slc30a-10

Overview
Nameslc30a-10 (AKN21630.1)
Smed IDSMED30005852
Length (bp)1338
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc30a-10 (SMED30005852) t-SNE clustered cells

Violin plots show distribution of expression levels for slc30a-10 (SMED30005852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc30a-10 (SMED30005852) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc30a-10 (SMED30005852) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005852SMESG000019226.1 Contig3522GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005852SMESG000002070.1 Contig3522GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30005852SMESG000002070.1 dd_Smed_v4_3236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005852SMESG000002070.1 dd_Smed_v4_3236_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005852SMESG000002070.1 dd_Smed_v4_3236_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc30a-10 vs. Ensembl Human
Match: SLC30A3 (solute carrier family 30 member 3 [Source:HGNC Symbol;Acc:HGNC:11014])

HSP 1 Score: 247.669 bits (631), Expect = 1.515e-77
Identity = 132/365 (36.16%), Postives = 206/365 (56.44%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNH-SQDVEHC---QDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
             A+ +L  A  +C +F  GE++GG +A+SLAI+TD+AHL +D+ S + SL ++ LS R +T++M FGWHR+E +GAL SV+ +W+VTG+L+Y A +R+++S+Y I    ML+ +++ V  N+L+A VLH                                    +A   H+H S+  E+    +  +EPL                     + N ++RAAF+HV+GD++QSFGVLAA+ +IYFKPQ+K ADPI TFLFS   + +T    RDV+ +L+E  PR++ +  V   + S+PG+   H L LW++TLT    S HL +D++ D +++L +        F  S  T+Q+E      A C
Sbjct:   71 HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLH------------------------------------QAGPPHSHGSRGAEYAPLEEGPEEPL--------------------PLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQC 379          
BLAST of slc30a-10 vs. Ensembl Human
Match: SLC30A2 (solute carrier family 30 member 2 [Source:HGNC Symbol;Acc:HGNC:11013])

HSP 1 Score: 246.514 bits (628), Expect = 3.339e-77
Identity = 135/361 (37.40%), Postives = 208/361 (57.62%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            +A+ +L +A  +C+LF +GE++GG +A+SLA++TD+AHL +D +S LISL ++ +S+R +TK+MNFGW RAEI+GAL SVL IW+VTGVL+Y A+ R+I+ +Y I+   MLI S   V +N+++ L LH                                         H HS    + Q+                           +N ++RAAFIHVIGD +QS GVL AA+I+YFKP++K  DPICTF+FS LV+ TT+ I RDVI VL+E  P+ +++  V   + S+ G+  +H+L +W++T+ +  LS H+ +  + D+Q++L+        +F    +TIQIE  ++    C
Sbjct:   69 KAQRQLYVASAICLLFMIGEVVGGYLAHSLAVMTDAAHLLTDFASMLISLFSLWMSSRPATKTMNFGWQRAEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVNIIMGLTLH--------------------------------------QSGHGHSHGTTNQQE---------------------------ENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFSILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTDAQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDC 364          
BLAST of slc30a-10 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 201.445 bits (511), Expect = 1.916e-60
Identity = 129/363 (35.54%), Postives = 199/363 (54.82%), Query Frame = 1
Query:  163 PLSKNMDRQA--KTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            P  K  +  A  K KL  A  +C +F + E++GG IA SLA++TD+AHL  DL+SFL+SL ++ LS++  +K + FGWHRAEI+GAL S+L IW+VTGVL+Y A  R++  +Y I A +M+I+S+  V  N++L +VLH +                                     + HNH +            +  N+ V A    +   +F+SI                     VL +A IIYFKP++KIADPICTF+FS LV+ +TI I +D   +L+E  P+ +NY+ V   I ++ G++ +H+L +WS+T+ +  LS H+   AS+DSQ +  ++     + F +  +TIQ+ES
Sbjct:   10 PTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQR------------------------------------CLGHNHKE------------VQANASVRAAFVHALGDLFQSIS--------------------VLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMES 304          
BLAST of slc30a-10 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 201.445 bits (511), Expect = 1.916e-60
Identity = 129/363 (35.54%), Postives = 199/363 (54.82%), Query Frame = 1
Query:  163 PLSKNMDRQA--KTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            P  K  +  A  K KL  A  +C +F + E++GG IA SLA++TD+AHL  DL+SFL+SL ++ LS++  +K + FGWHRAEI+GAL S+L IW+VTGVL+Y A  R++  +Y I A +M+I+S+  V  N++L +VLH +                                     + HNH +            +  N+ V A    +   +F+SI                     VL +A IIYFKP++KIADPICTF+FS LV+ +TI I +D   +L+E  P+ +NY+ V   I ++ G++ +H+L +WS+T+ +  LS H+   AS+DSQ +  ++     + F +  +TIQ+ES
Sbjct:   10 PTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQR------------------------------------CLGHNHKE------------VQANASVRAAFVHALGDLFQSIS--------------------VLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMES 304          
BLAST of slc30a-10 vs. Ensembl Human
Match: SLC30A8 (solute carrier family 30 member 8 [Source:HGNC Symbol;Acc:HGNC:20303])

HSP 1 Score: 201.445 bits (511), Expect = 1.916e-60
Identity = 129/363 (35.54%), Postives = 199/363 (54.82%), Query Frame = 1
Query:  163 PLSKNMDRQA--KTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            P  K  +  A  K KL  A  +C +F + E++GG IA SLA++TD+AHL  DL+SFL+SL ++ LS++  +K + FGWHRAEI+GAL S+L IW+VTGVL+Y A  R++  +Y I A +M+I+S+  V  N++L +VLH +                                     + HNH +            +  N+ V A    +   +F+SI                     VL +A IIYFKP++KIADPICTF+FS LV+ +TI I +D   +L+E  P+ +NY+ V   I ++ G++ +H+L +WS+T+ +  LS H+   AS+DSQ +  ++     + F +  +TIQ+ES
Sbjct:   10 PTEKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMIIVSSCAVAANIVLTVVLHQR------------------------------------CLGHNHKE------------VQANASVRAAFVHALGDLFQSIS--------------------VLISALIIYFKPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMES 304          
BLAST of slc30a-10 vs. Ensembl Celegans
Match: cdf-2 (Cation Diffusion Facilitator family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AVP5])

HSP 1 Score: 169.474 bits (428), Expect = 3.063e-48
Identity = 79/156 (50.64%), Postives = 109/156 (69.87%), Query Frame = 1
Query:  814 DNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD 1281
            DNIN+RAAFIHV+GD++QS GVL AA  IYF+P W I DPICT +FS +V+ TTI+I RD + VLLE +P +I++ KV   +  I G+ ++H+LR+WS+T+ K ALS HL +DA+  SQSIL +   M  + + + EITIQIE      + C + D
Sbjct:  201 DNINVRAAFIHVLGDLLQSLGVLVAALFIYFQPSWVIIDPICTLVFSVIVLCTTIYILRDAMIVLLEGRPSNIDFAKVFSSLEDIEGVKKVHDLRIWSLTMDKIALSVHLEIDANSQSQSILRETRKMLKQTYNVHEITIQIEEFGANRSDCGKCD 356          

HSP 2 Score: 120.939 bits (302), Expect = 2.215e-30
Identity = 66/134 (49.25%), Postives = 102/134 (76.12%), Query Frame = 1
Query:  169 SKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIIN-VLLALV 567
            S + +R+A   L + VVLC+ F + E+IGG++A SLAI+TD+AHL +D +S LISL ++ ++ R  ++ M+FG+HRAE++GA FSV LIWIVTGVL+  AI+RI++ +Y +   IM + +A+GV++N V+LAL+
Sbjct:   43 SHDSNRRATRILWLTVVLCLFFMVCEVIGGVLAGSLAIVTDAAHLLTDFASVLISLFSLYIARRPPSQKMSFGFHRAEVLGAFFSVFLIWIVTGVLVVLAIMRIVSGDYEVEGGIMALTAALGVVVNLVMLALL 176          
BLAST of slc30a-10 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 134.806 bits (338), Expect = 1.216e-35
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCD 1272
            N+N+RAA IHVIGD++QS GVL AA II F   W +ADPICTFLFS +V+ TT+ + RD+ +VL+E  P H + + V   +S++ G+  +H+L LWSI + KTA S HL +++   +   + +   +    F ++  T+Q+E   +    CD
Sbjct:  175 NVNVRAALIHVIGDLVQSIGVLIAALIIRFTG-WTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCD 325          

HSP 2 Score: 88.5817 bits (218), Expect = 3.766e-19
Identity = 55/133 (41.35%), Postives = 93/133 (69.92%), Query Frame = 1
Query:  172 KNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVL 570
            ++  R+A+  L     L  +F   E +GG  A SLAI+TD+ H+ SDL SF+IS+ A+  +   ++K ++FG+ RAE++GAL SV+++W++T VL+  AI RI+N+ + ++A++MLI + VGV+ N+++ LVL
Sbjct:   18 EDTGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVL 150          
BLAST of slc30a-10 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 134.806 bits (338), Expect = 4.186e-35
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCD 1272
            N+N+RAA IHVIGD++QS GVL AA II F   W +ADPICTFLFS +V+ TT+ + RD+ +VL+E  P H + + V   +S++ G+  +H+L LWSI + KTA S HL +++   +   + +   +    F ++  T+Q+E   +    CD
Sbjct:  233 NVNVRAALIHVIGDLVQSIGVLIAALIIRFTG-WTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCD 383          

HSP 2 Score: 89.3521 bits (220), Expect = 3.197e-19
Identity = 55/133 (41.35%), Postives = 93/133 (69.92%), Query Frame = 1
Query:  172 KNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVL 570
            ++  R+A+  L     L  +F   E +GG  A SLAI+TD+ H+ SDL SF+IS+ A+  +   ++K ++FG+ RAE++GAL SV+++W++T VL+  AI RI+N+ + ++A++MLI + VGV+ N+++ LVL
Sbjct:   76 EDTGRRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVL 208          
BLAST of slc30a-10 vs. Ensembl Celegans
Match: ttm-1 (Toxin-regulated Targets of MAPK [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU82])

HSP 1 Score: 134.806 bits (338), Expect = 5.919e-35
Identity = 63/152 (41.45%), Postives = 96/152 (63.16%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCD 1272
            N+N+RAA IHVIGD++QS GVL AA II F   W +ADPICTFLFS +V+ TT+ + RD+ +VL+E  P H + + V   +S++ G+  +H+L LWSI + KTA S HL +++   +   + +   +    F ++  T+Q+E   +    CD
Sbjct:  252 NVNVRAALIHVIGDLVQSIGVLIAALIIRFTG-WTLADPICTFLFSIIVLFTTVTVMRDIFFVLMEATPSHYDLSDVKKALSALEGVKGVHDLHLWSIGMDKTAFSVHLALESPNRAMENVAEARSLIRRRFGVAVATVQVEPFDEKIDSCD 402          

HSP 2 Score: 88.1965 bits (217), Expect = 9.098e-19
Identity = 55/129 (42.64%), Postives = 91/129 (70.54%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVL 570
            R+A+  L     L  +F   E +GG  A SLAI+TD+ H+ SDL SF+IS+ A+  +   ++K ++FG+ RAE++GAL SV+++W++T VL+  AI RI+N+ + ++A++MLI + VGV+ N+++ LVL
Sbjct:   99 RRAEKVLWAVAALSAVFIAAEFVGGFWAQSLAIMTDAGHMLSDLLSFIISIFAIRCARLPASKRLSFGYERAEVLGALTSVIILWVLTTVLVVVAIQRIVNNEHEVDADVMLITAGVGVLFNIVMGLVL 227          
BLAST of slc30a-10 vs. Ensembl Celegans
Match: cdf-1 (Cation diffusion facilitator family protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q95QW4])

HSP 1 Score: 61.2326 bits (147), Expect = 7.683e-10
Identity = 33/125 (26.40%), Postives = 64/125 (51.20%), Query Frame = 1
Query:  781 DSSKSKVFKSID-NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIA---DPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHL 1143
            D S  K  +  D N+N+   ++H++ D   S  V+ +A  +YF P WKIA   DPI +   + ++  T + + +     LL++ P  ++  KV   + SI G+ ++  L +W++   +   + H+
Sbjct:  327 DKSAQKTEQKKDKNVNIHGVWLHLLSDAFGSVIVMISAGFVYFLPTWKIAAYLDPILSISLASIMGFTAVVLVKTSGEKLLKQTPEGLDLEKVKKDLCSIVGVSKVEKLSVWTLCGQRIIAAAHV 451          

HSP 2 Score: 60.4622 bits (145), Expect = 1.193e-9
Identity = 41/146 (28.08%), Postives = 84/146 (57.53%), Query Frame = 1
Query:  118 LLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVL 555
            L  D+ ++ E   KS   K + R     LII + + ++F   E I G++ +S+A+L DS H+ +D+ + +++   + ++ R ST+ + +GW RAE +G  F+ + +  V  ++   A+ RIIN + + +   +L++  +G++IN+ 
Sbjct:   47 LEHDLRLKGEPIGKSESVKGVSRS----LIIQIGMTVIFCALEFITGVVCSSIAMLADSYHMAADVMALIVAFTCIKIATRPSTR-LGYGWVRAETLGGFFNGIFMCTVCVLVFQEAVGRIINVHMITHPLQVLVIGFIGLLINLF 187          
BLAST of slc30a-10 vs. Ensembl Fly
Match: ZnT33D (gene:FBgn0051860 transcript:FBtr0302984)

