score: 55.4546 bits (132), Expect = 6.170e-8
Identity = 36/137 (26.28%), Postives = 56/137 (40.88%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            + CC +    +GCCP    +CC D+ HCC     C     +C++   ++ +  +   L++   +                 +   +   C+  QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  561 QTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GSQCMIGEHSIPWFSKTPALKQKAKD-----------------VQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 678          

HSP 4 Score: 53.1434 bits (126), Expect = 3.515e-7
Identity = 57/237 (24.05%), Postives = 81/237 (34.18%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNI-LGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLER------------------------------IVLEKHKXXXXXXXXXXXXLA---IWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            CP    C     +C   ++ I  ++    +K   K    N  +  F G IV         D Y      CC +    +GCCP    +CCSD+ HCC     CD     C+L   ++ +  ++  L                                 V EK         +    L    +W  +Q  C   QTCC        CC     VCCPD + CCPY + C+  G   +R
Sbjct:  663 CPPGYTC--SGGQCQKGEHSIPWYSKTPALKQEGKCNLANTPVNVFAGNIVKCDDSFACKDGY-----TCCRMVSGVWGCCPIEKAVCCSDHWHCCPQGFTCDARG-TCVLGQFSIPWLTKVPALPFDGTHSICDDTHTCPSGTTCCPGEGGGWRCCPVEEKEAIETSPSDTSVQGLRLDYVWCDSQYACFDGQTCCRGLGGVWNCCVYTQGVCCPDMVHCCPYGYVCLNHGTSCSR 891          

HSP 5 Score: 52.7582 bits (125), Expect = 5.485e-7
Identity = 38/138 (27.54%), Postives = 56/138 (40.58%), Query Frame = 1
Query:  445 EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            +E CC +    +GCCP +  +CC+D+LHCC     C     +C     ++ +  +      +V                +  +   +   C   QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  370 KETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTP----MVFFLSLSLLSILPVVSVARDVECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 501          
BLAST of GRANULINS domain-containing protein vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 67.3958 bits (163), Expect = 9.009e-12
Identity = 67/242 (27.69%), Postives = 93/242 (38.43%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIK-MWTLYEEMKNMTKPFRRN--ILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRC---SKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
             L   C++ + S      +P+ V     C+     CP N  CD +  +CI   + I  M  L   +K+     RR   + G F             PD        CC      YGCC  L+ +CCSD+LHCC     CD V+ KC+           + ++  I  E                   + NQ  C   +K +TCC   +    CCP   AVCC D + CCP  + C  G C K
Sbjct:  150 TLTTCCMMSDMSSWGCCPMPQAVC----CDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTF------------CPD-----GSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPL---LPQMPAIREE-------------------SANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSK 348          

HSP 2 Score: 55.4546 bits (132), Expect = 5.508e-8
Identity = 49/203 (24.14%), Postives = 74/203 (36.45%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            CP    CD  +KKC+ +  +     L  +M  +    R     + P +    +             E CC +    +GCCP +  +CC+D+LHCC     C     +C     ++ +  +   L     +                 +   +   C   QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  261 CPGGTTCDLVHKKCVSQTGEGP---LLPQMPAI----REESANQVPCDATTKK-------------ETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARD-----------------VECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 424          

HSP 3 Score: 51.9878 bits (123), Expect = 8.233e-7
Identity = 33/128 (25.78%), Postives = 52/128 (40.62%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + CC +    +GCCP    +CC D+ HCC     C     +C++   ++ +  +   L++   +                 +   +   C+  QTCC   +    CCP   AVCC D   CCP  F C
Sbjct:  455 QTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GSQCMIGEHSIPWFSKTPALKQKAKD-----------------VQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTC 563          
BLAST of GRANULINS domain-containing protein vs. Ensembl Xenopus
Match: trappc11 (trafficking protein particle complex 11 [Source:Xenbase;Acc:XB-GENE-5931148])

HSP 1 Score: 67.0106 bits (162), Expect = 1.080e-11
Identity = 67/242 (27.69%), Postives = 93/242 (38.43%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIK-MWTLYEEMKNMTKPFRRN--ILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRC---SKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
             L   C++ + S      +P+ V     C+     CP N  CD +  +CI   + I  M  L   +K+     RR   + G F             PD        CC      YGCC  L+ +CCSD+LHCC     CD V+ KC+           + ++  I  E                   + NQ  C   +K +TCC   +    CCP   AVCC D + CCP  + C  G C K
Sbjct:  130 TLTTCCMMSDMSSWGCCPMPQAVC----CDDHMHCCPHNSECDVQQGRCISNQDHIPWMSKLPARVKSEGDEERRVPCLDGTF------------CPD-----GSTCCEQVDHTYGCCSILSAVCCSDHLHCCPGGTTCDLVHKKCVSQTGEGPL---LPQMPAIREE-------------------SANQVPCDATTKKETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCSQGECSK 328          

HSP 2 Score: 55.4546 bits (132), Expect = 6.418e-8
Identity = 49/203 (24.14%), Postives = 74/203 (36.45%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNR 858
            CP    CD  +KKC+ +  +     L  +M  +    R     + P +    +             E CC +    +GCCP +  +CC+D+LHCC     C     +C     ++ +  +   L     +                 +   +   C   QTCC   +    CCP   AVCC D   CCP  + C  G CQK  
Sbjct:  241 CPGGTTCDLVHKKCVSQTGEGP---LLPQMPAI----REESANQVPCDATTKK-------------ETCCRLVSGKWGCCPVVKAVCCNDHLHCCPEGYTCS--QGECSKMEHSIPWFTKTPALTHEARD-----------------VECDDMYSCPDGQTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCSGGQCQKGE 404          

HSP 3 Score: 51.6026 bits (122), Expect = 1.003e-6
Identity = 33/128 (25.78%), Postives = 52/128 (40.62%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + CC +    +GCCP    +CC D+ HCC     C     +C++   ++ +  +   L++   +                 +   +   C+  QTCC   +    CCP   AVCC D   CCP  F C
Sbjct:  435 QTCCRLASGDWGCCPIAQAVCCDDHEHCCPPGYTCS--GSQCMIGEHSIPWFSKTPALKQKAKD-----------------VQCDDMYSCADGQTCCRLASGDWGCCPIAQAVCCSDHWHCCPQGFTC 543          
BLAST of GRANULINS domain-containing protein vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 72.7886 bits (177), Expect = 9.901e-14
Identity = 71/251 (28.29%), Postives = 111/251 (44.22%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDP---CP-ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI---QRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKNRIL 864
            V L F V+   +KT   Q P+     + CE PT     CP  N +C +++  C P+D    +     + K ++K +  ++L K PG  V   +C +E   P+ Y      CC +    +GCCP+   +CC D++HCC +  +C T    C + +  V +  ++    RL    + K     +  +              RC  + TCC  ++    CCP   AVCC D   CCP  F C+  G CQK   +
Sbjct:  212 VSLPFSVVCPDAKT---QCPDD---STCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLI----QSKCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGY-----TCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFT--------------RCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTM 433          

HSP 2 Score: 64.6994 bits (156), Expect = 4.442e-11
Identity = 53/205 (25.85%), Postives = 76/205 (37.07%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +C+       +   +   K        N     P  +V    + + PD     +  CC +    YGCCP    +CCSD+LHCC     CD +  KC+           + +L    +++ K                   +  C +  TCC  +     CCP   AVCC D I CCP  F C
Sbjct:  166 QASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKT-------NRAVSLPFSVVCPDAKTQCPD-----DSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDL---LTKLPGYPVKEVKCDM----------------EVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQC 339          

HSP 3 Score: 56.6102 bits (135), Expect = 2.044e-8
Identity = 38/141 (26.95%), Postives = 58/141 (41.13%), Query Frame = 1
Query:  415 IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            ++ P    EC +   CC +    +GCCP     CC D +HCC     CD V+ +C+                  +L+K      +++       +    + +C  D TCC        CCP  NA+CC D + CCP +  C
Sbjct:  136 VQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGT-----------HTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 265          

HSP 4 Score: 54.6842 bits (130), Expect = 8.738e-8
Identity = 52/217 (23.96%), Postives = 74/217 (34.10%), Query Frame = 1
Query:  214 VKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDE---CEE--------KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
             K   CE     CP    C TE   C              EM  +  P+ + ++            R+ +P +      C++         CC +    +GCCP    +CCSDN HCC          + C+        D  +  LE+I   +                I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  321 AKAVCCEDHIHCCPAGFQCHTEKGTC--------------EMGILQVPWMKKVIAPL---------RLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQ-------GFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGD--------IGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 499          
BLAST of GRANULINS domain-containing protein vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 55.4546 bits (132), Expect = 2.824e-8
Identity = 37/126 (29.37%), Postives = 51/126 (40.48%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC +    +GCCP    +CCSDN HCC          + C+        D  +  LE+I   +        ++      I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:   11 CCKLNSGDWGCCPIPEAVCCSDNQHCCPQ-------GFTCLAQGYCQKGDTMVAGLEKIPARQ--------TTPLQIGDIGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 121          
BLAST of GRANULINS domain-containing protein vs. Ensembl Mouse
Match: Grn (granulin [Source:MGI Symbol;Acc:MGI:95832])

HSP 1 Score: 48.1358 bits (113), Expect = 4.515e-6
Identity = 59/227 (25.99%), Postives = 85/227 (37.44%), Query Frame = 1
Query:  193 FQLPEKVVKKSFCETPTDP---CPENEVC---DTENKKC--IPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIV----LEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
             +LP+  + KS  +TP D    CP N  C   ++ +  C  IP+    K  T+   ++ +  P R+      P +I    C     D +  C   + CC   K  + CC     +CC D  HCC +   C+     C   +D +   V +    ++      E H                       C  +QTCC   A    CCP    VCC D   CCP  FHC
Sbjct:   28 LRLPDPQILKS--DTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEGYCQKGDTMVAGLEKI--PARQTT----PLQIGDIGC-----DQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARTCEKDVDFIQPPVLLTLGPKVGNVECGEGH----------------------FCHDNQTCCKDSAGVWACCPYLKGVCCRDGRHCCPGGFHC 219          
BLAST of GRANULINS domain-containing protein vs. UniProt/SwissProt
Match: sp|P28799|GRN_HUMAN (Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.268e-13
Identity = 58/206 (28.16%), Postives = 81/206 (39.32%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP-GGCQKN 855
            CP++ VCD    KC+ K+N                    ++L K P   VG  +C +E   PD Y      CC ++   +GCCP+   +CC D++HCC +   CDT    C      V +           +EK                +   N   C    TCC   +    CCP   AVCC D   CCP  + C+  G CQ+ 
Sbjct:  247 CPQDTVCDLIQSKCLSKENATT-----------------DLLTKLPAHTVGDVKCDMEVSCPDGY-----TCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPW-----------MEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRG 419          

HSP 2 Score: 67.781 bits (164), Expect = 2.868e-11
Identity = 55/207 (26.57%), Postives = 75/207 (36.23%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +CI                  T P  + +  +     V     +  PD    C +   CC +    YGCCP     CCSD+LHCC     CD +  KC+   +A + D+  +     V +                 +    +  C    TCC   +    CCP   AVCC D I CCP  F C
Sbjct:  154 QASCCEDRVHCCPHGAFCDLVHTRCI--------------TPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATT-DLLTKLPAHTVGD-----------------VKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTC 328          

HSP 3 Score: 58.5362 bits (140), Expect = 3.222e-8
Identity = 43/143 (30.07%), Postives = 58/143 (40.56%), Query Frame = 1
Query:  415 IENPDVYDECEE--KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI--LALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            I+ PD   EC +   CC +    +GCCP     CC D +HCC     CD V+ +CI       ++  +  QR  R V                   +    + RC    TCC   +    CCP  NA CC D + CCP +  C
Sbjct:  124 IQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSS-------------VMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVC 253          

HSP 4 Score: 53.1434 bits (126), Expect = 1.655e-6
Identity = 47/194 (24.23%), Postives = 73/194 (37.63%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CDT+   C    +++  W + +   +++ P  + +    P + V        P       + CC +    +GCCP    +CCSD+ HCC          Y C+           +  LE++   +   S            I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  322 CPAGFTCDTQKGTCEQGPHQVP-W-MEKAPAHLSLPDPQALKRDVPCDNVS-----SCPS-----SDTCCQLTSGEWGCCPIPEAVCCSDHQHCC-------PQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRD--------IGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTC 488          
BLAST of GRANULINS domain-containing protein vs. UniProt/SwissProt
Match: sp|P28798|GRN_MOUSE (Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 6.908e-13
Identity = 71/251 (28.29%), Postives = 111/251 (44.22%), Query Frame = 1
Query:  145 VLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDP---CP-ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI---QRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKNRIL 864
            V L F V+   +KT   Q P+     + CE PT     CP  N +C +++  C P+D    +     + K ++K +  ++L K PG  V   +C +E   P+ Y      CC +    +GCCP+   +CC D++HCC +  +C T    C + +  V +  ++    RL    + K     +  +              RC  + TCC  ++    CCP   AVCC D   CCP  F C+  G CQK   +
Sbjct:  199 VSLPFSVVCPDAKT---QCPDD---STCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDL----IQSKCLSKNYTTDLLTKLPGYPVKEVKCDMEVSCPEGY-----TCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQCHTEKGTCEMGILQVPWMKKVIAPLRLPDPQILKSDTPCDDFT--------------RCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQGFTCLAQGYCQKGDTM 420          

