P2X purinoceptor 4

Overview
NameP2X purinoceptor 4
Smed IDSMED30005825
Length (bp)1511
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of P2X purinoceptor 4 (SMED30005825) t-SNE clustered cells

Violin plots show distribution of expression levels for P2X purinoceptor 4 (SMED30005825) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of P2X purinoceptor 4 (SMED30005825) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for P2X purinoceptor 4 (SMED30005825) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005825

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005825SMESG000046729.1 dd_Smed_v4_7865_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005825SMESG000046729.1 dd_Smed_v6_7865_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 283.493 bits (724), Expect = 1.332e-90
Identity = 147/368 (39.95%), Postives = 222/368 (60.33%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDA--LCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            C+     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  KVKG+ V++   +  +IWD+ D V+P QE N++F+ TN I T NQ+QG CPE   + DA  +C+  + C  G      NGV TGRCV +F G+ KTCE+ AWCP+E+DT +  + A LK   +FT+L++N I +   N  + N+         K CIY+A  +   +CPIF++  ++ N   S   +M   GG++ + + W+CNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +NIGSGLALL +A  +CDI+++ C  K+
Sbjct:    5 CAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCV-AFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKR 364          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 273.478 bits (698), Expect = 1.598e-86
Identity = 147/384 (38.28%), Postives = 222/384 (57.81%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVI----------------LYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDA--LCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            C+     +F Y+T ++ +I  + +G + R  Q+LIL YVI                 +  V+++GYQ+   + SSV  KVKG+ V++   +  +IWD+ D V+P QE N++F+ TN I T NQ+QG CPE   + DA  +C+  + C  G      NGV TGRCV +F G+ KTCE+ AWCP+E+DT +  + A LK   +FT+L++N I +   N  + N+         K CIY+A  +   +CPIF++  ++ N   S   +M   GG++ + + W+CNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +NIGSGLALL +A  +CDI+++ C  K+
Sbjct:    5 CAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGCYHPHLAEVEMESPRRWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCV-AFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKR 380          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 258.07 bits (658), Expect = 1.445e-80
Identity = 133/365 (36.44%), Postives = 213/365 (58.36%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            R+     + ++ YET KV ++ ++ +G + R  Q+LIL+Y + Y  + ++ YQ+   G  SS++ KVKGI  S+ K     +WD+ + V PP+  +   I T    T +Q+QGTCPE   V +A C   +DC  G+   LGNG+ TGRCV  ++G +KTCE+  WCP+E+   +     L    P+FT+LI+N+I +   +  + N+   T G + K+C ++ + +L  YCPIFK+  ++    +S   E+   GGVI VII W+C+LD  A  C P YSF RL       S G+NFR+A Y++++    R L K +G+RI + V G+AGKFSL+   +N+ + L  + +  F+CD +++   +K
Sbjct:   16 RLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHK-----VWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASV--SQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLGFIVEKAGES-FTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNK 369          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX2 (purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:HGNC:15459])

HSP 1 Score: 257.684 bits (657), Expect = 1.185e-79
Identity = 133/365 (36.44%), Postives = 213/365 (58.36%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            R+     + ++ YET KV ++ ++ +G + R  Q+LIL+Y + Y  + ++ YQ+   G  SS++ KVKGI  S+ K     +WD+ + V PP+  +   I T    T +Q+QGTCPE   V +A C   +DC  G+   LGNG+ TGRCV  ++G +KTCE+  WCP+E+   +     L    P+FT+LI+N+I +   +  + N+   T G + K+C ++ + +L  YCPIFK+  ++    +S   E+   GGVI VII W+C+LD  A  C P YSF RL       S G+NFR+A Y++++    R L K +G+RI + V G+AGKFSL+   +N+ + L  + +  F+CD +++   +K
Sbjct:   16 RLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHK-----VWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASV--SQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLGFIVEKAGES-FTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNK 369          
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Match: P2RX4 (purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:HGNC:8535])

HSP 1 Score: 251.136 bits (640), Expect = 8.742e-79
Identity = 132/337 (39.17%), Postives = 200/337 (59.35%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDA--LCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLV 1221
            C+     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  KVKG+ V++   +  +IWD+ D V+P QE N++F+ TN I T NQ+QG CPE   + DA  +C+  + C  G      NGV TGRCV +F G+ KTCE+ AWCP+E+DT +  + A LK   +FT+L++N I +   N  + N+         K CIY+A  +   +CPIF++  ++ N   S   +M   GG++ + + W+CNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++
Sbjct:    5 CAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCV-AFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDII 333          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4b (purinergic receptor P2X, ligand-gated ion channel, 4b [Source:ZFIN;Acc:ZDB-GENE-030319-4])