HSP 1 Score: 249.98 bits (637), Expect = 1.662e-75
Identity = 153/377 (40.58%), Postives = 221/377 (58.62%), Query Frame = 1
Query:  148 CKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDE-PLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            C FK      +D+ A+  LIIA +LC +F + E+IGGI++NSLAI TD+AHL +DL+SFLIS+ A+ L+ R S++ +N+GWHRAE+IGA+ S+  IW+VTG+L+Y AI+R +N ++ ++A IMLI SA+ ++ NV++A+ L                                          H+HS    H    D   +L +   +  G+  S     K  +NIN+RAA IHV+GDIIQSFGV  AA II+F P+W   D +CTF+FS LV++ T  I RDV+ VL+E  P  ++Y +V     SI G+  +HNLR+W++++ K ALS HL +    D Q ILE+   +  + FK  E TIQIE  +     C Q
Sbjct:  324 CHFKE-RETGVDKAARRVLIIACILCTIFLILEVIGGILSNSLAIATDAAHLLTDLASFLISISALHLAGRPSSERLNYGWHRAEVIGAMVSIFFIWVVTGILVYMAIMRWVNQDFELDAKIMLITSALAILFNVIMAMQLQH---------------------------------------GHSHSLPGVHKMSKDAGSVLGSKMILLLGKSVSMQYAAKGHENINVRAAIIHVVGDIIQSFGVFVAALIIFFWPEWAFMDSVCTFVFSVLVLVVTFKILRDVLMVLMEATPDFMDYEEVKQTFLSISGVEHVHNLRIWALSINKVALSAHLAISKDADPQLILEEATTLIHKRFKFFETTIQIEEYSPGMENCGQ 660          
BLAST of slc30a-10 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080715)

HSP 1 Score: 139.428 bits (350), Expect = 1.931e-36
Identity = 67/172 (38.95%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  760 SDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            ++   G       V +   N+N+RAA IHVIGD+IQS GV  AA +IYF P++ I DPICTF+FS +V+ TT  I +D + VL+E  P +++Y +V      I G+ ++HNLR+W++++ K ALS HL +  + + + IL+         +   E TIQIE        C Q
Sbjct:  263 AETAPGSHHHGGPVGREAVNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQ 434          

HSP 2 Score: 134.035 bits (336), Expect = 1.727e-34
Identity = 67/135 (49.63%), Postives = 108/135 (80.00%), Query Frame = 1
Query:  169 SKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            S+ +D +A+ KLIIA +LC++F + EI+GG+++NSLAI TD+AHL +D +SF+ISL A+ ++ R ST+ M+FGW+RAE+IGA+ SV +IW++TG+L++ AI R+I+ +Y +NA IMLI S + +++NV++ + L 
Sbjct:   48 SEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQ 182          
BLAST of slc30a-10 vs. Ensembl Fly
Match: ZnT35C (gene:FBgn0028516 transcript:FBtr0080714)

HSP 1 Score: 139.043 bits (349), Expect = 4.329e-36
Identity = 67/172 (38.95%), Postives = 100/172 (58.14%), Query Frame = 1
Query:  760 SDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            ++   G       V +   N+N+RAA IHVIGD+IQS GV  AA +IYF P++ I DPICTF+FS +V+ TT  I +D + VL+E  P +++Y +V      I G+ ++HNLR+W++++ K ALS HL +  + + + IL+         +   E TIQIE        C Q
Sbjct:  295 AETAPGSHHHGGPVGREAVNMNVRAALIHVIGDVIQSVGVFVAAGVIYFWPEYSIVDPICTFVFSIIVLFTTFTIMKDALLVLMEGTPNYMHYAEVLQIFQGIEGVERVHNLRIWALSINKVALSAHLAIAENANPKRILDAATSAVHLRYNFFETTIQIEDYTAQMESCLQ 466          

HSP 2 Score: 135.191 bits (339), Expect = 1.032e-34
Identity = 70/149 (46.98%), Postives = 113/149 (75.84%), Query Frame = 1
Query:  127 DVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            +V +R  C      S+ +D +A+ KLIIA +LC++F + EI+GG+++NSLAI TD+AHL +D +SF+ISL A+ ++ R ST+ M+FGW+RAE+IGA+ SV +IW++TG+L++ AI R+I+ +Y +NA IMLI S + +++NV++ + L 
Sbjct:   68 NVEVRDHCHRAR--SEGVDVKARRKLIIASILCLVFMIAEIVGGVLSNSLAIATDAAHLLTDFASFMISLFAIWIAGRPSTQRMSFGWYRAEVIGAMASVFMIWVITGILVWLAIGRLISGDYEVNAKIMLITSGLAILVNVIMGVQLQ 214          
BLAST of slc30a-10 vs. Ensembl Fly
Match: ZnT41F (gene:FBgn0025693 transcript:FBtr0086054)

HSP 1 Score: 114.005 bits (284), Expect = 3.692e-27
Identity = 65/193 (33.68%), Postives = 106/193 (54.92%), Query Frame = 1
Query:  682 RASVNHNHSQDVEHCQDSDEPLLTTNSDV-CAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDM-CIEEFKISEITIQIESSAK 1254
            R  +N N  + V    +  +P LT  S++  A ED           N+NLRAA IHVIGD++QS GV  AA +I   P  K ADP+CT +FS +V++TT+ +FR+ + +++   P+++N   + + + SI G+  +H+L +W  T  +  L  HLV D+  D   +L+    +     + I   TIQ+E + +
Sbjct:  318 RKEINSNEHKIV--ITNGKKPTLTGTSNMELAHEDK----------NLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE 498          

HSP 2 Score: 113.62 bits (283), Expect = 6.530e-27
Identity = 70/184 (38.04%), Postives = 113/184 (61.41%), Query Frame = 1
Query:   76 NDVNLSNEELDSLPLLRDVV-------------IRREC-----KFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            N V +  E+   +PLL D               ++REC      F++       ++AK K+++AV LC +F + E +GG +A SLAI+TD+AHL SD  SF+I L A+ +  R   + M+FG+ R E+IGAL S+L IW VT +L+  AI RI + ++ +NA++M+++S +G++IN+++  VLH
Sbjct:   73 NVVRVPEEQTWEVPLLGDCGDSARNQSSETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIVMMFVLH 256          
BLAST of slc30a-10 vs. Ensembl Fly
Match: ZnT41F (gene:FBgn0025693 transcript:FBtr0086056)

HSP 1 Score: 114.005 bits (284), Expect = 3.692e-27
Identity = 65/193 (33.68%), Postives = 106/193 (54.92%), Query Frame = 1
Query:  682 RASVNHNHSQDVEHCQDSDEPLLTTNSDV-CAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDM-CIEEFKISEITIQIESSAK 1254
            R  +N N  + V    +  +P LT  S++  A ED           N+NLRAA IHVIGD++QS GV  AA +I   P  K ADP+CT +FS +V++TT+ +FR+ + +++   P+++N   + + + SI G+  +H+L +W  T  +  L  HLV D+  D   +L+    +     + I   TIQ+E + +
Sbjct:  318 RKEINSNEHKIV--ITNGKKPTLTGTSNMELAHEDK----------NLNLRAAMIHVIGDLVQSIGVFLAAVLIKVCPGAKYADPLCTLIFSIIVIMTTLRLFRESLGIIVNAVPQNLNMRTLHLELGSIEGVRSLHHLNVWQQTSQQRVLMVHLVTDSRADGNEVLQAATALVSSPRYNIKHSTIQLEPTTE 498          

HSP 2 Score: 113.62 bits (283), Expect = 6.530e-27
Identity = 70/184 (38.04%), Postives = 113/184 (61.41%), Query Frame = 1
Query:   76 NDVNLSNEELDSLPLLRDVV-------------IRREC-----KFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            N V +  E+   +PLL D               ++REC      F++       ++AK K+++AV LC +F + E +GG +A SLAI+TD+AHL SD  SF+I L A+ +  R   + M+FG+ R E+IGAL S+L IW VT +L+  AI RI + ++ +NA++M+++S +G++IN+++  VLH
Sbjct:   73 NVVRVPEEQTWEVPLLGDCGDSARNQSSETEFDMQRECCNHQPGFRANSKSKSAQEAKYKIMLAVALCCVFMIIEFLGGYVAGSLAIMTDAAHLASDCISFVIGLVAIWIGGRPPDERMSFGYKRFEVIGALASILGIWFVTTLLVVVAIERIFSQDFELNADMMMLISGIGIVINIVMMFVLH 256          
BLAST of slc30a-10 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 271.166 bits (692), Expect = 8.022e-87
Identity = 156/391 (39.90%), Postives = 239/391 (61.13%), Query Frame = 1
Query:  106 DSLPLLRDVVIRRECKFKSPLSKNMDRQ---AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            +S+P + D+   + C   +   ++ +R+   AK +L I   +C++F +GEI+GG  A SLA++TD+AHL  DL+SF+ISL ++ LS+R +T+++N+GWHRAEI+GAL S+  IW+VTGVL+Y A+ RIIN N+ I   +MLI S   V+ N+++AL LH   HGHSHGG                            S  H HS D  H +++      ++SD  +  D  + +  K+  N ++RAAF+HVIGD++QS  VL +A II+FKP++KIADPICTFLFS  V+ TT  I RD++ VL+E  P  +NYN+V   +  + G+  +HNL +W++T+ +  LS H+  D + D Q +L ++  +C  ++    +TIQ+E  A     C
Sbjct:   25 ESMPSV-DMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGL---------------------------SAGHGHSHD--HGKENGH----SHSD-GSHHDVEEQRPGKTQANASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVATDETVDPQEVLREMTQVCFTKYSFHSVTIQLEPQADQRPDC 380          
BLAST of slc30a-10 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 263.848 bits (673), Expect = 1.854e-84
Identity = 143/362 (39.50%), Postives = 219/362 (60.50%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            AK KL IA ++C++F +GE+IGG +A+SLAI+TD+AHL +D  S ++SL ++ +S+R  TK MNFGWHR+EI+GAL SV+ IWIVTGVL+Y AI RI+ ++Y I   +ML+ S   V++N+++A +LH                                     ++  H+H        +S        S V  G   S   +  +  N ++RAAFIHV+GD++QSFGV+ AA IIYF+P++KIADPICTFLFS  V+ TT+ I RDV  +L+E  P+ I +N V   + S+  +  +H+L LW++TL+++ LS H+ ++ + D QS+L++  ++   +F     TIQ+E  ++    C Q
Sbjct:   31 AKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILH------------------------------------HSTTFHSHGSGYHKIDESG------MSPVGHGHSHS---LLGNHGNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQ 347          
BLAST of slc30a-10 vs. Ensembl Zebrafish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 264.618 bits (675), Expect = 2.806e-84
Identity = 154/384 (40.10%), Postives = 233/384 (60.68%), Query Frame = 1
Query:  127 DVVIRRECKFKSPLSKNMDRQ---AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            D+   + C   +   ++ +R+   AK +L I   +C++F +GEI+GG  A SLA++TD+AHL  DL+SF+ISL ++ LS+R +T+++N+GWHRAEI+GAL S+  IW+VTGVL+Y A+ RIIN N+ I   +MLI S   V+ N+++AL LH   HGHSHGG                            S  H HS D  H +++      ++SD  +  D  + +  K+  N ++RAAF+HVIGD++QS  VL +A II+FKP++KIADPICTFLFS  V+ TT  I RD++ VL+E  P  +NYN+V   +  + G+  +HNL +W++T+ +  LS H+ VD     Q +L ++  +C  ++    +TIQ+E  A     C
Sbjct:   29 DMKDGKHCHDNNRALEDREREKKIAKKRLYIVSAVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDLTSFIISLCSLWLSSRPATRTLNYGWHRAEILGALLSIFTIWLVTGVLVYLAVERIINDNFTIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGL---------------------------SAGHGHSHD--HGKENGH----SHSD-GSHHDVEEQRPGKTQANASVRAAFVHVIGDLLQSISVLVSALIIFFKPEYKIADPICTFLFSLFVLGTTFTIMRDIVIVLMEGTPAGVNYNEVRQLLLGVKGVKAVHNLHIWALTMNQAVLSAHVTVDP----QEVLREMTQVCFTKYSFHSVTIQLEPQADQRPDC 374          
BLAST of slc30a-10 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 264.618 bits (675), Expect = 4.049e-84
Identity = 143/362 (39.50%), Postives = 219/362 (60.50%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            AK KL IA ++C++F +GE+IGG +A+SLAI+TD+AHL +D  S ++SL ++ +S+R  TK MNFGWHR+EI+GAL SV+ IWIVTGVL+Y AI RI+ ++Y I   +ML+ S   V++N+++A +LH                                     ++  H+H        +S        S V  G   S   +  +  N ++RAAFIHV+GD++QSFGV+ AA IIYF+P++KIADPICTFLFS  V+ TT+ I RDV  +L+E  P+ I +N V   + S+  +  +H+L LW++TL+++ LS H+ ++ + D QS+L++  ++   +F     TIQ+E  ++    C Q
Sbjct:   76 AKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIMAYILH------------------------------------HSTTFHSHGSGYHKIDESG------MSPVGHGHSHS---LLGNHGNTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIEENADPQSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQ 392          
BLAST of slc30a-10 vs. Ensembl Zebrafish
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 244.588 bits (623), Expect = 3.643e-77
Identity = 140/362 (38.67%), Postives = 208/362 (57.46%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            AK KL IA ++C++F +GE+IGG +A+SLAI+TD+AHL +D  S ++SL ++ +S+R  TK MNFGWHR+EI+GAL SV+ IWIVTGVL+Y AI RI+ ++Y I   +ML+ S   V++N++     H                                     + V H HS            LL  +                   N ++RAAFIHV+GD++QSFGV+ AA IIYF+P++KIADPICTFLFS  V+ TT+ I RDV  +L+E  P+ I +N V   + S+  +  +H+L LW++TL+++ LS H+ +D     QS+L++  ++   +F     TIQ+E  ++    C Q
Sbjct:   31 AKKKLFIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKIMNFGWHRSEILGALISVMSIWIVTGVLVYLAIERIVKNDYEIEGRVMLLTSGCAVVVNIIHGSGYHK------------------------------IDESGMSPVGHGHSHS----------LLGNHG------------------NTSVRAAFIHVLGDLLQSFGVMVAAIIIYFRPEYKIADPICTFLFSVFVLATTLTILRDVFRILMEGAPKGIQFNSVKEVLLSLKAVKAMHSLHLWALTLSQSLLSVHIAIDP----QSVLKEATELLQTKFGFYSTTIQVEPYSEDMIHCTQ 330          
BLAST of slc30a-10 vs. Ensembl Xenopus
Match: ENSXETT00000033890.1 (solute carrier family 30 (zinc transporter), member 3 [Source:NCBI gene;Acc:100497671])