HSP 2 Score: 64.6994 bits (156), Expect = 2.991e-10
Identity = 53/205 (25.85%), Postives = 76/205 (37.07%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +C+       +   +   K        N     P  +V    + + PD     +  CC +    YGCCP    +CCSD+LHCC     CD +  KC+           + +L    +++ K                   +  C +  TCC  +     CCP   AVCC D I CCP  F C
Sbjct:  153 QASCCEDRVHCCPHGASCDLVHTRCVSPTGTHTLLKKFPAQKT-------NRAVSLPFSVVCPDAKTQCPD-----DSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCLSKNYTTDL---LTKLPGYPVKEVKCDM----------------EVSCPEGYTCCRLNTGAWGCCPFAKAVCCEDHIHCCPAGFQC 326          

HSP 3 Score: 56.6102 bits (135), Expect = 1.455e-7
Identity = 38/141 (26.95%), Postives = 58/141 (41.13%), Query Frame = 1
Query:  415 IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            ++ P    EC +   CC +    +GCCP     CC D +HCC     CD V+ +C+                  +L+K      +++       +    + +C  D TCC        CCP  NA+CC D + CCP +  C
Sbjct:  123 VQCPGSQFECPDSATCCIMVDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCVSPTGT-----------HTLLKKFPAQKTNRAVSLPFSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 252          

HSP 4 Score: 54.6842 bits (130), Expect = 5.896e-7
Identity = 52/217 (23.96%), Postives = 74/217 (34.10%), Query Frame = 1
Query:  214 VKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDE---CEE--------KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
             K   CE     CP    C TE   C              EM  +  P+ + ++            R+ +P +      C++         CC +    +GCCP    +CCSDN HCC          + C+        D  +  LE+I   +                I       C   QTCCP+      CC   +AVCC D+  CCP  + C
Sbjct:  308 AKAVCCEDHIHCCPAGFQCHTEKGTC--------------EMGILQVPWMKKVIAPL---------RLPDPQILKSDTPCDDFTRCPTNNTCCKLNSGDWGCCPIPEAVCCSDNQHCCPQ-------GFTCLAQGYCQKGDTMVAGLEKIPARQTTPLQIGD--------IGCDQHTSCPVGQTCCPSLKGSWACCQLPHAVCCEDRQHCCPAGYTC 486          
BLAST of GRANULINS domain-containing protein vs. UniProt/SwissProt
Match: sp|P23785|GRN_RAT (Progranulin OS=Rattus norvegicus OX=10116 GN=Grn PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 1.652e-11
Identity = 62/221 (28.05%), Postives = 95/221 (42.99%), Query Frame = 1
Query:  229 CETPTDP---CP-ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVG-FRCRIEN--PDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKN 855
            CE PT     CP  N +C +++  C P+D    +     + K ++K +  +++ K PG  V   +C +E   PD Y      CC +    +GCCP+   +CC D++HCC +  +C T    C L +  V +  ++     +   +                + N   C     C  + TCC   +    CCP   AVCC D   CCP  F C+  G CQK 
Sbjct:  220 CELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLI----QSKCISKDYTTDLMTKLPGYPVNEVKCDLEVSCPDGY-----TCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQCHTETGTCELGVLQVPWMKKVTASLSLPDPQ---------------ILKNDVPCDDFSSCPSNNTCCRLSSGDWGCCPMPEAVCCLDHQHCCPQGFKCMDEGYCQKG 416          

HSP 2 Score: 62.7734 bits (151), Expect = 1.155e-9
Identity = 59/212 (27.83%), Postives = 78/212 (36.79%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGE-----IVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +CI                  T P    +L KFP +     +  F   +  PD   +C  +  CC +    YGCCP    +CCSD+LHCC     CD +  KCI           + +L    + + K                   +  C    TCC  +     CCP   AVCC D I CCP  F C
Sbjct:  153 QASCCEDRVHCCPHGASCDLVHTRCI--------------SPTGTHP----LLKKFPAQRTNRAVASFS--VVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVCDLIQSKCISKDYTTDL---MTKLPGYPVNEVKCDL----------------EVSCPDGYTCCRLNTGAWGCCPFTKAVCCEDHIHCCPAGFQC 325          

HSP 3 Score: 56.225 bits (134), Expect = 1.535e-7
Identity = 41/143 (28.67%), Postives = 56/143 (39.16%), Query Frame = 1
Query:  415 IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI--QRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            ++ P    EC +   CC +    +GCCP     CC D +HCC     CD V+ +CI          +   QR  R V                   +    + +C  D TCC        CCP  NA+CC D + CCP +  C
Sbjct:  123 VQCPGSQFECPDSATCCIMIDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHTRCISPTGTHPLLKKFPAQRTNRAVAS--------------FSVVCPDAKTQCPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCPQDTVC 251          
BLAST of GRANULINS domain-containing protein vs. UniProt/SwissProt
Match: sp|P28797|GRN_CAVPO (Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 5.384e-11
Identity = 58/212 (27.36%), Postives = 83/212 (39.15%), Query Frame = 1
Query:  217 KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWT-LYEEMKNMTKPFRRNILGKFPGEI-VGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN---RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + S CE     CP    CD  + +C+       + T L  +  N T      ++   PG +       +  PD   +C +   CC +    YGCCP    +CCSD+LHCC     CD    +C+            Q   + +L K             S  +W+     +  C + QTCC   +    CCP   AVCC D + CCP  F C
Sbjct:  154 QASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVV--SPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVCDLRQSRCL-----------SQNKAKTLLTK-----------LPSWTVWDVECDQEVSCPEGQTCCRLQSGKWGCCPFPKAVCCEDHVHCCPEGFRC 341          

HSP 2 Score: 63.929 bits (154), Expect = 6.152e-10
Identity = 42/144 (29.17%), Postives = 63/144 (43.75%), Query Frame = 1
Query:  415 IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI--QRLERIVLEKHKXXXXXXXXXXXXLA-IWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            ++ P    EC +   CC++    +GCCP     CC D +HCC     CD V+ +C+ AL +     ++  QR      E                + I   ++ +C  D TCC   +    CCP  NA+CC D + CCP +  C
Sbjct:  124 VQCPGGEFECPDSSTCCHMLDGSWGCCPMPQASCCEDRVHCCPHGASCDLVHIRCVTALGSHPLTTKLPAQRTNYTGAEGTPVVSPGLLPAALPTSVICPDSRSQCPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCPQDTVC 267          
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Match: K1PAM6 (Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10005248 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 7.688e-14
Identity = 65/196 (33.16%), Postives = 80/196 (40.82%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  CD  + KC   D  I  W  +E+M     P      G+  GE     C    PD   ECE+   CC +    YGCCP    +CCSD++HCC    +CD    KCI    A    + +  ++     + K   E               Q  C   QTCC T A    CCP   AVCC D   CCP    C
Sbjct:  565 CPENTKCDVSSGKCTRGDGLIVDW--FEKM-----PLAVRSRGQ--GEASSVMC----PDGASECEDGQTCCLLASGKYGCCPIQDAVCCSDHVHCCPQGTKCDIQEKKCIGKPAANLGVISMDMIQIQGKGQEKSHPELLLKLPTENVECPDGQSECKTGQTCCKTAAGNYGCCPLPKAVCCSDMKHCCPEGTTC 747          

HSP 2 Score: 68.9366 bits (167), Expect = 4.117e-9
Identity = 55/196 (28.06%), Postives = 77/196 (39.29%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD  + KC                 N    +  + + K P  +      +  PD   EC++   CC +    +GCCP    +CCSD  HCC  + +C+    KCI A D++S D      E++   + +              +    Q +C   QTCC        CCP   AVCC D   CCP N  C
Sbjct:  336 CPEGTTCDVSSGKC-----------------NRGSTYVMDWMDKQPAVVRAGS--VMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPESTKCEVSQGKCIRA-DSLSMDW----FEKLPALRTRN------------VVCPDGQSQCKDGQTCCKLATGQYGCCPIPKAVCCSDGKHCCPENTQC 495          

HSP 3 Score: 65.855 bits (159), Expect = 4.070e-8
Identity = 56/196 (28.57%), Postives = 78/196 (39.80%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE+  C+    KCI  D+    W  +E++  +     RN++                PD   +C++   CC +    YGCCP    +CCSD  HCC    +CD  + KC    D +S D       ++   + K              +    Q  C   QTCC   +    CCP   AVCC D   CCP N  C
Sbjct:  413 CPESTKCEVSQGKCIRADSLSMDW--FEKLPALR---TRNVV---------------CPDGQSQCKDGQTCCKLATGQYGCCPIPKAVCCSDGKHCCPENTQCDVSSGKCKRG-DELSMDW----FAKLPALRSKN------------VVCPDGQSECKTSQTCCKLASGNYGCCPIPKAVCCSDMKHCCPENTKC 571          

HSP 4 Score: 65.855 bits (159), Expect = 4.417e-8
Identity = 58/197 (29.44%), Postives = 76/197 (38.58%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCR-IENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  CD  + KC   D     W                   K P      R + +  PD   EC+  + CC +    YGCCP    +CCSD  HCC    +CD  + KC    D +  D           EK   +  S+   + S  +       C   QTCC   +    CCP ++AVCC D + CCP    C
Sbjct:  489 CPENTQCDVSSGKCKRGDELSMDW-----------------FAKLPA----LRSKNVVCPDGQSECKTSQTCCKLASGNYGCCPIPKAVCCSDMKHCCPENTKCDVSSGKCTRG-DGLIVD---------WFEKMPLAVRSRGQGEASSVMCPDGASECEDGQTCCLLASGKYGCCPIQDAVCCSDHVHCCPQGTKC 654          

HSP 5 Score: 62.7734 bits (151), Expect = 3.880e-7
Identity = 52/200 (26.00%), Postives = 72/200 (36.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA----LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD  + KC                 N    +  + + K P  +      +  PD   EC++   CC +    +GCCP    +CCSD  HCC    +C+    KC+      LD +  +  + R + +V                        Q  C   QTCC   +    CCP   AVCC D   CCP    C
Sbjct:  182 CPEGTTCDVSSGKC-----------------NRGSTYVMDWMDKQPAVVRAGS--VMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPENTKCEVSQGKCMRGTGEMLDWLKKEPAMLRSKNVVCPD--------------------GQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTC 342          

HSP 6 Score: 62.3882 bits (150), Expect = 5.323e-7
Identity = 52/200 (26.00%), Postives = 71/200 (35.50%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA----LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD  + KC   +  +  W                 + K P  +      +  PD   EC++   CC +    +GCCP    +CC+D  HCC    +C+    KC+      LD    +  + R E +V                        Q  C   QTCC   +    CCP   AVCC D   CCP    C
Sbjct:   28 CPEGTTCDVSSGKCKRGNTYVMDW-----------------MDKQPAVVRAGS--VMCPDGQHECKDGQTCCKLASGQWGCCPIPKAVCCNDGKHCCPENTKCEVSQGKCMRGTGEMLDWFEKEPALVRSENVVCPD--------------------GQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTC 188          

HSP 7 Score: 61.6178 bits (148), Expect = 9.230e-7
Identity = 56/203 (27.59%), Postives = 72/203 (35.47%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIEN---PDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKC----ILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  C+    KC+    ++  W                   K P  +     R EN   PD   EC+  + CC +    YGCCP    +CCSD  HCC     CD  + KC       +D +     + R   ++                        Q  C   QTCC   +    CCP   AVCC D   CCP N  C
Sbjct:  105 CPENTKCEVSQGKCMRGTGEMLDW-----------------FEKEPALV-----RSENVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPD--------------------GQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPENTKC 265          

HSP 8 Score: 60.8474 bits (146), Expect = 1.933e-6
Identity = 52/200 (26.00%), Postives = 70/200 (35.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKC----ILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  C+    KC+    ++  W   E     +K                    +  PD   EC+  + CC +    YGCCP    +CCSD  HCC     CD  + KC       +D +     + R   ++                        Q  C   QTCC   +    CCP   AVCC D   CCP +  C
Sbjct:  259 CPENTKCEVSQGKCMRGTGEMLDWLKKEPAMLRSK-------------------NVVCPDGQSECKSGQTCCKLASGNYGCCPIPKAVCCSDMKHCCPEGTTCDVSSGKCNRGSTYVMDWMDKQPAVVRAGSVMCPD--------------------GQHECKDGQTCCKLASGQWGCCPIPKAVCCSDGKHCCPESTKC 419          
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Match: A0A498MSN0 (tRNA pseudouridine(38 39) synthase-like isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_022070 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.065e-13
Identity = 75/257 (29.18%), Postives = 103/257 (40.08%), Query Frame = 1
Query:  175 FSKTDTFQLPEKVVKKSF--CETPTDPCPENEVCDTENKKCIPKD-NKIKMWTLYEEMKNMTKPFRRNI--LGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGCQKNRILK*TICYI-NISVFGILVS 915
             +KT T    EKV  K    CE     CP+   CD E+ KC+        +W  +   +   KP +R    L K  G++    C    PD    C  +  CC +    YGCCP    +CCSD+LHCC     CD V+ KC+ A             + I+++       +    +  L   N     C    TCC T      CCP   AVCC D I CCP +  C    G C     L  ++ ++  +  F I  S
Sbjct:  468 VNKTHTLDWVEKVATKPAVCCEDKQHCCPQGTKCDLEHSKCVSATYGPSPLWRKFAARRR--KPLKRTAVALPKDSGDVGDVIC----PDEISTCPDDTTCCKLDTGSYGCCPMPNAVCCSDHLHCCPEATTCDIVHSKCVSA-------------DGIMVKMATKIPATSLKPEEKLVPCNET-VACESGTTCCKTQKGTWACCPLPKAVCCEDHIHCCPQDTVCNVAAGSCDDPADLSVSVPWVAKVPTFAIAPS 704          
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Match: A0A498LBB0 (tRNA pseudouridine(38 39) synthase-like isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_034801 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.076e-13
Identity = 75/257 (29.18%), Postives = 103/257 (40.08%), Query Frame = 1
Query:  175 FSKTDTFQLPEKVVKKSF--CETPTDPCPENEVCDTENKKCIPKD-NKIKMWTLYEEMKNMTKPFRRNI--LGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGCQKNRILK*TICYI-NISVFGILVS 915
             +KT T    EKV  K    CE     CP+   CD E+ KC+        +W  +   +   KP +R    L K  G++    C    PD    C  +  CC +    YGCCP    +CCSD+LHCC     CD V+ KC+ A             + I+++       +    +  L   N     C    TCC T      CCP   AVCC D I CCP +  C    G C     L  ++ ++  +  F I  S
Sbjct:  468 VNKTHTLDWVEKVATKPAVCCEDKQHCCPQGTKCDLEHSKCVSATYGPSPLWRKFAARRR--KPLKRTAVALPKDSGDVGDVIC----PDEISTCPDDTTCCKLDTGSYGCCPMPNAVCCSDHLHCCPEATTCDIVHSKCVSA-------------DGIMVKMATKIPATSLKPEEKLVPCNET-VACESGTTCCKTQKGTWACCPLPKAVCCEDHIHCCPQDTVCNVAAGSCDDPADLSVSVPWVAKVPTFAIAPS 704          
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Match: A0A0B5A1B9 (Granulin epithelin variant 3 OS=Pinctada fucata OX=50426 GN=GEP PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.187e-13
Identity = 76/274 (27.74%), Postives = 108/274 (39.42%), Query Frame = 1
Query:   64 RLPSIPLYIPGCIKLLFITMRVI----SRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGC-QKNRIL 864
            ++P+ P+  PG    + ++  VI       C     C  L+  K     L E V     C      CP++  C+  + KC   D  +  W L    + M      N++                PD    C   + CC      YGCCP    +CC+D+LHCC     C+  N +C         D  I  LE++  EK      +  S      +    Q  C   QTCC   +    CCP+K+AVCC D + CCP+   C  GGC   N+IL
Sbjct:  794 KVPAKPVSTPG--AKIAVSKEVICPDKQSQCKEGQTCCKLSSGKYGCCPLKEAVC----CSDEIHCCPKDTTCEPSSGKCQRGDGLVMDWFLKLPAQKMLTVSDNNVI---------------CPDGRSACPNGQTCCKTNTGAYGCCPLPQAVCCADHLHCCPHGYSCN--NGRCQRG------DKFINWLEKLPSEK----IITDVSTSVQNVVCPDGQSECHDGQTCCKLASGNYGCCPSKDAVCCADHVHCCPHGTTCSTGGCTHGNKIL 1034          

HSP 2 Score: 75.8702 bits (185), Expect = 2.422e-11
Identity = 56/203 (27.59%), Postives = 83/203 (40.89%), Query Frame = 1
Query:  229 CETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            C   T  CP    CDT    C   DN +  W  +E++  + +  +  +                 PD   +C +K  CC +    YGCCP +  +CC D+ HCC     C+T   +C+   ++      I  LE+++  K +      S       +    Q  C   QTCC   + G  CCP  +AVCC D   CCP  + C
Sbjct:  353 CSDHTHCCPHGTTCDTSTGHCNRGDNLVMDW--FEKVPALRRISKEVVC----------------PDGQSQCSDKETCCKLASGAYGCCPRINAVCCEDHKHCCPEGTTCETSKGRCMRQDNST-----ITWLEKVLARKTEDKGSLSS------VVCPDGQSECKSGQTCCKLTSGGYGCCPIPSAVCCEDGEHCCPSGYTC 526          

HSP 3 Score: 74.7146 bits (182), Expect = 5.187e-11
Identity = 58/196 (29.59%), Postives = 87/196 (44.39%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  +KKCI    K +M  +  EM   T+P R+  L             +  PD   +C   + CC +   ++GCCP    +CCSD  HCC +  +CD  + KCI A ++V+  +     +++  ++ K              +   NQ +C    TCC        CCP + A CC D+  CCP N  C
Sbjct:  602 CPQGTTCDIADKKCIGSRQKFEM--IITEMM-TTQPARKVSLE-----------YVICPDKSSQCPTGQTCCPLVDGHFGCCPTPNAVCCSDRRHCCLAGSQCDVRDGKCIKADNSVTNWLEKVPAQKVEQKEEKPGDP---------VVCPGNQFQCEYKHTCCKLDNGTWACCPLQEADCCADQNYCCPVNTQC 774          

HSP 4 Score: 73.1738 bits (178), Expect = 1.957e-10
Identity = 60/197 (30.46%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTL-CCPTKNAVCCPDKISCCPYNFHC 831
            CPE   C+T   +C+ +DN    W        + K   R    K  G +    C    PD   EC+  + CC +    YGCCP  + +CC D  HCC S   CD   +KC          V ++RL       H               +    Q  C   QTCC    Q +  CCP ++AVCC D I CCP    C
Sbjct:  438 CPEGTTCETSKGRCMRQDNSTITW--------LEKVLARKTEDK--GSLSSVVC----PDGQSECKSGQTCCKLTSGGYGCCPIPSAVCCEDGEHCCPSGYTCDNAQHKCN---KNEGTSVMMRRLRTAKNIPHPPPHS---------VMCPDGQSECMDGQTCCLLEDQTSYGCCPIEDAVCCLDHIHCCPQGTTC 608          

HSP 5 Score: 70.8626 bits (172), Expect = 1.131e-9
Identity = 57/210 (27.14%), Postives = 84/210 (40.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGE--IVGFRCRIEN---PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGCQK 852
            CP +  CD  +  C  K N +  W                 L K P    I       +N   PD   +C++   CC +    YGCCP    +CCSD++HCC    +CD  + KC+   + + +   +++L  + +                  +    Q  C +  TCC   +    CCP  NAVCC D + CCP  + C    G CQK
Sbjct: 1180 CPHDYTCDVSSGHCT-KGNNVIAW-----------------LEKLPSTKLITDVSVSTQNVICPDGQSQCKDGSTCCKLASGQYGCCPIPKAVCCSDHVHCCPHDYKCDVSSGKCMKGNNLIDW---LEKLPSMKVTSEVAVTVQNI-------VCPDGQSECKEGSTCCKLASGQYGCCPKPNAVCCADHVHCCPQGYTCDVSAGTCQK 1361          

HSP 6 Score: 70.0922 bits (170), Expect = 1.690e-9
Identity = 53/169 (31.36%), Postives = 72/169 (42.60%), Query Frame = 1
Query:  379 KFPGEIVGFRCRIEN---PDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRN-----QCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKN 855
            K P        R  N   PD   +C+  E CC ++   YGCCP    +CC D  HCC    +C+                 R  R  RIV+++ K     +++ +  +   NRN     Q  C   QTCC     G  CCP  + VCCPDK+ CCP    C  G C ++
Sbjct:  141 KVPAMTKAVNIRANNVTCPDGQSQCKTGETCCKLKSGTYGCCPLPDAVCCKDEKHCCSKGTKCE---------------GTRCVRDGRIVMDQVKKVPAMKNAVKIRV---NRNVVCPDQSECPNGQTCCQLANSGYGCCPNTDGVCCPDKLHCCPQYTSCDNGNCVRD 291          

HSP 7 Score: 69.3218 bits (168), Expect = 3.471e-9
Identity = 61/209 (29.19%), Postives = 86/209 (41.15%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP--GGCQKNRIL 864
            C     CD  + KCI  DN +  W      + + +   +      PG+ V        P    +CE K  CC +    + CCP     CC+D  +CC    +C+T   KC  A D +  D  ++   + V         S+        I    Q +C + QTCC   +    CCP K AVCC D+I CCP +  C P  G CQ+   L
Sbjct:  684 CLAGSQCDVRDGKCIKADNSVTNWLEKVPAQKVEQKEEK------PGDPVVC------PGNQFQCEYKHTCCKLDNGTWACCPLQEADCCADQNYCCPVNTQCNTAQGKCT-AGDTIVMDWFVKVPAKPVSTPGAKIAVSKE------VICPDKQSQCKEGQTCCKLSSGKYGCCPLKEAVCCSDEIHCCPKDTTCEPSSGKCQRGDGL 873          

HSP 8 Score: 68.9366 bits (167), Expect = 4.126e-9
Identity = 59/204 (28.92%), Postives = 81/204 (39.71%), Query Frame = 1
Query:  229 CETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVR-KSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CE     CP    CD    KC   +    M       KN+  P   +++                PD   EC   + CC +  ++ YGCCP    +CC D++HCC     CD  + KCI +          Q+ E I+ E        + S ++ +     +Q  C   QTCCP       CCPT NAVCC D+  CC     C
Sbjct:  513 CEDGEHCCPSGYTCDNAQHKCNKNEGTSVMMRRLRTAKNIPHPPPHSVM---------------CPDGQSECMDGQTCCLLEDQTSYGCCPIEDAVCCLDHIHCCPQGTTCDIADKKCIGSR---------QKFEMIITEMMTTQPARKVSLEYVICPDKSSQ--CPTGQTCCPLVDGHFGCCPTPNAVCCSDRRHCCLAGSQC 690          

HSP 9 Score: 66.6254 bits (161), Expect = 2.540e-8
Identity = 41/126 (32.54%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC +    YGCCP    +CC+D++HCC     CD  + KC    + + +      LE++  +K      S  S      I    Q +C++  TCC   +    CCP  NAVCC D + CCP+++ C
Sbjct: 1071 CCQLASGQYGCCPKPNAVCCADHIHCCPEGTTCDVSSGKCNKGNNVIDW------LEKLPSKK----LTSDVSVSTKKVICPDGQSQCNEGSTCCKLASGQYGCCPQPNAVCCADHVHCCPHDYTC 1186          

HSP 10 Score: 65.855 bits (159), Expect = 4.299e-8
Identity = 55/197 (27.92%), Postives = 80/197 (40.61%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAV-SFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  N  C+ +D ++    + E+M  ++       +     +++     I  PD    C   + CC +    YGCCP    +CCSD+ HCC     CDT    C    + V  +  ++  L RI  E                 +    Q +CS  +TCC   +    CCP  NAVCC D   CCP    C
Sbjct:  277 CPQYTSCD--NGNCV-RDGEV----VIEQMSKLS------AVKSVKADVMRVAANITCPDGQSTCHTGQTCCKLASGLYGCCPVPNAVCCSDHTHCCPHGTTCDTSTGHCNRGDNLVMDWFEKVPALRRISKE----------------VVCPDGQSQCSDKETCCKLASGAYGCCPRINAVCCEDHKHCCPEGTTC 444          
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Match: A0A0B4ZY93 (Granulin epithelin variant 2 OS=Pinctada fucata OX=50426 GN=GEP PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.509e-13
Identity = 76/274 (27.74%), Postives = 108/274 (39.42%), Query Frame = 1
Query:   64 RLPSIPLYIPGCIKLLFITMRVI----SRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGC-QKNRIL 864
            ++P+ P+  PG    + ++  VI       C     C  L+  K     L E V     C      CP++  C+  + KC   D  +  W L    + M      N++                PD    C   + CC      YGCCP    +CC+D+LHCC     C+  N +C         D  I  LE++  EK      +  S      +    Q  C   QTCC   +    CCP+K+AVCC D + CCP+   C  GGC   N+IL
Sbjct:  782 KVPAKPVSTPG--AKIAVSKEVICPDKQSQCKEGQTCCKLSSGKYGCCPLKEAVC----CSDEIHCCPKDTTCEPSSGKCQRGDGLVMDWFLKLPAQKMLTVSDNNVI---------------CPDGRSACPNGQTCCKTNTGAYGCCPLPQAVCCADHLHCCPHGYSCN--NGRCQRG------DKFINWLEKLPSEK----IITDVSTSVQNVVCPDGQSECHDGQTCCKLASGNYGCCPSKDAVCCADHVHCCPHGTTCSTGGCTHGNKIL 1022          

HSP 2 Score: 75.485 bits (184), Expect = 2.827e-11
Identity = 56/203 (27.59%), Postives = 83/203 (40.89%), Query Frame = 1
Query:  229 CETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            C   T  CP    CDT    C   DN +  W  +E++  + +  +  +                 PD   +C +K  CC +    YGCCP +  +CC D+ HCC     C+T   +C+   ++      I  LE+++  K +      S       +    Q  C   QTCC   + G  CCP  +AVCC D   CCP  + C
Sbjct:  341 CSDHTHCCPHGTTCDTSTGHCNRGDNLVMDW--FEKVPALRRISKEVVC----------------PDGQSQCSDKETCCKLASGAYGCCPRINAVCCEDHKHCCPEGTTCETSKGRCMRQDNST-----ITWLEKVLARKTEDKGSLSS------VVCPDGQSECKSGQTCCKLTSGGYGCCPIPSAVCCEDGEHCCPSGYTC 514          