HSP 1 Score: 273.478 bits (698), Expect = 2.213e-87
Identity = 152/382 (39.79%), Postives = 225/382 (58.90%), Query Frame = 1
Query:  136 IRRECKFKSPLS--KNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            + R C   S  S   N   QA+ KL  A  +C +F +GE++GG +A+SLAI+TD+AHL +DL S  +S+ ++ +S R  TKSMNFGWHR+EI+GAL SVL IWIVTGVL+Y A  RIIN++Y I+ ++MLI S   V +NV++A +LH                                    ++S  H HS    + +  + P            +S   ++     N ++RAAFIHVIGD++QS GV+ AA +IYFKPQ+KIADP+CTFLFS  V+ TT+ I RDV +VL+E  PR I Y  V   + S+ G+  +H+LRLW++TL++ A++ HL +D S + +S + +  ++   +F++   T+Q+E   +    C Q
Sbjct:   55 VPRHCHGASLSSAETNQKLQARRKLYFACAVCFIFMIGEVVGGSLAHSLAIMTDAAHLLTDLGSMCVSIFSLWISTRPPTKSMNFGWHRSEILGALASVLSIWIVTGVLVYLAAARIINNDYDIDGHVMLITSGCAVGVNVIMAYILH------------------------------------QSSPLHGHSHGSGYEKIGESP-----------SNSLALRLGGPHGNTSVRAAFIHVIGDLLQSIGVMVAAIVIYFKPQYKIADPLCTFLFSIFVLATTVTILRDVFWVLMEGAPRGIAYGSVKEVLLSVRGVRSVHSLRLWALTLSQNAVTVHLAIDESTEPESAVREATELLRSQFELCHSTVQVERYLEEMEECPQ 389          
BLAST of slc30a-10 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 265.388 bits (677), Expect = 1.394e-84
Identity = 144/364 (39.56%), Postives = 216/364 (59.34%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            ++A+ KL +A  +C++F +GE+IGG +A+SLAI+TD+AHL +D +S +ISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ RII+ +Y I  + MLI SA  V +N+++ + LH                                         H HS                      G   S S       N ++RAAFIHV+GD++QS GVL AA++IY+KP++KI DPICTFLFS LV++TT+ I RDV+ VL+E  P+ +++N V   + SI G+  +H+L +W++T+T+  LS H+ ++ + DSQ +L++       +F     TIQIE+ +     C +
Sbjct:   65 KRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLH--------------------------------------QTGHGHSHG-------------------DGNSHSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQE 371          
BLAST of slc30a-10 vs. Ensembl Xenopus
Match: slc30a2 (solute carrier family 30 member 2 [Source:NCBI gene;Acc:448552])

HSP 1 Score: 265.388 bits (677), Expect = 1.901e-84
Identity = 144/364 (39.56%), Postives = 216/364 (59.34%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            ++A+ KL +A  +C++F +GE+IGG +A+SLAI+TD+AHL +D +S +ISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ RII+ +Y I  + MLI SA  V +N+++ + LH                                         H HS                      G   S S       N ++RAAFIHV+GD++QS GVL AA++IY+KP++KI DPICTFLFS LV++TT+ I RDV+ VL+E  P+ +++N V   + SI G+  +H+L +W++T+T+  LS H+ ++ + DSQ +L++       +F     TIQIE+ +     C +
Sbjct:   66 KRARRKLYVASAVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFASMMISLFALWMSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVERIISGDYEIEGDAMLITSACAVAVNIIMGVTLH--------------------------------------QTGHGHSHG-------------------DGNSHSHSHAAGDHKNPSVRAAFIHVVGDLLQSVGVLIAAYVIYYKPEYKIIDPICTFLFSVLVLITTLTILRDVLLVLMEGTPKGVDFNLVKDTLLSIDGVKALHSLHIWALTVTQPVLSVHIAINENADSQKVLKEASSQLQNKFHFHTTTIQIENYSDDMKDCQE 372          
BLAST of slc30a-10 vs. Ensembl Xenopus
Match: nbr1 (neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GENE-949692])

HSP 1 Score: 246.514 bits (628), Expect = 2.821e-77
Identity = 143/360 (39.72%), Postives = 201/360 (55.83%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            AK KL IA ++C +F   EI+GG IA SLA++TD+AHL  DLSSF ISL ++ LS++ ST  + FGWHRAEI+GAL SV+ IW+VTGVL+Y A  R+I  +Y I+  +MLI SA  +  N++LAL+LH                                         H HS                      G+    +  +K   N ++RAAFIHVIGD+ QS  VL +A IIYFKP++K+ADPICTF+FS  V++TT+ + RD++ VL+E  PR I+Y+ V   I  + G+  +H+L LW++T+ +  LS H+  D   +S+ IL+ V       F    +TIQ+E     S  C
Sbjct:   64 AKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSKSSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACALGANLVLALILHQS--------------------------------------GHGHSH-------------------AGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILDVDGVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIEDQSPEC 366          
BLAST of slc30a-10 vs. Ensembl Xenopus
Match: gmip (GEM interacting protein [Source:Xenbase;Acc:XB-GENE-977540])

HSP 1 Score: 118.242 bits (295), Expect = 1.094e-28
Identity = 60/159 (37.74%), Postives = 99/159 (62.26%), Query Frame = 1
Query:  784 SSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVV--DASQDSQSILEKVYDMCIEEFKISEITIQIESSAK 1254
            +S S    S  ++ +RAAF+H +GD+ QS GVL AA+II FKP++KIADPICT++FS LV+ TT+ +  D + ++LE  PRH+N +++   +  I  +  + +L +WS+T  K+A   HL +  DAS   + +  K   + ++   + +  IQI+S  +
Sbjct:  250 NSPSPHGHSHGSLAVRAAFVHALGDLAQSIGVLIAAYIIRFKPEYKIADPICTYIFSVLVVFTTVRLVWDTVLIILEGVPRHLNVDRIKDDLMKIEDVYSVKDLNVWSLTTGKSAAIIHLQLCPDASSKWEEVQNKARHVLLKTHGMYKCFIQIQSYGQ 408          

HSP 2 Score: 107.842 bits (268), Expect = 5.658e-25
Identity = 66/164 (40.24%), Postives = 113/164 (68.90%), Query Frame = 1
Query:   82 VNLSNEELDSLPLLRDVVIRREC-KFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVL 570
            +N+++++   L   ++ V    C K  +   +    + K KL++A  L +LF +GE++GG +ANSLAI+TD+ H+ SDLSS +++L A+CLS++   K   FG+HR E++ A+ SV+L++I+TG L+Y AI R I+ +Y IN ++MLI +AVGV +N+++ ++L
Sbjct:   71 MNMASDDESLLESWQNRVKTEPCEKCSNHRERRKQGKVKRKLLLAAALYLLFMVGELVGGYVANSLAIMTDALHMLSDLSSIILTLLALCLSSKPPNKRFTFGFHRLEVLSAIVSVILVYILTGFLLYEAIQRTIHMDYNINGDVMLITAAVGVAVNLIMGILL 234          
BLAST of slc30a-10 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 258.07 bits (658), Expect = 6.801e-82
Identity = 147/362 (40.61%), Postives = 214/362 (59.12%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            ++A+ KL +A  +C++F +GEIIGG +A SLAI+TD+AHL +D +S LISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ R+I+ +Y I  + MLI S   V +N+++ L LH                                         H HS    H    D              DSS+ +      N ++RAAFIHVIGD++QS GVL AA+IIYFKP++K  DPICTFLFS LV+ TT+ I RDVI VL+E  P+ +++  V   + S+ G+  +H+L +W++T+ +  LS H+ +  + D+Q++L+   D    +F    +TIQIE  ++    C
Sbjct:   64 QRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQS--------------------------------------GHGHS----HGNSRD--------------DSSQQQ------NPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNC 363          
BLAST of slc30a-10 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 242.662 bits (618), Expect = 5.671e-77
Identity = 141/345 (40.87%), Postives = 201/345 (58.26%), Query Frame = 1
Query:  235 FMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
             +GEIIGG +A SLAI+TD+AHL +D +S LISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ R+I+ +Y I  + MLI S   V +N+++ L LH                                         H HS    H    D              DSS+ +      N ++RAAFIHVIGD++QS GVL AA+IIYFKP++K  DPICTFLFS LV+ TT+ I RDVI VL+E  P+ +++  V   + S+ G+  +H+L +W++T+ +  LS H+ +  + D+Q++L+   D    +F    +TIQIE  ++    C
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQS--------------------------------------GHGHS----HGNSRD--------------DSSQQQ------NPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNC 283          
BLAST of slc30a-10 vs. Ensembl Mouse
Match: Slc30a2 (solute carrier family 30 (zinc transporter), member 2 [Source:MGI Symbol;Acc:MGI:106637])

HSP 1 Score: 242.662 bits (618), Expect = 5.671e-77
Identity = 141/345 (40.87%), Postives = 201/345 (58.26%), Query Frame = 1
Query:  235 FMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
             +GEIIGG +A SLAI+TD+AHL +D +S LISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ R+I+ +Y I  + MLI S   V +N+++ L LH                                         H HS    H    D              DSS+ +      N ++RAAFIHVIGD++QS GVL AA+IIYFKP++K  DPICTFLFS LV+ TT+ I RDVI VL+E  P+ +++  V   + S+ G+  +H+L +W++T+ +  LS H+ +  + D+Q++L+   D    +F    +TIQIE  ++    C
Sbjct:    1 MIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQS--------------------------------------GHGHS----HGNSRD--------------DSSQQQ------NPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNC 283          
BLAST of slc30a-10 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 237.654 bits (605), Expect = 1.815e-74
Identity = 135/361 (37.40%), Postives = 207/361 (57.34%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            QA+ +L  A  +C +F  GE++GG +A+SLAI+TD+AHL +D+ S L SL ++ LS R +T++M FGWHR+E +GAL SV+ +WIVTG+L+Y A LR+++S+Y I A  ML+ +++ V  N+L+A VLH                                    +    H+H               +T ++    E+     +  S+ N ++RAAF+HV+GD++QSFGVLAA+ +IYFKPQ+K+ADPI TFLFS   + +T    RDV+ VL+E  PR + +  V   + S+PG+   H+L LW++TLT    S HL +D++ D +++L +        F  S  T+Q+E      A C
Sbjct:   22 QARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLH------------------------------------QTGAPHSHG--------------STGAEYAPLEEGHGYPM--SLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQC 330          
BLAST of slc30a-10 vs. Ensembl Mouse
Match: Slc30a3 (solute carrier family 30 (zinc transporter), member 3 [Source:MGI Symbol;Acc:MGI:1345280])