HSP 3 Score: 74.7146 bits (182), Expect = 5.729e-11
Identity = 58/196 (29.59%), Postives = 87/196 (44.39%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  +KKCI    K +M  +  EM   T+P R+  L             +  PD   +C   + CC +   ++GCCP    +CCSD  HCC +  +CD  + KCI A ++V+  +     +++  ++ K              +   NQ +C    TCC        CCP + A CC D+  CCP N  C
Sbjct:  590 CPQGTTCDIADKKCIGSRQKFEM--IITEMM-TTQPARKVSLE-----------YVICPDKSSQCPTGQTCCPLVDGHFGCCPTPNAVCCSDRRHCCLAGSQCDVRDGKCIKADNSVTNWLEKVPAQKVEQKEEKPGDP---------VVCPGNQFQCEYKHTCCKLDNGTWACCPLQEADCCADQNYCCPVNTQC 762          

HSP 4 Score: 73.1738 bits (178), Expect = 2.142e-10
Identity = 60/197 (30.46%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTL-CCPTKNAVCCPDKISCCPYNFHC 831
            CPE   C+T   +C+ +DN    W        + K   R    K  G +    C    PD   EC+  + CC +    YGCCP  + +CC D  HCC S   CD   +KC          V ++RL       H               +    Q  C   QTCC    Q +  CCP ++AVCC D I CCP    C
Sbjct:  426 CPEGTTCETSKGRCMRQDNSTITW--------LEKVLARKTEDK--GSLSSVVC----PDGQSECKSGQTCCKLTSGGYGCCPIPSAVCCEDGEHCCPSGYTCDNAQHKCN---KNEGTSVMMRRLRTAKNIPHPPPHS---------VMCPDGQSECMDGQTCCLLEDQTSYGCCPIEDAVCCLDHIHCCPQGTTC 596          

HSP 5 Score: 70.8626 bits (172), Expect = 1.249e-9
Identity = 57/210 (27.14%), Postives = 84/210 (40.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGE--IVGFRCRIEN---PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGCQK 852
            CP +  CD  +  C  K N +  W                 L K P    I       +N   PD   +C++   CC +    YGCCP    +CCSD++HCC    +CD  + KC+   + + +   +++L  + +                  +    Q  C +  TCC   +    CCP  NAVCC D + CCP  + C    G CQK
Sbjct: 1168 CPHDYTCDVSSGHCT-KGNNVIAW-----------------LEKLPSTKLITDVSVSTQNVICPDGQSQCKDGSTCCKLASGQYGCCPIPKAVCCSDHVHCCPHDYKCDVSSGKCMKGNNLIDW---LEKLPSMKVTSEVAVTVQNI-------VCPDGQSECKEGSTCCKLASGQYGCCPKPNAVCCADHVHCCPQGYTCDVSAGTCQK 1349          

HSP 6 Score: 68.9366 bits (167), Expect = 4.047e-9
Identity = 61/209 (29.19%), Postives = 86/209 (41.15%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP--GGCQKNRIL 864
            C     CD  + KCI  DN +  W      + + +   +      PG+ V        P    +CE K  CC +    + CCP     CC+D  +CC    +C+T   KC  A D +  D  ++   + V         S+        I    Q +C + QTCC   +    CCP K AVCC D+I CCP +  C P  G CQ+   L
Sbjct:  672 CLAGSQCDVRDGKCIKADNSVTNWLEKVPAQKVEQKEEK------PGDPVVC------PGNQFQCEYKHTCCKLDNGTWACCPLQEADCCADQNYCCPVNTQCNTAQGKCT-AGDTIVMDWFVKVPAKPVSTPGAKIAVSKE------VICPDKQSQCKEGQTCCKLSSGKYGCCPLKEAVCCSDEIHCCPKDTTCEPSSGKCQRGDGL 861          

HSP 7 Score: 68.9366 bits (167), Expect = 4.121e-9
Identity = 49/151 (32.45%), Postives = 68/151 (45.03%), Query Frame = 1
Query:  424 PDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRN-----QCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKN 855
            PD   +C+  E CC ++   YGCCP    +CC D  HCC    +C+                 R  R  RIV+++ K     +++ +  +   NRN     Q  C   QTCC     G  CCP  + VCCPDK+ CCP    C  G C ++
Sbjct:  147 PDGQSQCKTGETCCKLKSGTYGCCPLPDAVCCKDEKHCCSKGTKCE---------------GTRCVRDGRIVMDQVKKVPAMKNAVKIRV---NRNVVCPDQSECPNGQTCCQLANSGYGCCPNTDGVCCPDKLHCCPQYTSCDNGNCVRD 279          

HSP 8 Score: 68.9366 bits (167), Expect = 5.034e-9
Identity = 59/204 (28.92%), Postives = 81/204 (39.71%), Query Frame = 1
Query:  229 CETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVR-KSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CE     CP    CD    KC   +    M       KN+  P   +++                PD   EC   + CC +  ++ YGCCP    +CC D++HCC     CD  + KCI +          Q+ E I+ E        + S ++ +     +Q  C   QTCCP       CCPT NAVCC D+  CC     C
Sbjct:  501 CEDGEHCCPSGYTCDNAQHKCNKNEGTSVMMRRLRTAKNIPHPPPHSVM---------------CPDGQSECMDGQTCCLLEDQTSYGCCPIEDAVCCLDHIHCCPQGTTCDIADKKCIGSR---------QKFEMIITEMMTTQPARKVSLEYVICPDKSSQ--CPTGQTCCPLVDGHFGCCPTPNAVCCSDRRHCCLAGSQC 678          

HSP 9 Score: 66.6254 bits (161), Expect = 2.855e-8
Identity = 41/126 (32.54%), Postives = 61/126 (48.41%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC +    YGCCP    +CC+D++HCC     CD  + KC    + + +      LE++  +K      S  S      I    Q +C++  TCC   +    CCP  NAVCC D + CCP+++ C
Sbjct: 1059 CCQLASGQYGCCPKPNAVCCADHIHCCPEGTTCDVSSGKCNKGNNVIDW------LEKLPSKK----LTSDVSVSTKKVICPDGQSQCNEGSTCCKLASGQYGCCPQPNAVCCADHVHCCPHDYTC 1174          

HSP 10 Score: 65.855 bits (159), Expect = 4.743e-8
Identity = 55/197 (27.92%), Postives = 80/197 (40.61%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAV-SFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  N  C+ +D ++    + E+M  ++       +     +++     I  PD    C   + CC +    YGCCP    +CCSD+ HCC     CDT    C    + V  +  ++  L RI  E                 +    Q +CS  +TCC   +    CCP  NAVCC D   CCP    C
Sbjct:  265 CPQYTSCD--NGNCV-RDGEV----VIEQMSKLS------AVKSVKADVMRVAANITCPDGQSTCHTGQTCCKLASGLYGCCPVPNAVCCSDHTHCCPHGTTCDTSTGHCNRGDNLVMDWFEKVPALRRISKE----------------VVCPDGQSQCSDKETCCKLASGAYGCCPRINAVCCEDHKHCCPEGTTC 432          
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 70.0922 bits (170), Expect = 5.654e-13
Identity = 61/200 (30.50%), Postives = 82/200 (41.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA-LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCR-----CSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            C E  +CD E+ KC+ K + +  W        M  P R+  L   P  +V      E PD     +  CC +    +GCCP    +CC D +HCC     CD  + KC+ + L +V    +    +R   +  K       S+   LA  N   C      C  D TCCP       CCP   AVCC D + CCP    C
Sbjct:   58 CHEGTLCDLEHSKCVNKTHTLD-WV-------MRVPIRQPSL---PQAVVCPDQESECPD-----DTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARK------DSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSC 235          

HSP 2 Score: 64.6994 bits (156), Expect = 3.188e-11
Identity = 54/210 (25.71%), Postives = 81/210 (38.57%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKD-NKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA--LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            CP+   CD  + KC+      + +   +   K      R++  G    +     C    PD    C +   CC +    YGCCP    +CCSD++HCC     CD  + KC+ +  L+ V+ ++      ++ +E                ++       C    TCC T      CCP   AVCC D I CCP    C    C  +  L
Sbjct:  136 CPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDC----PDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVE----------------SVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADL 325          

HSP 3 Score: 64.6994 bits (156), Expect = 3.460e-11
Identity = 40/126 (31.75%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      YGCCP     CCSD+LHCCH    CD  + KC+     + + +R+   +  + +                 +    +  C  D TCC        CCP  NAVCC DK+ CCP    C
Sbjct:   32 CCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQA---------------VVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTC 142          

HSP 4 Score: 60.077 bits (144), Expect = 1.064e-9
Identity = 61/240 (25.42%), Postives = 89/240 (37.08%), Query Frame = 1
Query:  160 CVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI--LALDAVSFD-VRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP--GGCQKNRIL 864
            C +  F+K     LPE V     C      CP +  CDT    C+    +I  W   +E K        + +     +    RC   +          CC +    +GCCP++  +CC D++HCC +   CD     C+    L  V+   V     E+++ +                         C++ QTCC        CCP K AVCC D   CCP  + C P   GC +   L
Sbjct:  540 CYMKKFNKWGCCPLPEAVC----CGDGDHCCPNSYTCDTTKNTCLKGHLEIP-WFKKQEAKVTQGSEVAHGVADVQCDSTA-RCPTGS---------TCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATS---------------------HCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATSL 743          

HSP 5 Score: 58.151 bits (139), Expect = 4.490e-9
Identity = 50/198 (25.25%), Postives = 79/198 (39.90%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYE-EMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRK-SYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  ++ C        +W   +  +++MT+    N        +     +    D    C  +  CCY++K + +GCCP    +CC D  HCC ++  CDT    C+     + +    ++ E  V +  + +         S A       RC    TCC        CCP   AVCC D + CCP  + C
Sbjct:  469 CPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESK-HKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPW---FKKQEAKVTQGSEVAHGVADVQCDSTA-------RCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTC 655          

HSP 6 Score: 55.4546 bits (132), Expect = 3.693e-8
Identity = 60/243 (24.69%), Postives = 90/243 (37.04%), Query Frame = 1
Query:  169 LNFSKTDTFQLPEKVVKKSFCETPTDPCP-----------ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIE----NPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVR-------IQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            L+ + ++    P+KV   SFC   T  CP              VC +++  C P+     +        N+ +P   N+       +V  +  +E    N  V  E    CC  +   + CCP    +CC D++HCC     C      C+ + D ++  VR       I R+ +   EK   +                    C K  TCC   +    CCP   AVCC D + CCP N  C
Sbjct:  180 LDLADSNDVDCPDKV---SFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNL-----SPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCVASADLLTL-VRWVEKKPTINRVPQPANEKCDPTT------------------TCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVC 393          

HSP 7 Score: 52.7582 bits (125), Expect = 2.830e-7
Identity = 34/130 (26.15%), Postives = 48/130 (36.92%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC +    +GCCP    +CC D+LHCC     C+     C  A    +  + +  + +        +                +QC     C    TCC   +    CCP   AVCC D   CCP  + C
Sbjct:  361 CCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPA---------------NDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKC 475          

HSP 8 Score: 49.2914 bits (116), Expect = 3.351e-6
Identity = 39/148 (26.35%), Postives = 63/148 (42.57%), Query Frame = 1
Query:  424 PDVYDECEEK--------CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA-LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNR--NQCRCSKDQTCCPTHA-QGTLCCPTKNAVCCPDKISCCPYNFHC 831
            P   D+C+E         CC  +   + CCP    +CC D+ HCC    +CD ++  C    L ++ +  +   L+ +  + +  +     S    +   ++   Q  C +D TCC         CCP   AVCC D   CCP ++ C
Sbjct:  425 PPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTC 572          
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Match: grnb (granulins-like [Source:NCBI gene;Acc:103046308])

HSP 1 Score: 70.0922 bits (170), Expect = 5.654e-13
Identity = 61/200 (30.50%), Postives = 82/200 (41.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA-LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCR-----CSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            C E  +CD E+ KC+ K + +  W        M  P R+  L   P  +V      E PD     +  CC +    +GCCP    +CC D +HCC     CD  + KC+ + L +V    +    +R   +  K       S+   LA  N   C      C  D TCCP       CCP   AVCC D + CCP    C
Sbjct:   58 CHEGTLCDLEHSKCVNKTHTLD-WV-------MRVPIRQPSL---PQAVVCPDQESECPD-----DTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARK------DSNGLDLADSNDVDCPDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSC 235          

HSP 2 Score: 64.6994 bits (156), Expect = 3.188e-11
Identity = 54/210 (25.71%), Postives = 81/210 (38.57%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKD-NKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA--LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            CP+   CD  + KC+      + +   +   K      R++  G    +     C    PD    C +   CC +    YGCCP    +CCSD++HCC     CD  + KC+ +  L+ V+ ++      ++ +E                ++       C    TCC T      CCP   AVCC D I CCP    C    C  +  L
Sbjct:  136 CPQGTTCDLPHSKCVSSMLGSVPLRRKFPAYKRAEWKARKDSNGLDLADSNDVDC----PDKVSFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNLSPVVRVKVTVE----------------SVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVCARSTCVASADL 325          

HSP 3 Score: 64.6994 bits (156), Expect = 3.460e-11
Identity = 40/126 (31.75%), Postives = 53/126 (42.06%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      YGCCP     CCSD+LHCCH    CD  + KC+     + + +R+   +  + +                 +    +  C  D TCC        CCP  NAVCC DK+ CCP    C
Sbjct:   32 CCQTPSGGYGCCPLPNAECCSDHLHCCHEGTLCDLEHSKCVNKTHTLDWVMRVPIRQPSLPQA---------------VVCPDQESECPDDTTCCQLPDGSWGCCPMPNAVCCEDKMHCCPQGTTC 142          

HSP 4 Score: 60.077 bits (144), Expect = 1.064e-9
Identity = 61/240 (25.42%), Postives = 89/240 (37.08%), Query Frame = 1
Query:  160 CVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI--LALDAVSFD-VRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIP--GGCQKNRIL 864
            C +  F+K     LPE V     C      CP +  CDT    C+    +I  W   +E K        + +     +    RC   +          CC +    +GCCP++  +CC D++HCC +   CD     C+    L  V+   V     E+++ +                         C++ QTCC        CCP K AVCC D   CCP  + C P   GC +   L
Sbjct:  540 CYMKKFNKWGCCPLPEAVC----CGDGDHCCPNSYTCDTTKNTCLKGHLEIP-WFKKQEAKVTQGSEVAHGVADVQCDSTA-RCPTGS---------TCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTCDLQAGTCLRTSTLHTVALTLVHTHTKEQVMCDATS---------------------HCTESQTCCKLSDTEWACCPFKQAVCCKDMKHCCPVGYVCDPKAKGCARATSL 743          

HSP 5 Score: 58.151 bits (139), Expect = 4.490e-9
Identity = 50/198 (25.25%), Postives = 79/198 (39.90%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYE-EMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRK-SYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+   CD  ++ C        +W   +  +++MT+    N        +     +    D    C  +  CCY++K + +GCCP    +CC D  HCC ++  CDT    C+     + +    ++ E  V +  + +         S A       RC    TCC        CCP   AVCC D + CCP  + C
Sbjct:  469 CPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESK-HKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTCDTTKNTCLKGHLEIPW---FKKQEAKVTQGSEVAHGVADVQCDSTA-------RCPTGSTCCRLTTGQWGCCPHVQAVCCDDHVHCCPAGYTC 655          

HSP 6 Score: 55.4546 bits (132), Expect = 3.693e-8
Identity = 60/243 (24.69%), Postives = 90/243 (37.04%), Query Frame = 1
Query:  169 LNFSKTDTFQLPEKVVKKSFCETPTDPCP-----------ENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIE----NPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVR-------IQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            L+ + ++    P+KV   SFC   T  CP              VC +++  C P+     +        N+ +P   N+       +V  +  +E    N  V  E    CC  +   + CCP    +CC D++HCC     C      C+ + D ++  VR       I R+ +   EK   +                    C K  TCC   +    CCP   AVCC D + CCP N  C
Sbjct:  180 LDLADSNDVDCPDKV---SFCPDDTTCCPLGNGSYGCCPMPKAVCCSDHVHCCPQGTSCDLAHSKCVSSNVLEPVTTNL-----SPVVRVKVTVESVPCNESVACESGSTCCKTKDGDWACCPLPEAVCCEDHIHCCPQGTVC--ARSTCVASADLLTL-VRWVEKKPTINRVPQPANEKCDPTT------------------TCPKGATCCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVC 393          

HSP 7 Score: 52.7582 bits (125), Expect = 2.830e-7
Identity = 34/130 (26.15%), Postives = 48/130 (36.92%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC +    +GCCP    +CC D+LHCC     C+     C  A    +  + +  + +        +                +QC     C    TCC   +    CCP   AVCC D   CCP  + C
Sbjct:  361 CCKMESGTWGCCPLPQAVCCEDHLHCCPRNTVCNVAAGTCDSAFSGTAGQLSVPWVRKTPATSLPPA---------------NDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKC 475          

HSP 8 Score: 49.2914 bits (116), Expect = 3.351e-6
Identity = 39/148 (26.35%), Postives = 63/148 (42.57%), Query Frame = 1
Query:  424 PDVYDECEEK--------CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILA-LDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNR--NQCRCSKDQTCCPTHA-QGTLCCPTKNAVCCPDKISCCPYNFHC 831
            P   D+C+E         CC  +   + CCP    +CC D+ HCC    +CD ++  C    L ++ +  +   L+ +  + +  +     S    +   ++   Q  C +D TCC         CCP   AVCC D   CCP ++ C
Sbjct:  425 PPANDQCDETSACPTGTTCCRQKSGAWACCPLPQAVCCDDHEHCCPQGYKCDIIHESCDHPFLPSMLWFKKQPALQSMTQQSNANAKAIAESAVADVESKHKCDAQTSCPRDNTCCYMKKFNKWGCCPLPEAVCCGDGDHCCPNSYTC 572          
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029960.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26786284:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000029960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.226e-9
Identity = 49/208 (23.56%), Postives = 76/208 (36.54%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE------EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN--------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD+ + +C+     I+  +    M    K        + P   V       +P V+ +          CC      + CCPY    CC D +HCC     CD+ + +C L   A+S     Q+   ++ E+       +      + + +         +   C    TCC T      CCP     CC D I CCP+ +HC
Sbjct:  150 CPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCTLG--ALSIRSSSQQPAMLIQEQKAVEETEEKPLATLVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 355          

HSP 2 Score: 55.4546 bits (132), Expect = 2.797e-8
Identity = 37/135 (27.41%), Postives = 55/135 (40.74%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC---------RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      + CCPY    CC D +HCC     CD+ + +C+    A+S      +   ++  K K   E++     ++   + +            C    TCC T      CCP     CC D I CCP+ +HC
Sbjct:  124 CCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQG--ALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 256          
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Match: grna (granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434])

HSP 1 Score: 60.077 bits (144), Expect = 1.303e-9
Identity = 57/221 (25.79%), Postives = 87/221 (39.37%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLYEEM--KNMTKPFRRNILGKFPGEIVGFRCRIENPD------------VYD-ECEEK--------CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN---RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN VC   + KC+   NK + MW  +      +     R+++  K P      +    N              VY+  C++         CC   +  + CCP    +CC D LHCC   ++C+ +  KC     +V +  ++    R + EK         +  F +  +N    +   C  + TCC        CCP   AVCC D I CCP+   C
Sbjct:  144 CPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRRKDLTNKQPKTSTALKSTTTNKTRNLPCALFSVCTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCEDPSGSVPWLKKVP--SRPIREKK-----LPETKGFDIPFYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCDDFIHCCPHGKKC 357          

HSP 2 Score: 56.225 bits (134), Expect = 2.392e-8
Identity = 58/226 (25.66%), Postives = 85/226 (37.61%), Query Frame = 1
Query:  166 LLNFSKTDTFQLPEKVV--KKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFP--GEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
              N    DT   P++    K S  E    P P+   CD +   C P   K  +     E  + + P+ +  L   P  G  V     +  PD     E  CC   K  + CCP    +CC D  HCC   ++C+     C     +V +  ++    R +  K     ++      + A        C  + TCC     G  CCP    VCC D+I CCP++  C
Sbjct:  308 FYNVPCNDTAACPDETTCCKDSEGEWKCCPLPQAVCCD-DFIHCCPHGKKCNLAAGTCEDPSGSVPWMKKTLPLPPALGSDVPCNDTVACPD-----ETTCCKNVKGGWNCCPLPQAVCCDDFQHCCPHGKKCNVAAGTCEDPSGSVPWIKKVP--SRPISGKKLPKVKAGVPCNATFA--------CEDESTCCKNDKGGWSCCPLPEGVCCEDRIHCCPHDATC 517          

HSP 3 Score: 54.6842 bits (130), Expect = 6.174e-8
Identity = 39/130 (30.00%), Postives = 51/130 (39.23%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            CC +    +GCCP     CC D  HCC     CD  +  C+  +        + ++E I L   +            L I       CS  +TCC T      CCP+  AVCC D   CCP  + C   G
Sbjct:  624 CCEISTGKWGCCPLPEATCCPDREHCCPKGYSCDVNSQSCVKTI--------LLQVETIPLTYIRH-----------LQIPCGGGISCSDTETCCKTSKTTWGCCPSPKAVCCSDMKHCCPAGYTCEANG 734          

HSP 4 Score: 53.1434 bits (126), Expect = 1.852e-7
Identity = 47/171 (27.49%), Postives = 64/171 (37.43%), Query Frame = 1
Query:  424 PDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALD-AVSFDVRIQRLERIVLEKH--KXXXXXXXXXXXXLAIWNRNQCR----------------------CSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGCQ 849
            PD   EC  +  CC      +GCCP    +CC+D +HCC     C   + KC+ + +  +    +     R   E H  K     Q     +L     N+ R                      C+   TCC     G  CCP   AVCC D + CCP+   C  I G C+
Sbjct:  106 PDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVCHVNSSKCVSSTNKELPMWAKFPARLRADWENHRRKDLTNKQPKTSTALKSTTTNKTRNLPCALFSVCTVYNVPCDDTVACADGTTCCKNGEGGWSCCPLPQAVCCDDFLHCCPHGKKCNLIAGKCE 276          

HSP 5 Score: 52.7582 bits (125), Expect = 3.023e-7
Identity = 45/131 (34.35%), Postives = 57/131 (43.51%), Query Frame = 1
Query:  445 EEKCCYVRKSY-YGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIW-NRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            +  CC V  S  Y CCP+    CC D+LHCC +   C T+   C        F   +  L       H+ S +S S  + +  +        C    TCCPT   G  CCP   AVCC DK+ CCP N  C
Sbjct:   28 KHTCCQVLSSGEYNCCPFPQGECCEDHLHCCPAGMLCQTLICSC--------FVNDLLFLNHCCPNDHECSADSISCVKKAEPVMCPDGVSECPVQTTCCPTTDGGWGCCPMPRAVCCADKVHCCPENSVC 150          
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000014643.2 (pep primary_assembly:Astyanax_mexicanus-2.0:23:26786284:26792241:-1 gene:ENSAMXG00000014237.2 transcript:ENSAMXT00000014643.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 5.349e-9
Identity = 50/209 (23.92%), Postives = 77/209 (36.84%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE------EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC---------RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD+ + +C+     I+  +    M    K        + P   V       +P V+ +          CC      + CCPY    CC D +HCC     CD+ + +C+    A+S      +   ++  K K   E++     +L   + +            C    TCC T      CCP     CC D I CCP+ +HC
Sbjct:  150 CPHGYHCDSTSTRCMQGALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQG--ALSIRSSSPQPAMLIQNKQKAVEETEEKPLATLVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 356          

HSP 2 Score: 55.4546 bits (132), Expect = 2.656e-8
Identity = 37/135 (27.41%), Postives = 55/135 (40.74%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC---------RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC      + CCPY    CC D +HCC     CD+ + +C+    A+S      +   ++  K K   E++     ++   + +            C    TCC T      CCP     CC D I CCP+ +HC
Sbjct:  124 CCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHCDSTSTRCMQG--ALSIRSSSPQPAMLIQNKQKAVEETEEKPSATVVELSDDSSPMVHCDSSYTCPDGTTCCRTPYGRWACCPYNMGQCCRDGIHCCPHGYHC 256          
BLAST of GRANULINS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009302.1 (pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 gene:ENSPMAG00000008413.1 transcript:ENSPMAT00000009302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 2.820e-8
Identity = 50/200 (25.00%), Postives = 74/200 (37.00%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQC----RCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP+N +CD +  KC+                 ++ P+    + K+P +      +    D +  C ++  CC +    +GCCP    +CC D  HCC     C+  +  C  A  ++ +  +   L R+  E                   N  QC     C    TCC T      CCP   AVCC D   CCP    C
Sbjct:   99 CPKNTMCDLKLGKCV--------------HGKLSIPW----VSKYPSKQAASDVQC---DAFTSCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTICNVTSQTCNHAALSLPWSTKTPAL-RMTGEP------------------NDVQCDDLVGCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTC 258          

HSP 2 Score: 51.9878 bits (123), Expect = 8.905e-8
Identity = 38/140 (27.14%), Postives = 56/140 (40.00%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC-IPGG-CQKNRI 861
            + CC +    +GCCP +  +CC D+ HCC     C+     C     ++ +  +   L R+  E +                   +Q  C    TCC T      CCP   AVCC D   CCP    C +P G C + ++
Sbjct:  536 DTCCKMPSGDWGCCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDKGALSLPWSTKTPAL-RVAGEPNDVKC--------------DDQVSCPDQTTCCKTGTGDWGCCPLVKAVCCDDHEHCCPEGTTCNVPAGSCDQGQL 660          