HSP 1 Score: 238.424 bits (607), Expect = 5.183e-74
Identity = 135/361 (37.40%), Postives = 207/361 (57.34%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            QA+ +L  A  +C +F  GE++GG +A+SLAI+TD+AHL +D+ S L SL ++ LS R +T++M FGWHR+E +GAL SV+ +WIVTG+L+Y A LR+++S+Y I A  ML+ +++ V  N+L+A VLH                                    +    H+H               +T ++    E+     +  S+ N ++RAAF+HV+GD++QSFGVLAA+ +IYFKPQ+K+ADPI TFLFS   + +T    RDV+ VL+E  PR + +  V   + S+PG+   H+L LW++TLT    S HL +D++ D +++L +        F  S  T+Q+E      A C
Sbjct:   71 QARRQLYAACAVCFIFMAGEVVGGYLAHSLAIMTDAAHLLADIGSMLASLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWIVTGILLYLAFLRLLHSDYHIEAGAMLLTASIAVCANLLMAFVLH------------------------------------QTGAPHSHG--------------STGAEYAPLEEGHGYPM--SLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKVADPISTFLFSICALGSTAPTLRDVLLVLMEGAPRSVEFEPVRDTLLSVPGVRATHDLHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQC 379          
BLAST of slc30a-10 vs. UniProt/SwissProt
Match: sp|Q2HJ10|ZNT2_MOUSE (Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc30a2 PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 4.757e-81
Identity = 147/362 (40.61%), Postives = 214/362 (59.12%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            ++A+ KL +A  +C++F +GEIIGG +A SLAI+TD+AHL +D +S LISL A+ +S+R +TK+MNFGWHRAEI+GAL SVL IW+VTGVL+Y A+ R+I+ +Y I  + MLI S   V +N+++ L LH                                         H HS    H    D              DSS+ +      N ++RAAFIHVIGD++QS GVL AA+IIYFKP++K  DPICTFLFS LV+ TT+ I RDVI VL+E  P+ +++  V   + S+ G+  +H+L +W++T+ +  LS H+ +  + D+Q++L+   D    +F    +TIQIE  ++    C
Sbjct:   64 QRARRKLYVASAICLVFMIGEIIGGYLAQSLAIMTDAAHLLTDFASMLISLFALWVSSRPATKTMNFGWHRAEILGALLSVLSIWVVTGVLVYLAVQRLISGDYEIKGDTMLITSGCAVAVNLIMGLALHQS--------------------------------------GHGHS----HGNSRD--------------DSSQQQ------NPSVRAAFIHVIGDLLQSVGVLVAAYIIYFKPEYKYVDPICTFLFSILVLGTTLTILRDVILVLMEGTPKGVDFTTVKNLLLSVDGVEALHSLHIWALTVAQPVLSVHIAIAQNADAQAVLKVARDRLQGKFNFHTMTIQIEKYSEDMKNC 363          
BLAST of slc30a-10 vs. UniProt/SwissProt
Match: sp|Q5I020|ZNT8_XENLA (Zinc transporter 8 OS=Xenopus laevis OX=8355 GN=slc30a8 PE=2 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 1.753e-78
Identity = 145/360 (40.28%), Postives = 205/360 (56.94%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            AK KL IA ++C +F   EI+GG IA SLA++TD+AHL  DLSSF ISLG++ LS++ ST  + FGW+RAEI+GAL S++ IW+VTGVL+Y AI RII  +Y I+  +MLI SA  +  NV+LAL+LH                                         H HS                      G+    +  +K   N ++RAAFIHVIGD+ QS  VL +A IIYFKP++KIADPICTF+FS  V++TT+ + RD++ +L+E  PR I+Y+ V   I ++ G+  +H+L LW++T+ +  LS H+  D   +S+ IL+ V       F    +TIQ+E   + S  C
Sbjct:   65 AKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLGSLWLSSKSSTMRLTFGWYRAEILGALMSIITIWLVTGVLVYLAIERIIRPDYTIDGTVMLITSACALGANVVLALILHQS--------------------------------------GHGHSH-------------------AGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKIADPICTFIFSIFVLITTVTVLRDLLNILMEGTPRGIHYSDVKQSILAVDGVKSVHSLHLWALTMNQVILSAHIATDILGESKRILKDVTQNVCSSFPFHSVTIQVEPVEEQSPEC 367          
BLAST of slc30a-10 vs. UniProt/SwissProt
Match: sp|Q5R617|ZNT3_PONAB (Zinc transporter 3 OS=Pongo abelii OX=9601 GN=SLC30A3 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 7.123e-77
Identity = 132/365 (36.16%), Postives = 206/365 (56.44%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNH-SQDVEHC---QDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
             A+ +L  A  +C +F  GE++GG +A+SLAI+TD+AHL +D+ S + SL ++ LS R +T++M FGWHR+E +GAL SV+ +W+VTG+L+Y A +R+++S+Y I    ML+ +++ V  N+L+A VLH                                    +A   H+H S+  E+    +  +EPL                     + N ++RAAF+HV+GD++QSFGVLAA+ +IYFKPQ+K ADPI TFLFS   + +T    RDV+ +L+E  PR++ +  V   + S+PG+   H L LW++TLT    S HL +D++ D +++L +        F  S  T+Q+E      A C
Sbjct:   71 HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLH------------------------------------QAGPPHSHGSKGAEYAPLEEGPEEPL--------------------PLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQC 379          
BLAST of slc30a-10 vs. UniProt/SwissProt
Match: sp|Q99726|ZNT3_HUMAN (Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC30A3 PE=1 SV=2)

HSP 1 Score: 247.669 bits (631), Expect = 7.278e-77
Identity = 132/365 (36.16%), Postives = 206/365 (56.44%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNH-SQDVEHC---QDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
             A+ +L  A  +C +F  GE++GG +A+SLAI+TD+AHL +D+ S + SL ++ LS R +T++M FGWHR+E +GAL SV+ +W+VTG+L+Y A +R+++S+Y I    ML+ +++ V  N+L+A VLH                                    +A   H+H S+  E+    +  +EPL                     + N ++RAAF+HV+GD++QSFGVLAA+ +IYFKPQ+K ADPI TFLFS   + +T    RDV+ +L+E  PR++ +  V   + S+PG+   H L LW++TLT    S HL +D++ D +++L +        F  S  T+Q+E      A C
Sbjct:   71 HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHRSETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLH------------------------------------QAGPPHSHGSRGAEYAPLEEGPEEPL--------------------PLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGSTAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLAEASSRLYSRFGFSSCTLQVEQYQPEMAQC 379          
BLAST of slc30a-10 vs. UniProt/SwissProt
Match: sp|Q5XHB4|ZNT8_XENTR (Zinc transporter 8 OS=Xenopus tropicalis OX=8364 GN=slc30a8 PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 7.852e-77
Identity = 143/360 (39.72%), Postives = 202/360 (56.11%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            AK KL IA ++C +F   EI+GG IA SLA++TD+AHL  DLSSF ISL ++ LS++ ST  + FGWHRAEI+GAL SV+ IW+VTGVL+Y A  R+I  +Y I+  +MLI SA  +  N++LAL+LH                                         H HS                      G+    +  +K   N ++RAAFIHVIGD+ QS  VL +A IIYFKP++K+ADPICTF+FS  V++TT+ + RD++ VL+E  PR I+Y+ V   I ++ G+  +H+L LW++T+ +  LS H+  D   +S+ IL+ V       F    +TIQ+E     S  C
Sbjct:   64 AKKKLCIASLICFVFISAEIVGGYIAGSLAVVTDAAHLLVDLSSFFISLCSLWLSSKSSTTRLTFGWHRAEILGALMSVITIWLVTGVLVYLACERLIRPDYTIDGTVMLITSACALGANLVLALILHQS--------------------------------------GHGHSH-------------------AGGKHEHMASEYKPQTNASIRAAFIHVIGDLFQSISVLISALIIYFKPEYKMADPICTFIFSIFVLITTVTVLRDLLTVLMEGTPRGIHYSDVKQSILAVDGVKSVHSLHLWALTMNQVILSAHIATDIVGESKRILKDVTQNVFARFPFHSVTIQVEPIEDQSPEC 366          
BLAST of slc30a-10 vs. TrEMBL
Match: A0A0H3YF85 (Slc30a-10 OS=Schmidtea mediterranea OX=79327 GN=slc30a-10 PE=2 SV=1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 405/405 (100.00%), Postives = 405/405 (100.00%), Query Frame = 1
Query:   67 MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD 1281
            MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHGQSNGGGGHGHGHGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD
Sbjct:    1 MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHGQSNGGGGHGHGHGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD 405          
BLAST of slc30a-10 vs. TrEMBL
Match: A0A5K4EWQ4 (Cation efflux protein/ zinc transporter,putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 1.095e-97
Identity = 172/406 (42.36%), Postives = 252/406 (62.07%), Query Frame = 1
Query:   70 IINDVN-LSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSS-KSKVFKSID--NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            I N +N LS  E  S PL     +   C   S +S N+D+ A+ KLI+A  LC+ F  GEIIGG +A+SLAI+TD+AHL +D +SFLISL A+ L++R STK M+FGWHRAE++GAL SVLLIW+VTG+L+Y A++RII++NY IN  IMLI SA GV +N+++   LH                                         HNH+   EH  +  +P +TT S+          ++++K ++  NI +R+A+IHVIGD++QS GV+  A +IYF+P++KI DP+CTFLFS LV++TT+ I RD + VL+E  PR +N+N+V   +  IPG+ +IHNL +WS+T  KTA+S HL ++   ++Q IL++   +  + +   ++TIQ+E   +  A C Q
Sbjct:   22 ITNKLNVLSKHERLSSPLPVQPSLNDHCHEYSTVSSNIDKSARRKLILASGLCLFFMTGEIIGGALAHSLAIMTDTAHLLTDFASFLISLLALFLASRPSTKRMSFGWHRAEVVGALASVLLIWLVTGILVYLAVIRIIHNNYEINGKIMLITSATGVGVNIIMLFTLHNH--------------------------------------GHNHTSLNEHSNELPKPTITTISNHNHNHKYDINNEIYKELNRPNITVRSAYIHVIGDLLQSIGVMITAMVIYFQPKYKIIDPLCTFLFSILVLITTLNILRDALNVLMEATPRGLNFNEVKSSLMDIPGVREIHNLHIWSLTTNKTAVSVHLAIENDSNTQEILKQANYLLKQRYLAHDVTIQLELYVEEMANCYQ 389          
BLAST of slc30a-10 vs. TrEMBL
Match: A0A0H3YKE4 (Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc30a-8 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 3.066e-95
Identity = 156/367 (42.51%), Postives = 235/367 (64.03%), Query Frame = 1
Query:  175 NMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
             +D+ A+ KL++A +LC++F +GEI+GG +A+SLAI+TD+AHL +D +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVL+IW+VTG+L+Y A++R+++  + I   IMLI S  G+IIN+++A  LH   H                                  S   N+  D EH                 G    KS+     +NIN+RAAFIHVIGD++QS GV  AA +IY KP++KIADPICTF+FS LV++TTI I RD + VL+E  P+ +++N+V      +PG++++HNLR+WS+T++KTALS H+ +D  Q++ +IL    +M  + F+I+++TIQ+E+     A C Q
Sbjct:   64 GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHT-------------------------------HGSSKSNNETDKEH-----------------GHSHGKSEK----ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQ 378          
BLAST of slc30a-10 vs. TrEMBL
Match: A0A183JW98 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS6993 PE=4 SV=1)