HSP 3 Score: 50.8322 bits (120), Expect = 2.328e-7
Identity = 54/201 (26.87%), Postives = 72/201 (35.82%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFR----RNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCI---LALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP   VCD  +  C  +  KI +  L +      + +R    R++  + P    G  C  +           CC +    YGCC     +CCSD LHCC     CD    KC+   L++  VS     Q    +  +                         CS   TCC   +    CCP   AVCC DK  CCP    C
Sbjct:   12 CPSGTVCDLAHGMC--QKGKISVPWLEKTPTFTPRTWRWRLARSLAVRPPQCPDGTSCGDD---------ATCCPLASGQYGCCSLEDAVCCSDYLHCCPKNTMCDLKLGKCVHGKLSIPWVSKYPSKQAASDVQCDAFT---------------------SCSDQNTCCILPSGQWGCCPLPKAVCCDDKEHCCPEGTIC 180          

HSP 4 Score: 48.9062 bits (115), Expect = 8.893e-7
Identity = 47/196 (23.98%), Postives = 68/196 (34.69%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCR--IENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE  +C+  ++ C      +  W+       MT            GE    +C   +  PD        CC      + CCP +  +CC D+ HCC     C+     C     ++ +  +   L R+  E +               +   +Q  C    TCC T      CCP   AVCC D   CCP    C
Sbjct:  174 CPEGTICNVTSQTCNHAALSLP-WSTKTPALRMT------------GEPNDVQCDDLVGCPD-----GNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPAL-RVAGEPN--------------VVICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTC 336          

HSP 5 Score: 48.1358 bits (113), Expect = 1.759e-6
Identity = 43/191 (22.51%), Postives = 68/191 (35.60%), Query Frame = 1
Query:  265 VCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            VC  +++ C P+     +     +   ++ P+      K P   V     +   D    C +   CC      + CCP +  +CC D+ HCC     C+     C     ++ +  +   L R+  E +               +   +Q  C    TCC   +    CCP   AVCC D   CCP    C
Sbjct:  243 VCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWST----KTPALRVAGEPNVVICDDQSSCPDGNTCCKTPGGDWACCPLVKAVCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWSTKTPAL-RVAGEPN--------------VVICDDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTC 414          

HSP 6 Score: 47.7506 bits (112), Expect = 2.176e-6
Identity = 44/191 (23.04%), Postives = 70/191 (36.65%), Query Frame = 1
Query:  265 VCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            VC  +++ C P+     +     +   ++ P+      K P   V     +   D    C +   CC +    +GCCP    +CC D+ HCC     C+    +C     ++ +  +   L R+  E +               +   +Q  C    TCC   +    CCP   AVCC D   CCP    C
Sbjct:  321 VCCDDHEHCCPQGTTCNLPAQTCDQGTLSLPWST----KTPALRVAGEPNVVICDDQSSCPDGNTCCKMPSGDWGCCPLPKAVCCDDHQHCCPEGTTCNLPVERCDKGTLSLPWSTKTPAL-RVAGEPN--------------VVICDDQFSCPDGNTCCKLPSGDWGCCPLVKAVCCDDHEHCCPQGTTC 492          
BLAST of GRANULINS domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001039.1 (pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 gene:ENSPMAG00000000936.1 transcript:ENSPMAT00000001039.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 4.067e-7
Identity = 36/129 (27.91%), Postives = 49/129 (37.98%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCI 834
            + CC  R+  +GCC      CCSD +HCC S  RC      C  + +A+S       L   +    +                      C + QTCC +      CC  + A CC D I CCP    C+
Sbjct:  460 QTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSGVAGSSTLSHALPYDSRVY--------------------CRRWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCL 568          

HSP 2 Score: 49.6766 bits (117), Expect = 5.311e-7
Identity = 40/139 (28.78%), Postives = 53/139 (38.13%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            + CC  R   +GCC      CCSD +HCC S  RC      C  + +A+S       L+ +  E+                 W          QTCC +      CC  + A CC D I CCP    C+ G C  +  L
Sbjct:   78 QTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVPYRLCSRSSEALSV------LDYLSREQQDGYNVVHCGGGQYCRRW----------QTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAAL 200          

HSP 3 Score: 48.9062 bits (115), Expect = 9.985e-7
Identity = 39/139 (28.06%), Postives = 57/139 (41.01%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            + CC  R+  +GCC      CCSD +HCC S  RC  +  +C+ +   + +  +   L   V +               +       CR  + QTCC +      CC  + A CC D I CCP    C+ G C  +  L
Sbjct:  155 QTCCRSRRGMWGCCNGRRATCCSDGIHCCPSMTRC--LVGQCVNSAALIPWLKKEAALSGPVGDN-------------VVHCGGGQYCR--RWQTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRCLVGQCVNSAAL 276          

HSP 4 Score: 46.9802 bits (110), Expect = 3.252e-6
Identity = 40/139 (28.78%), Postives = 56/139 (40.29%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRIL 864
            + CC  R   +GCC      CCSD +HCC S  RC  +  +C+ +   + +  +   L   V +               L      Q  C + QTCC +      CC  + A CC D I CCP    C+ G C  +  L
Sbjct:  231 QTCCRSRCGMWGCCNGRRATCCSDGIHCCPSMTRC--LVGQCVNSAALIPWLKKEAALSGPVGDN--------------LVHCGGGQ-YCRRWQTCCRSRCGMWGCCNGRKATCCSDGIHCCPSMTRCLVGQCVNSAAL 352          
BLAST of GRANULINS domain-containing protein vs. Ensembl Nematostella
Match: EDO27824 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T870])

HSP 1 Score: 56.9954 bits (136), Expect = 1.180e-9
Identity = 54/209 (25.84%), Postives = 77/209 (36.84%), Query Frame = 1
Query:  259 NEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKP---FRRNILGKFPGEIV---GFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIV--LEKHKXXXXXXXXXXXXLAI----------WNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            N VC ++ K C P      + +   +M   + P   +   +     GEI    G  C            E CC V  + YGCCP  + +CC+D  HCC S   C+  +  C             QR   ++   +KH       +  +  + I               C C    TCC + +    CCP  NA CC D + CCP  F C
Sbjct:   36 NAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAGVGEIKCKDGSHCNTG---------ETCCLVGPTKYGCCPLPSAVCCADMQHCCPSGYTCNDKSGHC-------------QRGRHVLPMFQKHPSVHPRPAVAKTPVIIDHTIRFVPRGGRGAGCACEPYHTCCGSSSAQQNCCPLPNASCCSDGLHCCPQGFIC 222          

HSP 2 Score: 53.1434 bits (126), Expect = 2.845e-8
Identity = 43/135 (31.85%), Postives = 55/135 (40.74%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA---VSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG 843
            E CC +    YGCCP    +CCSD  HCC     CD  +  C +A D+   VS+   +QR    V E                 I  ++   C+  +TCC        CCP  +AVCC D         HC P G
Sbjct:   19 ETCCELSTGSYGCCPLPNAVCCSDGKHCCPCGYHCDISSSTCDMAKDSTPMVSYHATVQRAG--VGE-----------------IKCKDGSHCNTGETCCLVGPTKYGCCPLPSAVCCADMQ-------HCCPSG 127          
BLAST of GRANULINS domain-containing protein vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 63.1586 bits (152), Expect = 1.316e-10
Identity = 54/224 (24.11%), Postives = 78/224 (34.82%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLY-----------EEMKNMTK-PFRRNILGKFPGEIVG--FRCRIENPDVYDECEEK---------------CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD E  KC+   +K + MW  +           +E K ++      N    FP           +E   V  E   K               CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++    ++ ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  210 CPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 419          

HSP 2 Score: 58.151 bits (139), Expect = 6.025e-9
Identity = 34/126 (26.98%), Postives = 50/126 (39.68%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++    ++ ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  545 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 656          

HSP 3 Score: 56.9954 bits (136), Expect = 1.190e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  387 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 498          

HSP 4 Score: 56.9954 bits (136), Expect = 1.190e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  466 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 577          

HSP 5 Score: 56.9954 bits (136), Expect = 1.190e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  624 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 735          

HSP 6 Score: 56.6102 bits (135), Expect = 1.585e-8
Identity = 44/175 (25.14%), Postives = 71/175 (40.57%), Query Frame = 1
Query:  316 MWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRK-SYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            M T  E  +   KP  R+    F  E       I + D + +C +   CC++++   +GCCP    +CC+D  HCC +  +C   +  C+     + +  +I   + I  +       +                +C +  +CC        CCP  NAVCC DK  CCP  + C
Sbjct:  848 MKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVH--------------QCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTC 1008          

HSP 7 Score: 54.6842 bits (130), Expect = 7.496e-8
Identity = 46/153 (30.07%), Postives = 61/153 (39.87%), Query Frame = 1
Query:  451 KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNR--NQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKNRILK*TICYINISVF 900
             CC +    +GCCP    +CC D  HCC     CD  +  C   L   +  +    L  + L   +              I NR  +   C+ D+TCC T      CC +  AVCC D   CCP  + C  GG C KN  L     ++N   F
Sbjct:  975 SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLL---TLQLETVPLTPVFLPDDQSQHGPVK------PILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTKGGSCIKNTGLH----WLNWHTF 1114          

HSP 8 Score: 54.299 bits (129), Expect = 1.071e-7
Identity = 32/126 (25.40%), Postives = 48/126 (38.10%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++    ++ ++                 +       C    TCC T      CCP   AVCC D   CCP    C
Sbjct:  703 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMED--------------VPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTC 814          

HSP 9 Score: 51.2174 bits (121), Expect = 9.206e-7
Identity = 45/168 (26.79%), Postives = 55/168 (32.74%), Query Frame = 1
Query:  427 DVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALD-AVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN------------------------------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            D   EC  E  CC  ++  + CCP    +CC D +HCC     CD    KC+ + D A+    +     R   E  K   E  +         N                                   C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  173 DGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 340          

HSP 10 Score: 49.6766 bits (117), Expect = 3.268e-6
Identity = 37/148 (25.00%), Postives = 55/148 (37.16%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRN---------------------QCRCSKDQTCC-PTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   +GCCP    +CC D+ HCC +   CD     C+ A   V    ++    R      +     Q +++      +R+                       +C +  TCC     Q   CCP   AVCC D   CCP ++ C
Sbjct:  782 CCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKC 929          
BLAST of GRANULINS domain-containing protein vs. Ensembl Medaka
Match: grna (granulins [Source:NCBI gene;Acc:101162601])

HSP 1 Score: 63.1586 bits (152), Expect = 1.456e-10
Identity = 54/224 (24.11%), Postives = 78/224 (34.82%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNK-IKMWTLY-----------EEMKNMTK-PFRRNILGKFPGEIVG--FRCRIENPDVYDECEEK---------------CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD E  KC+   +K + MW  +           +E K ++      N    FP           +E   V  E   K               CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++    ++ ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  210 CPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 419          

HSP 2 Score: 56.9954 bits (136), Expect = 1.378e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  387 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 498          

HSP 3 Score: 56.9954 bits (136), Expect = 1.378e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  466 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 577          

HSP 4 Score: 56.9954 bits (136), Expect = 1.378e-8
Identity = 34/126 (26.98%), Postives = 49/126 (38.89%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++     + ++                 +       C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  545 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSNVSVKMED--------------VPCDGSTSCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 656          

HSP 5 Score: 56.6102 bits (135), Expect = 1.663e-8
Identity = 44/175 (25.14%), Postives = 71/175 (40.57%), Query Frame = 1
Query:  316 MWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRK-SYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            M T  E  +   KP  R+    F  E       I + D + +C +   CC++++   +GCCP    +CC+D  HCC +  +C   +  C+     + +  +I   + I  +       +                +C +  +CC        CCP  NAVCC DK  CCP  + C
Sbjct:  769 MKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKCKEEDTSCVKGEVVIPWYTKIPATDSIQADSSFVQCSAVH--------------QCPEHMSCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTC 929          

HSP 6 Score: 54.6842 bits (130), Expect = 8.081e-8
Identity = 46/153 (30.07%), Postives = 61/153 (39.87%), Query Frame = 1
Query:  451 KCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNR--NQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGG-CQKNRILK*TICYINISVF 900
             CC +    +GCCP    +CC D  HCC     CD  +  C   L   +  +    L  + L   +              I NR  +   C+ D+TCC T      CC +  AVCC D   CCP  + C  GG C KN  L     ++N   F
Sbjct:  896 SCCRLFTGEWGCCPLPNAVCCGDKEHCCPEGYTCDLASKSCHKLL---TLQLETVPLTPVFLPDDQSQHGPVK------PILNRCDDVYSCNVDETCCRTSHTTWGCCLSPKAVCCRDMKHCCPDGYRCTKGGSCIKNTGLH----WLNWHTF 1035          

HSP 7 Score: 53.9138 bits (128), Expect = 1.240e-7
Identity = 32/126 (25.40%), Postives = 48/126 (38.10%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  ++  +GCCP+   +CC D +HCC   + C+     C     +V    ++    ++ ++                 +       C    TCC T      CCP   AVCC D   CCP    C
Sbjct:  624 CCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTCNLAAQTCEGDGGSVPMLEKVPSFSKVSVKMED--------------VPCDGSTSCPDQTTCCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTC 735          

HSP 8 Score: 51.2174 bits (121), Expect = 1.056e-6
Identity = 45/168 (26.79%), Postives = 55/168 (32.74%), Query Frame = 1
Query:  427 DVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALD-AVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN------------------------------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            D   EC  E  CC  ++  + CCP    +CC D +HCC     CD    KC+ + D A+    +     R   E  K   E  +         N                                   C    TCC T   G  CCP   AVCC D I CCP    C
Sbjct:  173 DGVSECPDETTCCENQEGKWACCPMPKAVCCDDKIHCCPEETTCDVEQMKCLSSSDKALPMWAKFPARTRADWENQKEGKEVSAVAVEGNETKNFPEVTTANPVPAFLEGSSVAGEASAKDIPCNETASCPDQTTCCKTQEGGWGCCPFPEAVCCEDFIHCCPKGKTC 340          

HSP 9 Score: 49.2914 bits (116), Expect = 3.463e-6
Identity = 37/148 (25.00%), Postives = 55/148 (37.16%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRN---------------------QCRCSKDQTCC-PTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CC  +   +GCCP    +CC D+ HCC +   CD     C+ A   V    ++    R      +     Q +++      +R+                       +C +  TCC     Q   CCP   AVCC D   CCP ++ C
Sbjct:  703 CCKTKDGAWGCCPLPEAVCCDDHEHCCPTGTTCDLSTLSCLKASGLVPMSKKLPASTRTSSATSQLMKTGQETEEGENKPDDRDGQEDFDEEDKTDEEGIISCDSHTQCPQHTTCCFMKQVQKWGCCPLPKAVCCADGEHCCPADYKC 850          
BLAST of GRANULINS domain-containing protein vs. Ensembl Medaka
Match: grnb (granulin precursor [Source:NCBI gene;Acc:101166910])

HSP 1 Score: 62.003 bits (149), Expect = 3.151e-10
Identity = 50/194 (25.77%), Postives = 73/194 (37.63%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP N  CD E   C   + +++             P R   +   P +++    R   PD        CC +    +GCCP    +CCSD++HCC     CD  +  C+ A    +  V +  +     + H             LA+       C+   TCC        CCP   AVCC D + CCP+   C
Sbjct:  175 CPGNTTCDLERGVCKSGEARVE-------------PIR--AVSASPEDVLCPDQRSMCPD-----GTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTCDLAHSTCVSAAGGTAEAVMVP-VSGTPPKTHP---------VRGLAVPCNASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVC 338          

HSP 2 Score: 60.8474 bits (146), Expect = 7.561e-10
Identity = 50/196 (25.51%), Postives = 74/196 (37.76%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD  + KC      ++ + + +++     P +R  +G  P  +      +  P     C     CC +    +GCCPY    CCSD+LHCC     CD     C       S + R++ +  +                    +    +  C    TCC  +     CCP  NAVCC D + CCP    C
Sbjct:   90 CPEGTTCDLVHSKCA--SPSLQAFPMLQKV-----PAQR--VGTLP--VFAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTCDLERGVCK------SGEARVEPIRAVSASPED-------------VLCPDQRSMCPDGTTCCQLNNGTFGCCPLPNAVCCSDHMHCCPEGTTC 255          

HSP 3 Score: 56.9954 bits (136), Expect = 1.284e-8
Identity = 46/157 (29.30%), Postives = 62/157 (39.49%), Query Frame = 1
Query:  400 GFRCRIEN--------PDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCIL-ALDAVSF--DVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            GF C + +        PD   EC  E  CC +    +GCCP+   +CC D  HCC     CD V+ KC   +L A      V  QR+  + +               +  +    +  C    TCC   +    CCP   A CC D + CCP N  C
Sbjct:   36 GFTCPLPHTRVGAVICPDQESECPDETTCCQLPDGSWGCCPFPKAVCCEDQRHCCPEGTTCDLVHSKCASPSLQAFPMLQKVPAQRVGTLPV-----------FAAAASVVCPGGKSSCPNSFTCCLLTSGDFGCCPYPQATCCSDHLHCCPGNTTC 181          

HSP 4 Score: 56.9954 bits (136), Expect = 1.284e-8
Identity = 51/198 (25.76%), Postives = 74/198 (37.37%), Query Frame = 1
Query:  259 NEVCDTENKKCIPKDNKIKMWTLY-EEMKNMTKPFRRNILGKFPG--EIVGFRCRIENP-DVYDEC--EEKCCYVRKSY-YGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
              VC ++   C PK  K   +    E     + P+R+    K P   +  G    +EN  D    C  +  CC++ ++  +GCCP    +CC D  HCC     C      C      V +  ++  L                       +   N+  C+   TCCP    G  CCP   AVCC D   CCP ++ C
Sbjct:  478 QAVCCSDLDHCCPKGYKCNAFDRTCERPGGPSLPWRQ----KLPALQQRSGQTGPVENKCDAQTSCPKDTTCCFMEQTLKWGCCPLPQAVCCGDGNHCCPRGHSCQPHRSSCSRGSHVVPWFTKVGALTE---------------PSGVTDVKCDNKSSCASGTTCCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTC 656          

HSP 5 Score: 56.225 bits (134), Expect = 1.888e-8
Identity = 50/189 (26.46%), Postives = 64/189 (33.86%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCP 816
            CPE   CD  +  C+          +     + T P    + G      +   C   N  V       CC   +  +GCCP    +CC D+LHCC     C+ V   C    D  S       L       ++                      C  + TCC T A G  CCP   AVCC D I CCP
Sbjct:  249 CPEGTTCDLAHSTCVSAAGGTAEAVMVP--VSGTPPKTHPVRG------LAVPC---NASVACADGSTCCRASRGQWGCCPLPEAVCCEDHLHCCPHGTVCNLVASTC----DDPSGSALTPLLSNTPGFPYRSENGRC-----------DESASCPGEATCCRTRAGGWACCPLPQAVCCDDHIHCCP 411          

HSP 6 Score: 53.5286 bits (127), Expect = 1.585e-7
Identity = 38/133 (28.57%), Postives = 58/133 (43.61%), Query Frame = 1
Query:  454 CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC--IPGGC 846
            CC ++   +GCCP +  +CC+D+ HCC  +  C+     C           +   L R+V  + + + +        +      + +C K  TCC   A    CCP+  AVCC D   CCP  + C    GGC
Sbjct:  624 CCPLQTGGWGCCPLVKAVCCADHEHCCPQSYTCNMQTGTCEKKAG------QGLPLSRVVPAQPQDTQD--------VPCDGTGEFKCPKQNTCCRISATAWGCCPSPGAVCCMDSKHCCPAGYSCDLKAGGC 742          
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Match: SMESG000049067.1 (SMESG000049067.1)

HSP 1 Score: 480.33 bits (1235), Expect = 2.319e-173
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 1
Query:  121 MRVISRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRILK 867
            MRVISRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKFSFESQSSDQFSLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRILK
Sbjct:    1 MRVISRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKFSFESQSSDQFSLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRILK 249          
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Match: SMESG000018760.1 (SMESG000018760.1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.522e-16
Identity = 61/201 (30.35%), Postives = 91/201 (45.27%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIP-KDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIEN--PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI--QRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD +  KC+    + ++M  L   +K   +P + NIL     E    +  + N  P+   +C E+  CC  + + Y CC Y   +CC D  HCC +   CD+V+ KC   ++A    ++   + +E  V+E+             +      N+ +C   QTCC T      CC   NAVCCPDK  CCP    C
Sbjct:  144 CPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEP-KTNILEAKVNEKDENKETVGNICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEE-------TDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTC 336          

HSP 2 Score: 69.3218 bits (168), Expect = 7.888e-13
Identity = 49/151 (32.45%), Postives = 69/151 (45.70%), Query Frame = 1
Query:  391 EIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRI--QRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            E VG  C    P+   +C E+  CC  + + Y CC Y   +CC D  HCC +   CD+V+ KC   ++A    ++   + +E  V+E+             +      N+ +C   QTCC T      CC   NAVCCPDK  CCP    C
Sbjct:   11 ETVGNIC----PNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSCDSVHKKCNRNIEATKSPIQTTPEPMEMPVIEE-------TDVKIITDQTCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTC 150          

HSP 3 Score: 68.5514 bits (166), Expect = 1.256e-12
Identity = 56/196 (28.57%), Postives = 86/196 (43.88%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIK--MWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD +NKKC    + I      + +E+ + +  +  N   K    ++GF+ +    D Y       C +     G C + A  CCSD   CC    +CD  N KC L  ++  FD    +              S ++++ S  +   N+  C   +TCC    +   CC  +NAVCC D++SCCP+N  C
Sbjct:  422 CPEATTCDIKNKKCTSSPHSIHEIAHEMAQELIHDSFKYETNFF-KIISLLLGFKQKASKSDFY-------CPITNGRSGRCKFSAGTCCSDLRTCCPQHTKCDEKNNKCTL--NSTDFDTEKSK-------------HSPNTNRLSTVVCPDNETECFSWETCCAVSDKSYGCCELENAVCCADRVSCCPHNQKC 594          

HSP 4 Score: 65.0846 bits (157), Expect = 1.714e-11
Identity = 52/192 (27.08%), Postives = 82/192 (42.71%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCIL-ALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCP 816
            CP    CD+ +KKC        +      ++   +P    ++ +   +I+  +     P+   +C++   CC  +   Y CC +   +CC D  HCC     CD   +KC+  A   V     I  L+  V  + K +      ++    +   N+ +C   +TCC T      CCP KNAVCC DK  CCP
Sbjct:  242 CPNGTSCDSVHKKC-----NRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQ---TCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK--VENELKTNILEAKVNEKDEVMCPNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCP 423          

HSP 5 Score: 63.5438 bits (153), Expect = 6.622e-11
Identity = 53/208 (25.48%), Postives = 83/208 (39.90%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA------------VSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD+ +KKC        +      ++   +P    ++ +   +I+  +     P+   +C++   CC  +   Y CC +   +CC D  HCC     CD   +KC+    +            V  + +   LE  V EK +      +       I    + +C++ QTCC T      CC   NAVCCPDK  CCP    C
Sbjct:   56 CPNGTSCDSVHKKC-----NRNIEATKSPIQTTPEPMEMPVIEETDVKIITDQ---TCPNNRTKCQDSQTCCVTKHGSYHCCKFANAVCCPDKFHCCPEGSTCDAKQHKCVKCAKSNVEMRKLIPALKVEDEPKTNILEAKVNEKDENKETVGN-------ICPNKRTKCTERQTCCQTKHNSYHCCKYANAVCCPDKFHCCPNGTSC 248          

HSP 6 Score: 53.1434 bits (126), Expect = 1.281e-7
Identity = 48/197 (24.37%), Postives = 79/197 (40.10%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIP-KDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPE   CD +  KC+    + ++M  L   +K +    + NIL     E     C    P+   +C++   CC  + + Y CCP+   +CCSD   CC     CD  N KC  +  ++  ++  +  + ++ +  K+           L        + SK    CP     +  C      CC D  +CCP +  C
Sbjct:  330 CPEGSTCDAKQHKCVKCAKSNVEMGKLIPALK-VENELKTNILEAKVNEKDEVMC----PNNKTKCKDTKTCCITKHNNYYCCPHKNAVCCSDKYQCCPEATTCDIKNKKCTSSPHSI-HEIAHEMAQELIHDSFKYETNFFKIISLLLGFKQ----KASKSDFYCPITNGRSGRCKFSAGTCCSDLRTCCPQHTKC 516          
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.372e-15
Identity = 60/203 (29.56%), Postives = 79/203 (38.92%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
            CP N  CD+  K C+ K + +       E+ N  +P  +  L                PD + EC+  E CC V    YGCCP+    CCSDN  CC   + CD     C     +     + + L     E               L +   +Q +C  D  CC        CC  KN VCC DK +CCP    C+ GGC K
Sbjct:  270 CPHNTDCDSAKKACVSKSSDL------TEIPNELQPEAQIKLNNIC------------PDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSE-------------IGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGCSK 441          

HSP 2 Score: 63.929 bits (154), Expect = 4.181e-11
Identity = 47/145 (32.41%), Postives = 70/145 (48.28%), Query Frame = 1
Query:  424 PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA-VSFDVRIQRLERIVLE-KHKXXXXXXXXXXXXLAIWN-----RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            P+   +C+E   CC  + + Y CC Y   +CC D  HCC S   CD    +C   ++  + + V  + L   +L+ K   +     S+  +L + +      N+ +C   +TCC T      CCP KNAVCC DK +CCP N  C
Sbjct:   44 PNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 188          

HSP 3 Score: 62.3882 bits (150), Expect = 1.257e-10
Identity = 54/197 (27.41%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCIL-ALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  CD +NKKC+          ++   KN     +   L  F   +   +   + P+   +C  ++KCC +   ++GCC +   +CC D   CC     CD+    C+  + D       +Q   +I L                  I       C   +TCC        CCP KNA CC D  SCCP+N  C
Sbjct:  182 CPENTKCDLKNKKCLDSS------AVFNSYKNPG--LKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNN----------------ICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 354          

HSP 4 Score: 58.151 bits (139), Expect = 2.575e-9
Identity = 51/209 (24.40%), Postives = 77/209 (36.84%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEM--KNMTKPFRRNILGKFPGEIVGFRCR--IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN---------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD   K+C         W + EE     M      + L  F       R    I  P+   +C++   CC  +   Y CCP+   +CCSD  +CC    +CD  N KC+ +                V   +K      ++     ++ N          ++ +C   + CCP       CC     +CCPD  +CCP+N  C
Sbjct:   82 CPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDS--------------SAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 276          
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.398e-15
Identity = 60/203 (29.56%), Postives = 79/203 (38.92%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
            CP N  CD+  K C+ K + +       E+ N  +P  +  L                PD + EC+  E CC V    YGCCP+    CCSDN  CC   + CD     C     +     + + L     E               L +   +Q +C  D  CC        CC  KN VCC DK +CCP    C+ GGC K
Sbjct:  267 CPHNTDCDSAKKACVSKSSDL------TEIPNELQPEAQIKLNNIC------------PDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSE-------------IGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGCSK 438          