HSP 1 Score: 297.36 bits (760), Expect = 4.648e-94
Identity = 166/385 (43.12%), Postives = 237/385 (61.56%), Query Frame = 1
Query:  136 IRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKS---KVFKSID--NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            I   C   S +S N+D+ A+ KLI+A  LC+ F  GEIIGG +A+SLAI+TD+AHL +D +SFLISL A+ L++R STK M+FGWHRAE++GAL SVLLIW+VTG+L+Y A++RII++NY IN  IMLI SA GV +N+++   LH                                        +HNH+   EH          T+ +     + S      + K  +  NI +RAAFIHVIGD++QS GV+ AA +IYF+P++KI DP+CTFLFS LV++TTI I RD + VL+E  PR +N+N+V   + +I G+ +IHNL +WS+T  KTA+S HL ++   ++Q IL++   +  + +   ++TIQ+E   K  A C Q
Sbjct:    1 IDDHCHEHSTVSSNIDKNARRKLILASGLCLFFMTGEIIGGALAHSLAIMTDAAHLLTDFASFLISLLALYLASRPSTKRMSFGWHRAEVVGALASVLLIWLVTGILVYLAVIRIIHNNYEINGKIMLITSATGVGVNIIMLFTLHNH--------------------------------------DHNHNSLNEHSHQELNSFPRTHVNHLTINNHSHEINHDIHKEFNRPNITVRAAFIHVIGDLLQSIGVMIAAMVIYFQPKYKIIDPLCTFLFSLLVLITTINILRDALNVLMEATPRGLNFNEVKNSLMNINGVKEIHNLHMWSLTTNKTAVSVHLAIENDSNAQEILKQANHLLKQRYLAHDVTIQLELYVKEMADCYQ 347          
BLAST of slc30a-10 vs. TrEMBL
Match: V4AF44 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_180179 PE=4 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 1.207e-93
Identity = 167/366 (45.63%), Postives = 241/366 (65.85%), Query Frame = 1
Query:  178 MDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            +D +AK KLIIA +LC++F +GE++GG++A SLAI++D+AHL +D +SF+ISL A+ L+ R++TK ++FGW+R EI+GA  S+L++W++TG+L Y+A+ RII++ Y INA++MLI +  GV  N+ L   LH   H HSH GG                             + NHS D +   D++    + NS   +    S ++  KS +NIN++AAFIHVIGD+ QS GVL AAFIIYFKP+WKIADPICTFLFS  V++TT+ I RD+I VL+E  PRH+ +  +      I GI  IHNLR+WS+T+ K ALS H+ V +S D+QS+L+   +M  E+F+I+E T+QIE   +    C +
Sbjct:   24 VDGKAKKKLIIASLLCLIFMVGEMVGGLVAGSLAIISDAAHLLTDFASFMISLMALYLAQRRATKKLSFGWYRIEILGAFLSILMLWVLTGILCYSAVNRIIDTTYSINADVMLITAGCGVAFNLALGFTLHQSGHTHSHLGG--------------------------GHSHGNHSHDSKK-HDTNH---SHNSHNESEHGHSHNRKSKSKNNINVKAAFIHVIGDLCQSIGVLVAAFIIYFKPEWKIADPICTFLFSLFVIVTTVTILRDIIVVLMEGTPRHLVFGDIRDAFYEIEGIKDIHNLRVWSLTMNKIALSVHIAVYSSADTQSVLKMASNMIKEKFEITETTMQIEEYVEEMLDCSR 359          
BLAST of slc30a-10 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 263.462 bits (672), Expect = 8.373e-84
Identity = 148/386 (38.34%), Postives = 232/386 (60.10%), Query Frame = 1
Query:  127 DVVIR--RECKFKSPLSKNMDRQ---AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            D+V++  + C   S   ++ +++   A+ +L I  V+C++F +GEI+GG  A SLA++TD+AHL  D +SF+ISL ++ LS+R +T ++N+GWHRAEI+GAL SV  IW+VTGVL+Y A+ R+I+ +Y I   +MLI S   V+ N+++AL LH   HGHSHGG                               H+HS    H + +       N D    E+ +  K  K+ +N ++RAAF+HVIGD++QS  VL +A II+F+P++K+ADPICTFLFS  V+ TT  I RD++ VL+E  P  ++Y +V  R+ S+ G+  +HNL +W++T+ +  LS H+ +D + + Q +L ++   C   +    +TIQ+E        C
Sbjct:   31 DMVLKDSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVFTIWLVTGVLVYLAVERLISDDYEIEGTVMLITSGCAVLANIIMALTLHQSGHGHSHGGLSSQGH------------------------GHSHSGAHSHEKKNGHSHAYANGDSHNPENKTTGK--KTQENASVRAAFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDC 390          
BLAST of slc30a-10 vs. Ensembl Cavefish
Match: slc30a2 (zinc transporter 2 [Source:NCBI gene;Acc:103036936])

HSP 1 Score: 259.996 bits (663), Expect = 2.265e-82
Identity = 144/372 (38.71%), Postives = 221/372 (59.41%), Query Frame = 1
Query:  157 KSPLSKNMDRQ-AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            K+   +N ++  AK KL IA ++C++F +GE+IGG +A+SLAI+TD+AHL +D  S ++SL ++ +S+R  TK+MNFG+HR+EI+GA  SV+ IWIVTGVL+Y AI RI+ ++Y I  ++ML+ S   V++N+++A +LH                                     ++  H H        +        N     G   S S +     N ++RAAFIHV+GD++QSFGVL AA IIYF+P++K+ADPICTFLFS  V+ TTI I RDV  +L+E  PR I +N V   + S+  +  IH+L LW++T+ ++ +S H+ ++ + D QS+L++  ++   +F     TIQIE   +  A C
Sbjct:   64 KTAWEENREKLVAKKKLYIASIVCLVFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGFHRSEILGAFISVMSIWIVTGVLVYLAIERIVKNDYEIEGHVMLLTSGCAVVVNIIMAYILH------------------------------------HSTTFHGHGSGYHKIDE--------NGMSPVGHGHSHS-LLSGHGNTSVRAAFIHVLGDLLQSFGVLVAAIIIYFRPEYKVADPICTFLFSVFVLGTTITILRDVFRILMEGAPRGIEFNSVKEVLLSLKAVKAIHSLHLWALTVGQSLVSVHVAIEENADHQSVLKEATELLQTKFGFYSTTIQIEPYCEDMAYC 390          
BLAST of slc30a-10 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 145.591 bits (366), Expect = 3.682e-39
Identity = 66/153 (43.14%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            N ++RAAFIHV+GD++QS GV  AA IIYF P+WKIADP+CTFLFS L++ TT  I +D+  +L+E  P  I+++ V   + ++ G+  IH+L LW++T+++  +S H V+D     Q++L  + +M   +F    ITIQIE+ +  +A C +
Sbjct:  206 NTSVRAAFIHVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRE 358          

HSP 2 Score: 126.716 bits (317), Expect = 2.684e-32
Identity = 66/140 (47.14%), Postives = 105/140 (75.00%), Query Frame = 1
Query:  157 KSPLSKNMDRQ-AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            ++  ++N ++  A  KL+I  +LC++F +GE+IGG  A+SLA++TD+AHL +D  S LISL ++ +S+R ++K+M +GWHR+E++G L SVL IW VT VL++ AI RI+ ++Y I++  MLI S   VI+N+L+AL+LH
Sbjct:   53 RAAWAQNEEKSGAWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMALILH 192          
BLAST of slc30a-10 vs. Ensembl Cavefish
Match: SLC30A2 (zinc transporter 2-like [Source:NCBI gene;Acc:103045971])

HSP 1 Score: 144.821 bits (364), Expect = 4.574e-39
Identity = 66/153 (43.14%), Postives = 103/153 (67.32%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
            N ++RAAFIHV+GD++QS GV  AA IIYF P+WKIADP+CTFLFS L++ TT  I +D+  +L+E  P  I+++ V   + ++ G+  IH+L LW++T+++  +S H V+D     Q++L  + +M   +F    ITIQIE+ +  +A C +
Sbjct:  193 NTSVRAAFIHVVGDLLQSLGVALAATIIYFWPEWKIADPVCTFLFSILILATTSTILKDIFKILMEGTPHGIDFDFVKEALLAVRGVKSIHSLHLWALTMSQPQISVHTVIDEQTSPQTVLLDLTEMLQSDFNFHNITIQIETYSNDAAHCRE 345          

HSP 2 Score: 126.331 bits (316), Expect = 3.069e-32
Identity = 66/140 (47.14%), Postives = 105/140 (75.00%), Query Frame = 1
Query:  157 KSPLSKNMDRQ-AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            ++  ++N ++  A  KL+I  +LC++F +GE+IGG  A+SLA++TD+AHL +D  S LISL ++ +S+R ++K+M +GWHR+E++G L SVL IW VT VL++ AI RI+ ++Y I++  MLI S   VI+N+L+AL+LH
Sbjct:   40 RAAWAQNEEKSGAWRKLLITSILCLVFMIGEVIGGYAAHSLAVMTDAAHLLTDFGSILISLFSLWISSRPASKTMTYGWHRSEVLGGLLSVLSIWAVTAVLVFIAIQRILQNDYEIHSGAMLITSGCAVIVNILMALILH 179          
BLAST of slc30a-10 vs. Ensembl Cavefish
Match: slc30a8 (solute carrier family 30 member 8 [Source:ZFIN;Acc:ZDB-GENE-060315-10])

HSP 1 Score: 139.428 bits (350), Expect = 4.972e-37
Identity = 59/145 (40.69%), Postives = 94/145 (64.83%), Query Frame = 1
Query:  835 AFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC 1269
            AF+HVIGD++QS  VL +A II+F+P++K+ADPICTFLFS  V+ TT  I RD++ VL+E  P  ++Y +V  R+ S+ G+  +HNL +W++T+ +  LS H+ +D + + Q +L ++   C   +    +TIQ+E        C
Sbjct:  196 AFVHVIGDLLQSISVLVSALIIFFRPEYKMADPICTFLFSLFVLGTTFTIMRDILVVLMEGTPAGVDYREVRERLLSVKGVKAVHNLHIWALTMNQAVLSAHVAIDDATEPQVVLREITQSCFTTYSFHSVTIQLEQQEDQRPDC 340          

HSP 2 Score: 131.339 bits (329), Expect = 3.777e-34
Identity = 70/154 (45.45%), Postives = 110/154 (71.43%), Query Frame = 1
Query:  127 DVVIR--RECKFKSPLSKNMDRQ---AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            D+V++  + C   S   ++ +++   A+ +L I  V+C++F +GEI+GG  A SLA++TD+AHL  D +SF+ISL ++ LS+R +T ++N+GWHRAEI+GAL SV  IW+VTGVL+Y A+ R+I+ +Y I   +MLI S   V+ N+++AL LH
Sbjct:   31 DMVLKDSKHCHDSSHAFEDREKEKKVARKRLYIVSVVCLVFMVGEILGGYFAGSLAVMTDAAHLLVDFTSFIISLCSLWLSSRPATHTLNYGWHRAEILGALLSVFTIWLVTGVLVYLAVERLISDDYEIEGTVMLITSGCAVLANIIMALTLH 184          
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 239.195 bits (609), Expect = 3.348e-75
Identity = 138/359 (38.44%), Postives = 205/359 (57.10%), Query Frame = 1
Query:  169 SKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHR-AEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            S+   R A+ KL IA V+C+LF  GEI GG +A+SLAI+TD+AHLF+D +SF ISL ++ +S+R  TK+MNFGW+R  EI+GAL SVL IW+VTGVL+Y A LR+I  ++ I    ML+ S   + +NV+++  L+                                        NH HS        ++   LT      +G  +          N ++RAAFIHV+GD++QS GVL AA +IY +P++KIADPICTF+FSF V+ TT+ I RDV+ VL+E  PR + +  V   + ++P +  +H++ LWS+T+   A+  H+ VD     + ++ +   +    F  S +TIQ+E
Sbjct:   62 SEGERRHARRKLCIAAVICLLFMAGEIFGGFLAHSLAIMTDAAHLFADFASFSISLFSLWVSSRPPTKTMNFGWYRMPEILGALLSVLTIWVVTGVLVYLASLRLIYKDFEIEGTAMLVTSGCAIAVNVIMSFTLY--------------------------------------QANHLHSHGGVTADATEPKPLTMAEGPVSGPQA----------NPSVRAAFIHVVGDLLQSIGVLIAACVIYAEPEYKIADPICTFVFSFFVLFTTVTILRDVLLVLMEGAPRAVKFTDVQEALLALPHVCSVHDVHLWSLTINHCAICAHVCVDDIGKGEEVVREATVVLQTRFSFSVLTIQVE 372          
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 112.464 bits (280), Expect = 3.099e-29
Identity = 61/123 (49.59%), Postives = 90/123 (73.17%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVL 555
            +AK +L +  V+C +F +GE +GGI+A+SLAI+TD AHL +D +SF ISL ++ L+ R ++K M FGW+RAEI+GAL S+  IW+VTGVL+Y A  R+I+ ++ I    ML  SA  VI+N++
Sbjct:    1 RAKRQLYLVSVICFVFIIGEAVGGILAHSLAIMTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVNIM 123          

HSP 2 Score: 46.2098 bits (108), Expect = 3.566e-6
Identity = 21/36 (58.33%), Postives = 28/36 (77.78%), Query Frame = 1
Query:  802 FKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFK 909
             +S  N ++RAAFIH +GD++QS GVL AA II+FK
Sbjct:  138 LQSHSNPSIRAAFIHALGDLLQSIGVLVAACIIFFK 173          
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Match: slc30a2 (solute carrier family 30 member 2 [Source:ZFIN;Acc:ZDB-GENE-041014-347])

HSP 1 Score: 101.293 bits (251), Expect = 1.315e-25
Identity = 76/216 (35.19%), Postives = 108/216 (50.00%), Query Frame = 1
Query:  283 LTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIAD 930
            +TD AHL +D +SF ISL ++ L+ R ++K M FGW+RAEI+GAL S+  IW+VTGVL+Y A  R+I+ ++ I    ML  SA  VI+N+++A++L                                           +HS       DS+ P          G    +S    SI     RAAFIH +GD++QS GVL AA II+FKP   + +
Sbjct:    1 MTDVAHLLTDFASFSISLLSLWLADRPTSKRMTFGWYRAEILGALLSIFSIWVVTGVLVYLAACRMISRDFAIEGTAMLATSACAVIVNIIMAVLL----------------------------------------ARGHHSSGPS--GDSEAPPAVPLH--LHGHSHLQSHSNPSI-----RAAFIHALGDLLQSIGVLVAACIIFFKPPLPMPE 167          
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 84.3445 bits (207), Expect = 3.607e-18
Identity = 86/368 (23.37%), Postives = 159/368 (43.21%), Query Frame = 1
Query:  178 MDRQAKTKLIIAVVLCI--LFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQ---DSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKP-------QWKIA-DPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            M R +     +  +LC   +FF+ E++ G + NSLA++ DS ++ SD  S    L +  L+   +T    +G  R E++ AL +   +  ++  +   A+  +   + + N  ++LI+ A+G+ +N L  L+L       S        + G        G           +      +D  H       +E L+ T+ D   G    +SK     + IN+R   +H +GD + S  V+  A I   +P        W+   DP  T   + +++ + + + R+   +LL+  P  I    +  ++S IPG+  IH L +W +T  +   S H+      D  +    ++D+   E  I +IT+Q E
Sbjct:    1 MGRYSGRSFRLICMLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFLVALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVN-LTGLMLFQDCFSCSRLCARFNAAEGTDDRKPRTGDKSTLSEKENYTDVSMKREDTFHFTYFIQPEERLIFTSGDEEMGASVKRSKE----NAINIRGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHIKCAGMSDYATAGLHIHDLLQLE-GIDDITVQPE 362          
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Match: slc30a10 (solute carrier family 30 member 10 [Source:ZFIN;Acc:ZDB-GENE-060608-2])

HSP 1 Score: 75.8702 bits (185), Expect = 1.287e-15
Identity = 75/333 (22.52%), Postives = 142/333 (42.64%), Query Frame = 1
Query:  178 MDRQAKTKLIIAVVLCI--LFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDN-INLRAAFIHVIGDIIQSFGVLAAAFIIYFKP-------QWKIA-DPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHL 1143
            M R +     +  +LC   +FF+ E++ G + NSLA++ DS ++ SD  S    L +  L+   +T    +G  R E++ AL +   +  ++  +   A+  +   + + N  ++LI+ A+G+ +N L  L+L       S                             R     N ++      D  +P          G++   + V +S +N IN+R   +H +GD + S  V+  A I   +P        W+   DP  T   + +++ + + + R+   +LL+  P  I    +  ++S IPG+  IH L +W +T  +   S H+
Sbjct:    1 MGRYSGRSFRLICMLCFTSVFFVTELVSGYVGNSLALVADSFNMLSDALSLTSGLASARLARWPATSRHTYGLVRGEVVSALATASFLVALSLSVAVQALKALSQPDVIDNPRLVLIVGALGLSVN-LTGLMLFQDCFSCS-----------------------------RLCARFNAAEGT----DDRKPR--------TGDEEMGASVKRSKENAINIRGVLLHTLGDALGSVTVVITAIIFNVRPIASKEECNWQCYIDPALTIAMTLIIITSAVRLIREAAVILLQIVPPDILIKDIEQKLSGIPGVQSIHRLHVWRLTAGRDVASVHI 291          
BLAST of slc30a-10 vs. Ensembl Yeast
Match: COT1 (Vacuolar transporter that mediates zinc transport into the vacuole; overexpression confers resistance to cobalt and rhodium; protein abundance increases in response to DNA replication stress; COT1 has a paralog, ZRC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005843])

HSP 1 Score: 94.3597 bits (233), Expect = 1.934e-21
Identity = 93/385 (24.16%), Postives = 175/385 (45.45%), Query Frame = 1
Query:  193 KTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSA-RQSTKSMNFGWHRAEIIGALF-SVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSD--------------EPLLTTNSDVCAGEDSSKSKVF-----------------KSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKP-QWKI-ADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            + K+I  ++L  +FF  EI  G +++SLA++ DS H+ +D+ S +++L A+ ++  R    +  +GW RAEI+GAL  +V LI +   +LI  A+ RII    + N   +L +   G+I N +   + H     H HG G                              H H   +E+    D              +  +  N+ +   E++SK+  +                 K   ++N+   F+HV+GD + + GV+ +AF I+     WK   DP+ + + + ++  + + +      +LL+  P  ++ ++V   +  IPGI+ IH+  +W++T +    S H+ +D S +  + L K+    +  + I   T+Q E
Sbjct:    7 QVKIISLLLLDTVFFGIEITTGYLSHSLALIADSFHMLNDIISLVVALWAVNVAKNRNPDSTYTYGWKRAEILGALINAVFLIALCVSILI-EALQRIIAPPVIENPKFVLYVGVAGLISNTVGLFLFHDNDQEHGHGHGHSHGGIFADHEMHMPSSHTH---------THAHVDGIENTTPMDSTDNISEIMPNAIVDSFMNENTRLLTPENASKTPSYSTSSHTIASGGNYTEHNKRKRSLNMHGVFLHVLGDALGNIGVMLSAFFIWKTDYSWKYYTDPLVSLIITGIIFSSALPLSCKASKILLQATPSTLSGDQVEGDLLKIPGIIAIHDFHIWNLTESIFIASLHIQLDISPEQFTDLAKIVRSKLHRYGIHSATLQPE 381          
BLAST of slc30a-10 vs. Ensembl Yeast
Match: ZRC1 (Vacuolar membrane zinc transporter; transports zinc from cytosol to vacuole for storage; also has role in resistance to zinc shock resulting from sudden influx of zinc into cytoplasm; human ortholog SLC30A10 functions as a Mn transporter and mutations in SLC30A10 cause neurotoxic accumulation of Mn in liver and brain; ZRC1 has a paralog, COT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004856])

HSP 1 Score: 70.0922 bits (170), Expect = 1.745e-13
Identity = 45/178 (25.28%), Postives = 89/178 (50.00%), Query Frame = 1
Query:  715 VEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIY-FKPQWKI-ADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            V    +  +PLL  N D       SK    +S+   N+   F+HV+GD + + GV+AAA  I+  +  W+  +DPI + + + ++  + + + R    +LL+  P  I+ +++   I ++PG++ +H+  +W++T +    S H+ +D + D      K+      +  I   T+Q E
Sbjct:  200 VNRLSNESQPLL--NHDDHDHSHESKKPGHRSL---NMHGVFLHVLGDALGNIGVIAAALFIWKTEYSWRYYSDPIVSLIITIIIFSSALPLSRRASRILLQATPSTISADQIQREILAVPGVIAVHDFHVWNLTESIYIASIHVQIDCAPDKFMSSAKLIRKIFHQHGIHSATVQPE 372          

HSP 2 Score: 52.373 bits (124), Expect = 7.905e-8
Identity = 38/126 (30.16%), Postives = 73/126 (57.94%), Query Frame = 1
Query:  199 KLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSA-RQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            ++I  + L  +FF+ EI  G +++SLA++ DS H+ +D+ S L++L A+ ++  R       +GW RAEI+GAL + + +  +   ++  A+ R+I    + N  ++L +   G+I NV+   + H
Sbjct:    8 RIISLLTLDTVFFLLEITIGYMSHSLALIADSFHMLNDIISLLVALWAVDVAKNRGPDAKYTYGWKRAEILGALINAVFLIALCFSIMIEALQRLIEPQEIQNPRLVLYVGVAGLISNVVGLFLFH 133          
BLAST of slc30a-10 vs. Ensembl Nematostella
Match: EDO30554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0G7])

HSP 1 Score: 254.218 bits (648), Expect = 1.019e-81
Identity = 137/358 (38.27%), Postives = 210/358 (58.66%), Query Frame = 1
Query:  172 KNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            K        +L IA  LC+ F + E +GG  +NSLAI+TD+AH+ SD + F+ISL A+ ++ R +TK++++GW+RAE++GA+ SVL+IW++TGVL+Y A+ R+I   Y ++A +MLI ++ G++INV++  +L+ +                                       H HS                      GE+          +N+N+RAAFIHVIGD +QS GV  AA II+FKP+W IADPICTF+FS +V+ TT+ I +D + VL+E  P+ +++N +   +++IPG+  +H+L +WS+T+   ALS HLVVD S ++Q ILE    +C + F I   TIQIE+
Sbjct:    2 KKSSSNPTRRLRIASFLCLFFMIAEFVGGYFSNSLAIMTDAAHMLSDFAGFMISLFAIWVATRPATKTLSYGWYRAEVMGAVLSVLVIWVLTGVLVYMALQRLIMKEYEVDAKVMLITASGGLLINVIMGAILYQK--------------------------------------GHGHSH---------------------GEEE---------ENVNVRAAFIHVIGDFLQSLGVFVAALIIWFKPEWAIADPICTFIFSIIVLFTTLAILKDALIVLMEGMPKGLSFNDLKTSLTAIPGVEAVHDLHVWSLTVGTDALSVHLVVDNSANTQDILEAASQVCSKSFDIHHSTIQIET 291          
BLAST of slc30a-10 vs. Ensembl Nematostella
Match: EDO48857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHI7])

HSP 1 Score: 175.252 bits (443), Expect = 1.765e-51
Identity = 111/353 (31.44%), Postives = 183/353 (51.84%), Query Frame = 1
Query:  199 KLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYV-----INANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            +LIIA + C++F   E+ GG+IANSLA++ D+ H   DL+S L SL A  ++  +      +G+ RAEI+GA   +L++W++TGVL+Y A+LR++    +     +NA++M+I +      N++LA +L                                      + V  +H     H   S E      +D C G             NIN+RAAF+H IGDII +FGVL A  II  KP+W+ AD IC+ + + +V++TT  + RD   +L E  PR +   +V   +S++  +V  HN+ +W++T  +  L+ HLVV+   D+Q++L+        ++ +   T+Q+E
Sbjct:    2 RLIIATLFCVVFIACEVTGGVIANSLAVMNDALHQLFDLNSLLASLLAAWIAGWKPNSQKTYGYFRAEILGACLVILMLWLLTGVLVYEALLRLLAGTAMGHSDHVNADVMMITAGFTCAANIVLAFML--------------------------------------SGVGRHH-----HSHGSYE-----KNDNCEG-------------NINIRAAFLHTIGDIIYAFGVLLAGLIIKIKPEWQKADAICSLVGAVIVLVTTYAVIRDSFNILFEGVPRDVRIAEVKRDLSTLHHVVSFHNVHVWALTSGRNLLTAHLVVEPEADTQTLLKIASKRLSSKYSLYHCTLQLE 293          
BLAST of slc30a-10 vs. Ensembl Nematostella
Match: EDO43612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY04])

HSP 1 Score: 160.229 bits (404), Expect = 2.359e-45
Identity = 78/157 (49.68%), Postives = 111/157 (70.70%), Query Frame = 1
Query:  775 GEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLE-RKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            G+  S S + K  +NIN+RAAFIHV+GD++QS GVL AA+II +KP WK+ADPICTFLFS LV++TT+ I RD I+VL+E   P+++NYN V   + +I G+V  H+L +WS+T+ K AL+ HL +  + DSQ +L   +     +F+I   TIQ+E
Sbjct:  158 GKPRSGSVLEK--ENINVRAAFIHVLGDVVQSVGVLIAAYIIKYKPSWKLADPICTFLFSILVLITTLNIVRDTIHVLMEGSTPKNVNYNAVKAGLENIQGVVAAHSLHIWSLTVNKAALAVHLAIGPNVDSQKVLNIAHQKLKTQFQIFHSTIQVE 312          

HSP 2 Score: 117.472 bits (293), Expect = 1.221e-29
Identity = 62/129 (48.06%), Postives = 98/129 (75.97%), Query Frame = 1
Query:  187 QAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            + + KL  A V+C+ F + E++GG +A+SLAI+TD+AH+ SD ++F+ISL A+ ++  Q  K   FG++RAEI+GAL SVL+IW++TG+L+Y A+ R+I  ++ INA+IMLI + V + IN+LL ++LH
Sbjct:    2 RTRKKLTTASVVCLFFVVAEVVGGYLAHSLAIMTDAAHMLSDFAAFMISLFAIWVAEWQPDKKRTFGYYRAEILGALVSVLIIWVLTGILVYLAVQRVITKDFDINADIMLITAGVALGINILLGIILH 130          
BLAST of slc30a-10 vs. Ensembl Nematostella
Match: EDO34617 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW3])

HSP 1 Score: 58.151 bits (139), Expect = 4.314e-9
Identity = 36/145 (24.83%), Postives = 76/145 (52.41%), Query Frame = 1
Query:  829 RAAFIHVIGDIIQSFGVLAAAFIIYFKPQWK--IADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTI--RISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSA 1251
               F+HV+ D + S GV+A++ +I    Q+   IADP+C+   + L+ L+ + + ++   VLL+R P  +  +      +I S  G++   +   W  + +    + H+ V  S   Q I+++V  +  +E+ ++ +++Q+E  A
Sbjct:  561 HGVFLHVVADTLGSVGVIASSILI---DQFGLFIADPVCSLFIASLIFLSVLPLLKESSLVLLQRTPLDMEKSLTGALNKILSFDGVLSFRDHHFWQHSESVVCGTIHVQVAPSASEQKIIQQVTSL-FKEYGVNNLSVQVEKEA 701          
BLAST of slc30a-10 vs. Ensembl Medaka
Match: slc30a2 (solute carrier family 30 member 3 [Source:NCBI gene;Acc:101167260])