HSP 2 Score: 63.929 bits (154), Expect = 4.045e-11
Identity = 47/145 (32.41%), Postives = 70/145 (48.28%), Query Frame = 1
Query:  424 PDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA-VSFDVRIQRLERIVLE-KHKXXXXXXXXXXXXLAIWN-----RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            P+   +C+E   CC  + + Y CC Y   +CC D  HCC S   CD    +C   ++  + + V  + L   +L+ K   +     S+  +L + +      N+ +C   +TCC T      CCP KNAVCC DK +CCP N  C
Sbjct:   41 PNNRTKCKETQTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 185          

HSP 3 Score: 62.3882 bits (150), Expect = 1.297e-10
Identity = 54/197 (27.41%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCIL-ALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  CD +NKKC+          ++   KN     +   L  F   +   +   + P+   +C  ++KCC +   ++GCC +   +CC D   CC     CD+    C+  + D       +Q   +I L                  I       C   +TCC        CCP KNA CC D  SCCP+N  C
Sbjct:  179 CPENTKCDLKNKKCL------DSSAVFNSYKNPG--LKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNN----------------ICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 351          

HSP 4 Score: 58.151 bits (139), Expect = 2.609e-9
Identity = 51/209 (24.40%), Postives = 77/209 (36.84%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEM--KNMTKPFRRNILGKFPGEIVGFRCR--IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN---------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD   K+C         W + EE     M      + L  F       R    I  P+   +C++   CC  +   Y CCP+   +CCSD  +CC    +CD  N KC+ +                V   +K      ++     ++ N          ++ +C   + CCP       CC     +CCPD  +CCP+N  C
Sbjct:   79 CPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDS--------------SAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 273          
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Match: SMESG000018770.1 (SMESG000018770.1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.623e-15
Identity = 60/203 (29.56%), Postives = 79/203 (38.92%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDECE--EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQK 852
            CP N  CD+  K C+ K + +       E+ N  +P  +  L                PD + EC+  E CC V    YGCCP+    CCSDN  CC   + CD     C     +     + + L     E               L +   +Q +C  D  CC        CC  KN VCC DK +CCP    C+ GGC K
Sbjct:  261 CPHNTDCDSAKKACVSKSSDL------TEIPNELQPEAQIKLNNIC------------PDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVCDLEKKVCKNKETSQPSITKSKSLLHFYSE-------------IGLKVICPDQTKCENDSVCCQMDDNQYGCCSYKNGVCCADKQTCCPNGTQCVSGGCSK 432          

HSP 2 Score: 63.5438 bits (153), Expect = 4.977e-11
Identity = 44/135 (32.59%), Postives = 65/135 (48.15%), Query Frame = 1
Query:  448 EKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDA-VSFDVRIQRLERIVLE-KHKXXXXXXXXXXXXLAIWN-----RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            + CC  + + Y CC Y   +CC D  HCC S   CD    +C   ++  + + V  + L   +L+ K   +     S+  +L + +      N+ +C   +TCC T      CCP KNAVCC DK +CCP N  C
Sbjct:   45 QTCCVTKHNSYHCCRYPNAICCPDKYHCCPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKC 179          

HSP 3 Score: 62.003 bits (149), Expect = 1.497e-10
Identity = 54/197 (27.41%), Postives = 78/197 (39.59%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIENPDVYDEC--EEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCIL-ALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWNRNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CPEN  CD +NKKC+          ++   KN     +   L  F   +   +   + P+   +C  ++KCC +   ++GCC +   +CC D   CC     CD+    C+  + D       +Q   +I L                  I       C   +TCC        CCP KNA CC D  SCCP+N  C
Sbjct:  173 CPENTKCDLKNKKCL------DSSAVFNSYKNPG--LKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDCDSAKKACVSKSSDLTEIPNELQPEAQIKLNN----------------ICPDKHVECQSFETCCSVGDGLYGCCPFKNATCCSDNASCCPHNKVC 345          

HSP 4 Score: 57.7658 bits (138), Expect = 3.449e-9
Identity = 51/209 (24.40%), Postives = 77/209 (36.84%), Query Frame = 1
Query:  250 CPENEVCDTENKKCIPKDNKIKMWTLYEEM--KNMTKPFRRNILGKFPGEIVGFRCR--IENPDVYDECEEK--CCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYKCILALDAVSFDVRIQRLERIVLEKHKXXXXXXXXXXXXLAIWN---------RNQCRCSKDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHC 831
            CP    CD   K+C         W + EE     M      + L  F       R    I  P+   +C++   CC  +   Y CCP+   +CCSD  +CC    +CD  N KC+ +                V   +K      ++     ++ N          ++ +C   + CCP       CC     +CCPD  +CCP+N  C
Sbjct:   73 CPSGSTCDAAKKRCTRNVEGPMEWPVVEENLPVKMLDLKPSSTLHGFESNSETLRVNDDITCPNNKTKCKDTKTCCITKHGNYYCCPHKNAVCCSDKYNCCPENTKCDLKNKKCLDS--------------SAVFNSYKNPGLKSANLYTFYSLLNVDKLEKKCPNSEKQCPGQKKCCPMSGGHFGCCKFNKGICCPDMKTCCPHNTDC 267          
The following BLAST results are available for this feature:
BLAST of GRANULINS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GRN1.095e-1528.86granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN9.933e-1428.16granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN1.305e-1328.16granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
GRN8.060e-929.33granulin precursor [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgrn-18.295e-1327.51ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
pgrn-11.333e-1227.23ProGRaNulin homolog [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grna1.322e-1125.45granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna1.355e-1125.45granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grna1.355e-1125.45granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
grnb3.932e-1125.86granulin b [Source:ZFIN;Acc:ZDB-GENE-030131-7393][more]
grna1.238e-929.37granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
trappc112.873e-1227.85trafficking protein particle complex 11 [Source:Xe... [more]
trappc113.420e-1227.85trafficking protein particle complex 11 [Source:Xe... [more]
trappc119.009e-1227.69trafficking protein particle complex 11 [Source:Xe... [more]
trappc111.080e-1127.69trafficking protein particle complex 11 [Source:Xe... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Grn9.901e-1428.29granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn2.824e-829.37granulin [Source:MGI Symbol;Acc:MGI:95832][more]
Grn4.515e-625.99granulin [Source:MGI Symbol;Acc:MGI:95832][more]
back to top
BLAST of GRANULINS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P28799|GRN_HUMAN6.268e-1328.16Progranulin OS=Homo sapiens OX=9606 GN=GRN PE=1 SV... [more]
sp|P28798|GRN_MOUSE6.908e-1328.29Progranulin OS=Mus musculus OX=10090 GN=Grn PE=1 S... [more]
sp|P23785|GRN_RAT1.652e-1128.05Progranulin OS=Rattus norvegicus OX=10116 GN=Grn P... [more]
sp|P28797|GRN_CAVPO5.384e-1127.36Progranulin OS=Cavia porcellus OX=10141 GN=GRN PE=... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1PAM67.688e-1433.16Uncharacterized protein OS=Crassostrea gigas OX=29... [more]
A0A498MSN01.065e-1329.18tRNA pseudouridine(38 39) synthase-like isoform X1... [more]
A0A498LBB01.076e-1329.18tRNA pseudouridine(38 39) synthase-like isoform X1... [more]
A0A0B5A1B92.187e-1327.74Granulin epithelin variant 3 OS=Pinctada fucata OX... [more]
A0A0B4ZY932.509e-1327.74Granulin epithelin variant 2 OS=Pinctada fucata OX... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grnb5.654e-1330.50granulins-like [Source:NCBI gene;Acc:103046308][more]
grnb5.654e-1330.50granulins-like [Source:NCBI gene;Acc:103046308][more]
ENSAMXT00000029960.11.226e-923.56pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
grna1.303e-925.79granulin a [Source:ZFIN;Acc:ZDB-GENE-030131-8434][more]
ENSAMXT00000014643.25.349e-923.92pep primary_assembly:Astyanax_mexicanus-2.0:23:267... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009302.12.820e-825.00pep scaffold:Pmarinus_7.0:GL483232:1183:11161:1 ge... [more]
ENSPMAT00000001039.14.067e-727.91pep scaffold:Pmarinus_7.0:GL484091:11570:24665:-1 ... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO278241.180e-925.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
grna1.316e-1024.11granulins [Source:NCBI gene;Acc:101162601][more]
grna1.456e-1024.11granulins [Source:NCBI gene;Acc:101162601][more]
grnb3.151e-1025.77granulin precursor [Source:NCBI gene;Acc:101166910... [more]
back to top
BLAST of GRANULINS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049067.12.319e-173100.00SMESG000049067.1[more]
SMESG000018760.12.522e-1630.35SMESG000018760.1[more]
SMESG000018770.11.372e-1529.56SMESG000018770.1[more]
SMESG000018770.11.398e-1529.56SMESG000018770.1[more]
SMESG000018770.11.623e-1529.56SMESG000018770.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005855 ID=SMED30005855|Name=GRANULINS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=949bp
TTCTGGATCAATTTCACTAGTTTTGCACATAAAATCTGCTGAAATTGACA
CTTGTGTGACCAAAGGTTACCTTCAATTCCTCTATATATTCCTGGGTGCA
TCAAACTATTATTTATAACAATGAGAGTCATTTCAAGAATTTGCGTTCTG
CTAATTTTCTGTGTTCTGCTGAACTTTTCAAAAACTGACACCTTTCAGTT
ACCAGAGAAAGTCGTAAAAAAGTCATTTTGTGAAACCCCTACGGATCCTT
GTCCAGAAAACGAAGTCTGTGACACTGAAAATAAAAAATGCATTCCCAAA
GATAATAAAATAAAAATGTGGACTTTATATGAAGAAATGAAAAATATGAC
AAAACCCTTTAGACGAAATATTCTCGGCAAATTTCCTGGTGAGATAGTTG
GATTTAGGTGCAGAATTGAGAACCCTGATGTCTATGATGAATGTGAGGAA
AAATGCTGTTATGTGAGAAAATCGTATTATGGATGTTGTCCATATCTGGC
TGAATTATGTTGCAGCGATAATCTACATTGTTGCCATAGTACGAGAAGGT
GTGACACTGTAAATTATAAATGTATTTTGGCTCTTGATGCTGTTTCGTTT
GACGTAAGAATTCAAAGATTAGAAAGAATAGTTTTGGAAAAGCATAAATT
CTCATTTGAAAGCCAGTCCTCAGATCAGTTTAGCCTAGCCATATGGAATA
GGAACCAATGTCGATGTTCTAAAGATCAAACTTGTTGTCCAACTCATGCT
CAAGGAACTTTGTGTTGTCCAACCAAAAACGCTGTCTGCTGTCCGGATAA
GATATCCTGCTGTCCATATAACTTCCACTGCATTCCCGGAGGATGTCAGA
AAAACAGAATTTTAAAATAAACAATTTGTTATATTAATATTAGCGTTTTT
GGTATTTTAGTTTCTGTGACTTTAATATAATTTTGATAGCCAAAAAAAA
back to top

protein sequence of SMED30005855-orf-1

>SMED30005855-orf-1 ID=SMED30005855-orf-1|Name=SMED30005855-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=250bp
MRVISRICVLLIFCVLLNFSKTDTFQLPEKVVKKSFCETPTDPCPENEVC
DTENKKCIPKDNKIKMWTLYEEMKNMTKPFRRNILGKFPGEIVGFRCRIE
NPDVYDECEEKCCYVRKSYYGCCPYLAELCCSDNLHCCHSTRRCDTVNYK
CILALDAVSFDVRIQRLERIVLEKHKFSFESQSSDQFSLAIWNRNQCRCS
KDQTCCPTHAQGTLCCPTKNAVCCPDKISCCPYNFHCIPGGCQKNRILK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000207sperm duct
PLANA:0000234seminal vesicle
Vocabulary: INTERPRO
TermDefinition
IPR037277Granulin_sf
IPR039036Granulin_fam
IPR000118Granulin
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005125cytokine activity
GO:0005515protein binding
GO:0008083growth factor activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005764lysosome
GO:0005768endosome
GO:0005783endoplasmic reticulum
GO:0035578azurophil granule lumen
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0043312neutrophil degranulation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000118GranulinSMARTSM00277GRAN_2coord: 108..151
e-value: 0.0065
score: 12.5
coord: 193..242
e-value: 1.3E-4
score: 29.2
IPR000118GranulinPFAMPF00396Granulincoord: 112..152
e-value: 6.0E-6
score: 26.5
coord: 204..240
e-value: 1.7E-6
score: 28.3
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 191..249
e-value: 8.8E-11
score: 43.8
IPR037277Granulin superfamilyGENE3DG3DSA:3.10.20.500coord: 99..153
e-value: 5.7E-8
score: 34.9
IPR039036Granulin familyPANTHERPTHR12274GRANULINcoord: 14..245
NoneNo IPR availablePANTHERPTHR12274:SF3GRANULINScoord: 14..245
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.836