HSP 1 Score: 255.758 bits (652), Expect = 2.279e-81
Identity = 142/369 (38.48%), Postives = 217/369 (58.81%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHC-QDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALC----DQSD 1281
            AK KL IA  +C++F +GE+IGG +A+SLAI+TD+AHL +D  S ++SL ++ +S+R  TK+MNFGWHR+EI+GA  SV+ IW+VTG L+Y AI RI+ ++Y I  ++ML  S   VI+N+++A +LH                                     ++  H H        +D   P+   ++ +  G  S          N ++RAAFIHVIGD++QS GV+ AA IIY +P++K+ADPICTFLFS  V+ TT+ I RDV  +L+E  P+ I ++ V   + S+  +  +H L LW++TL ++ +S HL ++   D Q+IL++  D+ I +F    ITIQ+E  ++  + C    D SD
Sbjct:   32 AKRKLFIASGVCLIFMIGEVIGGYLAHSLAIMTDAAHLLTDFGSMMVSLFSLWISSRPPTKTMNFGWHRSEILGAFVSVMSIWVVTGALVYLAIERIVQNDYEIEGHVMLATSGCAVIVNIIMAYILH------------------------------------HSTTLHPHGSGYHQIDEDGRSPVNHGHAHMLLGGHS----------NTSVRAAFIHVIGDLLQSIGVMVAAIIIYVRPEYKVADPICTFLFSLFVLCTTVTILRDVFRILMEGSPKGIEFSSVKEVLLSVKAVKSMHCLHLWALTLGQSLVSVHLAIEEEADPQAILQEATDLLIAKFGFHSITIQVELYSEDMSHCSHCQDPSD 354          
BLAST of slc30a-10 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 154.066 bits (388), Expect = 4.462e-42
Identity = 68/155 (43.87%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSA--KPS-ALCD 1272
            N ++RAAF+HVIGD++QS  VL +A +I+F+P++KIADPICTFLFS LV+ TT  I RD++ VL+E  P  + Y++V  R+ ++ G+  +HNL +W++T+ +  LS H+ +D S D+Q +L ++   C   +    +TIQ+E  A  KP  +LC+
Sbjct:  232 NASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCE 386          

HSP 2 Score: 125.561 bits (314), Expect = 9.728e-32
Identity = 64/128 (50.00%), Postives = 99/128 (77.34%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            AK +L +  V+C++F + EI+GG +A SLA++TD+AHL +DL+SFLISL ++ LS++ +T+ ++FGWHRAEI+GAL SV  IW+VTGVL+Y A+ R++  ++ I  +IMLI S   V+ N+++A+ LH
Sbjct:   52 AKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLH 179          
BLAST of slc30a-10 vs. Ensembl Medaka
Match: slc30a8 (solute carrier family 30 member 8 [Source:NCBI gene;Acc:101174514])

HSP 1 Score: 154.066 bits (388), Expect = 4.462e-42
Identity = 68/155 (43.87%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSA--KPS-ALCD 1272
            N ++RAAF+HVIGD++QS  VL +A +I+F+P++KIADPICTFLFS LV+ TT  I RD++ VL+E  P  + Y++V  R+ ++ G+  +HNL +W++T+ +  LS H+ +D S D+Q +L ++   C   +    +TIQ+E  A  KP  +LC+
Sbjct:  232 NASVRAAFVHVIGDLLQSISVLISAIVIFFRPEYKIADPICTFLFSILVLCTTFTIMRDILLVLMEGTPSGVKYSEVRDRLLAVKGVTAVHNLHIWALTMNQAMLSAHVAIDDSADAQMVLREMTQACFSSYNFHSVTIQMERQADLKPGCSLCE 386          

HSP 2 Score: 125.561 bits (314), Expect = 9.728e-32
Identity = 64/128 (50.00%), Postives = 99/128 (77.34%), Query Frame = 1
Query:  190 AKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            AK +L +  V+C++F + EI+GG +A SLA++TD+AHL +DL+SFLISL ++ LS++ +T+ ++FGWHRAEI+GAL SV  IW+VTGVL+Y A+ R++  ++ I  +IMLI S   V+ N+++A+ LH
Sbjct:   52 AKRRLYVVSVICLVFMVAEIVGGYLAGSLAVMTDAAHLLTDLTSFLISLFSLWLSSKPATQKLSFGWHRAEILGALLSVFTIWLVTGVLVYLAVERLVTDDFTIEGSIMLITSGCAVVANIIMAVTLH 179          
BLAST of slc30a-10 vs. Ensembl Medaka
Match: slc30a4 (solute carrier family 30 member 4 [Source:NCBI gene;Acc:101171398])

HSP 1 Score: 119.013 bits (297), Expect = 4.873e-29
Identity = 55/145 (37.93%), Postives = 93/145 (64.14%), Query Frame = 1
Query:  817 NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDS--QSILEKVYDMCIEEFKISEITIQIES 1245
            ++ +RAAFIH +GD++QS GVL AA+++ FKP++K+ADPICT++FS LV+ TTI I RD I ++LE  PRH++  ++   +  +  +  I  L +W++T  KTA   HL +  S     + +  K   + +  + +S  T+Q+++
Sbjct:  273 SLAVRAAFIHALGDLLQSVGVLIAAYVVRFKPEFKLADPICTYIFSVLVLFTTIRIIRDTIVIVLEGVPRHLDTQRIREDLLKLEDVQSIDELNVWALTADKTAAIVHLQLTPSSGHSWEDVQAKARHLLLHTYGLSRCTVQVQT 417          

HSP 2 Score: 101.679 bits (252), Expect = 4.978e-23
Identity = 58/130 (44.62%), Postives = 93/130 (71.54%), Query Frame = 1
Query:  184 RQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLH 573
            R+   +L+IA +L  LF  GEIIGG ++NSLAI+TD+ H+ +D+   L SL A+ LS +  TK   FG HR E++ A+ SV+LI+I+TGVL+Y A+ R ++ ++ I+ ++MLI +AVGV +N+++  +L+
Sbjct:  109 RRVMKRLVIAALLYFLFMTGEIIGGYVSNSLAIMTDAVHMLADVVGILFSLLALWLSTKPPTKRFTFGLHRLEVVSAVLSVVLIYILTGVLLYEAVQRTVHQDFSIDGDVMLITAAVGVAVNLIMGFLLN 238          
BLAST of slc30a-10 vs. Ensembl Medaka
Match: slc30a5 (solute carrier family 30 member 5 [Source:NCBI gene;Acc:101161255])

HSP 1 Score: 73.9442 bits (180), Expect = 1.094e-13
Identity = 73/367 (19.89%), Postives = 156/367 (42.51%), Query Frame = 1
Query:  157 KSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHIN--YNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSA 1251
            K  L + ++     ++   + L + F   E+  G+  NSL +++D  H+  D S+ ++ L A  ++  ++T+  ++G+ R EI+    + L + ++   +   ++ R+++    IN +++  +S  G+++N++                                            + +H HS   + CQ  D            GE   +     S   +     F+HV+ D + S GV+ +  +I  +  W IADPIC+   + L+ L+ I + ++   VLL R P       N    +I  + G++   +   W  +    A + HL V +    Q I ++V  + +++  ++ +++Q+E  A
Sbjct:  344 KDSLKQILEEYDSRQIFYFLCLNLAFTFVELFYGVWTNSLGLISDGFHMLFDCSALVLGLFAALMTRWKATRIFSYGFGRVEILSGFINGLFLMVIAFFVFMESVTRLLDPPN-INTDMLTPVSVGGLLVNLV-----------------------------------------GICAFSHAHSHGGKSCQSHDH-------GHSHGERDPEPNALMSSAGV-----FLHVLADTLGSVGVIISTLLIR-QFGWLIADPICSLFIATLIFLSVIPLLKEACEVLLLRTPPEHEKVLNGALEKIDKLEGVLSHRDAHFWRHSANMVAGTIHLQVMSDVVEQRITQQVTAL-LKDAGVNNLSVQVEKEA 654          
BLAST of slc30a-10 vs. Planmine SMEST
Match: SMESG000002070.1 (SMESG000002070.1)

HSP 1 Score: 711.064 bits (1834), Expect = 0.000e+0
Identity = 404/405 (99.75%), Postives = 404/405 (99.75%), Query Frame = 1
Query:   67 MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD 1281
            MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHG SNGGGGHGHGHGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD
Sbjct:    1 MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHGHSNGGGGHGHGHGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQSD 405          
BLAST of slc30a-10 vs. Planmine SMEST
Match: SMESG000013136.1 (SMESG000013136.1)

HSP 1 Score: 301.212 bits (770), Expect = 8.526e-99
Identity = 156/367 (42.51%), Postives = 235/367 (64.03%), Query Frame = 1
Query:  175 NMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSALCDQ 1275
             +D+ A+ KL++A +LC++F +GEI+GG +A+SLAI+TD+AHL +D +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVL+IW+VTG+L+Y A++R+++  + I   IMLI S  G+IIN+++A  LH   H                                  S   N+  D EH                 G    KS+     +NIN+RAAFIHVIGD++QS GV  AA +IY KP++KIADPICTF+FS LV++TTI I RD + VL+E  P+ +++N+V      +PG++++HNLR+WS+T++KTALS H+ +D  Q++ +IL    +M  + F+I+++TIQ+E+     A C Q
Sbjct:   64 GVDKNARKKLLVASILCLIFMIGEIVGGAMASSLAIMTDAAHLLTDFASFMISLFAIYLASRPATKRMSFGWHRAEVVGALVSVLMIWVVTGILVYLAVMRVVSMEFKIEGGIMLITSIAGIIINLIMAATLHQHGHT-------------------------------HGSSKSNNETDKEH-----------------GHSHGKSEK----ENINVRAAFIHVIGDLVQSIGVFIAALVIYLKPKYKIADPICTFIFSILVLITTINILRDTMVVLMEGTPKDLDFNEVKAAFYDLPGVIEVHNLRMWSLTISKTALSVHIAIDPDQETHTILRDASNMLRQRFQIADVTIQLENYVSEMAECQQ 378          
BLAST of slc30a-10 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 294.278 bits (752), Expect = 6.929e-96
Identity = 176/398 (44.22%), Postives = 251/398 (63.07%), Query Frame = 1
Query:   79 DVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQ------DVEHCQ---DSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            ++ ++N EL      RD +    C   S  +  +DR A+ KL+IA  LC++F + EI+GG +ANSLAI+TD+AHL SD +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVLLIW+VTG+L+Y A+LRI+N +Y I A IMLI S VGV++N+++A  LH  S                                  +   H H++      DVE+ Q             SD+      S + + K+  NIN+RAAFIHVIGD++QSFGVL AAF+IY+KP WKIADPICTF+FS LV+ TTI I RD + VL+E  P+ ++++ V   +  + G+V +HNLR+WS+T  KTALS HL VD +++ Q IL++   + + +F IS+ TIQ+E+
Sbjct:   18 NIEIANSELAH----RDNIETDHCHSDSE-TDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHS---------------------------------HSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKT--NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLEN 375          
BLAST of slc30a-10 vs. Planmine SMEST
Match: SMESG000022672.1 (SMESG000022672.1)

HSP 1 Score: 293.123 bits (749), Expect = 2.552e-95
Identity = 176/394 (44.67%), Postives = 250/394 (63.45%), Query Frame = 1
Query:   94 NEELDSLPLL-RDVVIRRECKFKSPLSKNMDRQAKTKLIIAVVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQ------DVEHCQ---DSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIES 1245
            N+E+ +  L  RD +    C   S  +  +DR A+ KL+IA  LC++F + EI+GG +ANSLAI+TD+AHL SD +SF+ISL A+ L++R +TK M+FGWHRAE++GAL SVLLIW+VTG+L+Y A+LRI+N +Y I A IMLI S VGV++N+++A  LH  S                                  +   H H++      DVE+ Q             SD+      S + + K+  NIN+RAAFIHVIGD++QSFGVL AAF+IY+KP WKIADPICTF+FS LV+ TTI I RD + VL+E  P+ ++++ V   +  + G+V +HNLR+WS+T  KTALS HL VD +++ Q IL++   + + +F IS+ TIQ+E+
Sbjct:   32 NQEIANSELAHRDNIETDHCHSDSE-TDGIDRVARRKLLIASGLCLIFMIAEIVGGTLANSLAIMTDAAHLLSDFASFMISLFALFLASRPATKRMSFGWHRAEVMGALVSVLLIWVVTGILVYMAVLRIMNKDYNIEATIMLITSGVGVLVNLIMACSLHQHS---------------------------------HSHETHPHNEPLSEEYDVENAQYSDSDALLDDDKKSDLVEVRIKSNNPIRKT--NINVRAAFIHVIGDLVQSFGVLIAAFVIYYKPSWKIADPICTFIFSILVLCTTINILRDTMNVLMEGTPKSLDFDDVKETLLELEGVVLLHNLRIWSLTTNKTALSVHLAVDPNKEVQVILKEATRVLMSKFHISDATIQLEN 389          
BLAST of slc30a-10 vs. Planmine SMEST
Match: SMESG000075723.1 (SMESG000075723.1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.769e-21
Identity = 76/353 (21.53%), Postives = 163/353 (46.18%), Query Frame = 1
Query:  214 VVLCILFFMGEIIGGIIANSLAILTDSAHXXXXXXXXXXXXGAMCLSARQSTKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIMLIMSAVGVIINVLLALVLHPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSIDNINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQ---------WKI-ADPICTFLFSFLVMLTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITLTKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIE 1242
            +VL +L+F+ E+I G + NS+ ++ DS H+ SD  + +I + A  +     +    FGW RAE++G+L + +++  +T  ++  +I R I    +   +I+  +   G+++N++  ++L                     +                          V +  D D  ++  +++   GE+   S+  K   ++N+RA ++HV+ D+  S  V+ +A +++  P          WK+  DP+ + L   L++++T+ + +    +LL+  P+ ++  ++  R+ +I GI ++H+L +W +       + H  +  S ++     K       EF+I   TIQ E
Sbjct:    2 IVLVLLYFLVELIVGHMLNSITLIADSFHMLSDFIALIIGIAARRIGKWPKSSKNTFGWQRAEVVGSLVNTVMLTTLTFTILIKSIQRFIQPEEIEKPHIIFYVGLGGLLVNIIGLIILRNHHGHSHGPETAILLKEEEEELVDDDIP----------------ESPVPNLVDGDVKIVIKDNE---GENHGHSQK-KGASHMNMRAVYLHVLADLFGSIAVVISAIVLWQVPNFQNPPKTDYWKLMVDPLISVLMVVLILISTVPLLKQSALILLQSVPKDVSIKELKDRMENIEGIEKVHDLHVWLLQSDVIIGTVH--IRCSNENYVTASKKVKKLFHEFRIHCTTIQAE 332          
The following BLAST results are available for this feature:
BLAST of slc30a-10 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC30A31.515e-7736.16solute carrier family 30 member 3 [Source:HGNC Sym... [more]
SLC30A23.339e-7737.40solute carrier family 30 member 2 [Source:HGNC Sym... [more]
SLC30A81.916e-6035.54solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A81.916e-6035.54solute carrier family 30 member 8 [Source:HGNC Sym... [more]
SLC30A81.916e-6035.54solute carrier family 30 member 8 [Source:HGNC Sym... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdf-23.063e-4850.64Cation Diffusion Facilitator family [Source:UniPr... [more]
ttm-11.216e-3541.45Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-14.186e-3541.45Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
ttm-15.919e-3541.45Toxin-regulated Targets of MAPK [Source:UniProtKB... [more]
cdf-17.683e-1026.40Cation diffusion facilitator family protein 1 [So... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZnT33D1.662e-7540.58gene:FBgn0051860 transcript:FBtr0302984[more]
ZnT35C1.931e-3638.95gene:FBgn0028516 transcript:FBtr0080715[more]
ZnT35C4.329e-3638.95gene:FBgn0028516 transcript:FBtr0080714[more]
ZnT41F3.692e-2733.68gene:FBgn0025693 transcript:FBtr0086054[more]
ZnT41F3.692e-2733.68gene:FBgn0025693 transcript:FBtr0086056[more]
back to top
BLAST of slc30a-10 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a88.022e-8739.90solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
slc30a21.854e-8439.50solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a82.806e-8440.10solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
slc30a24.049e-8439.50solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a23.643e-7738.67solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000033890.12.213e-8739.79solute carrier family 30 (zinc transporter), membe... [more]
slc30a21.394e-8439.56solute carrier family 30 member 2 [Source:NCBI gen... [more]
slc30a21.901e-8439.56solute carrier family 30 member 2 [Source:NCBI gen... [more]
nbr12.821e-7739.72neighbor of BRCA1 gene 1 [Source:Xenbase;Acc:XB-GE... [more]
gmip1.094e-2837.74GEM interacting protein [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc30a26.801e-8240.61solute carrier family 30 (zinc transporter), membe... [more]
Slc30a25.671e-7740.87solute carrier family 30 (zinc transporter), membe... [more]
Slc30a25.671e-7740.87solute carrier family 30 (zinc transporter), membe... [more]
Slc30a31.815e-7437.40solute carrier family 30 (zinc transporter), membe... [more]
Slc30a35.183e-7437.40solute carrier family 30 (zinc transporter), membe... [more]
back to top
BLAST of slc30a-10 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ10|ZNT2_MOUSE4.757e-8140.61Zinc transporter 2 OS=Mus musculus OX=10090 GN=Slc... [more]
sp|Q5I020|ZNT8_XENLA1.753e-7840.28Zinc transporter 8 OS=Xenopus laevis OX=8355 GN=sl... [more]
sp|Q5R617|ZNT3_PONAB7.123e-7736.16Zinc transporter 3 OS=Pongo abelii OX=9601 GN=SLC3... [more]
sp|Q99726|ZNT3_HUMAN7.278e-7736.16Zinc transporter 3 OS=Homo sapiens OX=9606 GN=SLC3... [more]
sp|Q5XHB4|ZNT8_XENTR7.852e-7739.72Zinc transporter 8 OS=Xenopus tropicalis OX=8364 G... [more]
back to top
BLAST of slc30a-10 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF850.000e+0100.00Slc30a-10 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A5K4EWQ41.095e-9742.36Cation efflux protein/ zinc transporter,putative O... [more]
A0A0H3YKE43.066e-9542.51Slc30a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A183JW984.648e-9443.12Uncharacterized protein OS=Schistosoma curassoni O... [more]
V4AF441.207e-9345.63Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a88.373e-8438.34solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
slc30a22.265e-8238.71zinc transporter 2 [Source:NCBI gene;Acc:103036936... [more]
SLC30A23.682e-3943.14zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
SLC30A24.574e-3943.14zinc transporter 2-like [Source:NCBI gene;Acc:1030... [more]
slc30a84.972e-3740.69solute carrier family 30 member 8 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a23.348e-7538.44solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a23.099e-2949.59solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a21.315e-2535.19solute carrier family 30 member 2 [Source:ZFIN;Acc... [more]
slc30a103.607e-1823.37solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
slc30a101.287e-1522.52solute carrier family 30 member 10 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
COT11.934e-2124.16Vacuolar transporter that mediates zinc transport ... [more]
ZRC11.745e-1325.28Vacuolar membrane zinc transporter; transports zin... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO305541.019e-8138.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488571.765e-5131.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436122.359e-4549.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346174.314e-924.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc30a-10 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc30a22.279e-8138.48solute carrier family 30 member 3 [Source:NCBI gen... [more]
slc30a84.462e-4243.87solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a84.462e-4243.87solute carrier family 30 member 8 [Source:NCBI gen... [more]
slc30a44.873e-2937.93solute carrier family 30 member 4 [Source:NCBI gen... [more]
slc30a51.094e-1319.89solute carrier family 30 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc30a-10 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002070.10.000e+099.75SMESG000002070.1[more]
SMESG000013136.18.526e-9942.51SMESG000013136.1[more]
SMESG000022672.16.929e-9644.22SMESG000022672.1[more]
SMESG000022672.12.552e-9544.67SMESG000022672.1[more]
SMESG000075723.19.769e-2121.53SMESG000075723.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005852
GenBankAKN21630.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005852 ID=SMED30005852|Name=slc30a-10|organism=Schmidtea mediterranea sexual|type=transcript|length=1338bp
CAATTTGTAGTATATAGATGTGCATTTTAATAATTAAAATTAATTATTAT
CAATAATCTGTATGCTATGATTATTAATGATGTAAACTTGTCTAATGAAG
AGCTCGACAGTCTTCCATTATTAAGAGATGTCGTTATAAGAAGAGAATGC
AAATTCAAGTCCCCATTATCCAAGAATATGGACCGACAAGCCAAAACCAA
ATTGATTATTGCGGTTGTTTTGTGCATTTTGTTTTTCATGGGTGAAATAA
TCGGGGGTATAATTGCTAATAGTCTGGCCATTTTGACAGATTCAGCCCAT
CTTTTCAGTGACCTGAGCAGTTTCCTTATCAGTCTTGGAGCAATGTGCCT
TTCTGCTCGTCAATCTACCAAATCTATGAATTTCGGTTGGCATCGAGCAG
AAATAATAGGAGCTTTATTCTCAGTGTTGTTGATCTGGATCGTTACGGGG
GTACTCATATATGCCGCCATTTTACGCATAATAAATTCTAATTATGTTAT
AAATGCCAATATCATGCTCATTATGTCAGCAGTCGGTGTTATAATAAATG
TTCTCTTGGCGTTGGTTCTTCATCCGCAATCTCATGGTCATAGCCATGGT
GGTGGTGGACACGGTCATAGTCATGGACATGGTCAAAGCAATGGTGGTGG
TGGACATGGCCATGGTCATGGACATGGGCATAGAGCCAGTGTCAACCATA
ATCACAGTCAAGACGTAGAGCACTGCCAAGATTCCGATGAACCTTTGTTG
ACCACGAATTCTGACGTATGTGCTGGCGAAGATTCGTCGAAATCTAAAGT
ATTCAAATCAATTGATAACATTAATCTAAGAGCTGCTTTTATTCATGTTA
TCGGCGATATCATTCAAAGTTTTGGTGTTTTAGCCGCTGCTTTTATTATC
TATTTCAAGCCCCAATGGAAAATTGCAGATCCAATTTGTACATTTCTCTT
TTCATTCCTTGTAATGCTCACAACTATTTTTATATTTCGCGATGTCATTT
ATGTGCTCCTCGAAAGGAAGCCTCGACATATCAATTATAACAAAGTAACA
ATCCGGATTTCTTCCATACCGGGAATCGTGCAGATTCACAATCTCCGCCT
GTGGAGTATAACGTTGACAAAAACGGCTTTATCATGCCATCTGGTGGTTG
ATGCCTCTCAAGATTCCCAAAGCATTTTAGAAAAAGTCTACGATATGTGC
ATTGAAGAGTTCAAAATTTCAGAAATCACGATCCAGATCGAGTCTTCAGC
AAAGCCGTCCGCTCTCTGTGATCAATCTGATTAATTCTATTATTTTCTGA
TTGAAATATATTATTTTTTGATTTGAAAAAAAAAGATC
back to top

protein sequence of SMED30005852-orf-1

>SMED30005852-orf-1 ID=SMED30005852-orf-1|Name=SMED30005852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MIINDVNLSNEELDSLPLLRDVVIRRECKFKSPLSKNMDRQAKTKLIIAV
VLCILFFMGEIIGGIIANSLAILTDSAHLFSDLSSFLISLGAMCLSARQS
TKSMNFGWHRAEIIGALFSVLLIWIVTGVLIYAAILRIINSNYVINANIM
LIMSAVGVIINVLLALVLHPQSHGHSHGGGGHGHSHGHGQSNGGGGHGHG
HGHGHRASVNHNHSQDVEHCQDSDEPLLTTNSDVCAGEDSSKSKVFKSID
NINLRAAFIHVIGDIIQSFGVLAAAFIIYFKPQWKIADPICTFLFSFLVM
LTTIFIFRDVIYVLLERKPRHINYNKVTIRISSIPGIVQIHNLRLWSITL
TKTALSCHLVVDASQDSQSILEKVYDMCIEEFKISEITIQIESSAKPSAL
CDQSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036837Cation_efflux_CTD_sf
IPR002524Cation_efflux
IPR027470Cation_efflux_CTD
IPR027469Cation_efflux_TMD_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0008324cation transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002524Cation efflux proteinTIGRFAMTIGR01297TIGR01297coord: 43..394
e-value: 4.1E-81
score: 270.3
IPR002524Cation efflux proteinPFAMPF01545Cation_effluxcoord: 46..315
e-value: 2.9E-46
score: 157.7
IPR027469Cation efflux transmembrane domain superfamilyGENE3DG3DSA:1.20.1510.10coord: 239..315
e-value: 1.8E-8
score: 36.2
coord: 42..177
e-value: 3.4E-20
score: 74.5
IPR027469Cation efflux transmembrane domain superfamilySUPERFAMILYSSF161111Cation efflux protein transmembrane domain-likecoord: 40..316
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..206
NoneNo IPR availablePANTHERPTHR11562CATION EFFLUX PROTEIN/ ZINC TRANSPORTERcoord: 22..191
NoneNo IPR availablePANTHERPTHR11562:SF84LD05335Pcoord: 195..403
NoneNo IPR availablePANTHERPTHR11562:SF84LD05335Pcoord: 22..191
NoneNo IPR availablePANTHERPTHR11562CATION EFFLUX PROTEIN/ ZINC TRANSPORTERcoord: 195..403
NoneNo IPR availableTMHMMTMhelixcoord: 149..168
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 78..97
NoneNo IPR availableTMHMMTMhelixcoord: 293..315
NoneNo IPR availableTMHMMTMhelixcoord: 46..68
NoneNo IPR availableTMHMMTMhelixcoord: 117..139
IPR036837Cation efflux protein, cytoplasmic domain superfamilySUPERFAMILYSSF160240Cation efflux protein cytoplasmic domain-likecoord: 323..392