HSP 1 Score: 261.536 bits (667), Expect = 3.122e-82
Identity = 144/368 (39.13%), Postives = 215/368 (58.42%), Query Frame = 1
Query:  226 CSKAVNH-IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            CS    H +F + T  + ++  K +GFI R  Q+ I+VYV +Y   YKR YQ+   + SSV  KVKG  +++   +   +WD  + V+PPQ  N+ F+ TNAI T  Q+QG+CPE  + E   CQ  SDCK+G     GNGV TG+CV+ +  T KTCE+ +WCP+ENDT+I  K ALL    DFTVLI+N I +     ++ N+         K C +N   +   +CP+F++  ++   S  + + M   GG+I + I W+C+LD++   C P YSF RL     +   + G+NFRYA Y+   ++ E R L K FG+R  + V G AGKF++V   +N+G+ LALL++   +CD  ++NC S  +
Sbjct:    3 CSAYCFHCLFDHGTPVILVVSSKKVGFIFRLLQLCIIVYVAVYVCWYKRAYQERDSVISSVSTKVKGNILTNSSALGTHVWDTSEYVIPPQGENSFFVLTNAIVTQGQTQGSCPEIPS-EFTNCQSDSDCKEGLKEIRGNGVQTGKCVQ-YSETIKTCEVLSWCPLENDTVI-PKPALLSAAEDFTVLIKNNIQYPKFKFRKRNILRHINSTYLKNCTFNHKTD--PHCPVFRLGDIVTE-SGEDFSIMALKGGIIGIFIDWSCDLDFNERFCVPKYSFRRLDNKNPENNVAPGYNFRYAKYYMNNENTETRTLIKAFGIRFDVIVFGMAGKFNIVPTIVNVGAALALLNLMKVICDWFMLNCLSDSE 364          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.825 bits (634), Expect = 2.324e-77
Identity = 135/366 (36.89%), Postives = 207/366 (56.56%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYFE-VDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            C       F Y T+K+ II  K +G + RF Q L++ YVI Y  VY +GYQD   + SSV  KVKGI +++  ++  +IWD+ D ++PPQE  + F+ TN I T NQ+Q  C E+ T   + C    DCK+G     G+GV TGRCV S+  + KTCE+ +WCP+E   +      LL +  +FTVLI+N I +   N  + N+           C+++   +    CPIF++  ++G  ++ +   M   GGV+ V I W+C+LD     C P Y+F RL     D   + G+NFR+A Y++  D  E R L K +G+R  + V G+AGKF+++   +N+G+GLALL +   +CD +++    +K
Sbjct:    8 CDSVSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQEDGSFFVLTNMIITTNQTQSKCAENPTPA-STCTSHRDCKRGFNDARGDGVRTGRCV-SYSASVKTCEVLSWCPLEK-IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTD--PDCPIFRLGDIVGE-AEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNMGAGLALLGLVNVICDWIVLTFMKRK 367          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 242.276 bits (617), Expect = 9.029e-75
Identity = 136/375 (36.27%), Postives = 207/375 (55.20%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQ---------EMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYFE-VDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            C       F Y T+K+ II  K +G + RF Q L++ YVI Y  VY +GYQD   + SSV  KVKGI +++  ++  +IWD+ D ++PPQ         E  + F+ TN I T NQ+Q  C E+ T   + C    DCK+G     G+GV TGRCV S+  + KTCE+ +WCP+E   +      LL +  +FTVLI+N I +   N  + N+           C+++   +    CPIF++  ++G  ++ +   M   GGV+ V I W+C+LD     C P Y+F RL     D   + G+NFR+A Y++  D  E R L K +G+R  + V G+AGKF+++   +NIG+GLALL +   +CD +++    +K
Sbjct:    8 CDSVSQCFFDYYTSKILIIRSKKVGTLNRFTQALVIAYVIGYVCVYNKGYQDTDTVLSSVTTKVKGIALTNTSELGERIWDVADYIIPPQVVRRLDEEEEDGSFFVLTNMIITTNQTQSKCAENPTPA-STCTSHRDCKRGFNDARGDGVRTGRCV-SYSASVKTCEVLSWCPLEK-IVDPPNPPLLADAENFTVLIKNNIRYPKFNFNKRNILPNINSSYLTHCVFSRKTD--PDCPIFRLGDIVGE-AEEDFQIMAVHGGVMGVQIRWDCDLDMPQSWCVPRYTFRRLDNKDPDNNVAPGYNFRFAKYYKNSDGTETRTLIKGYGIRFDVMVFGQAGKFNIIPTLLNIGAGLALLGLVNVICDWIVLTFMKRK 376          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 243.817 bits (621), Expect = 1.984e-74
Identity = 129/360 (35.83%), Postives = 203/360 (56.39%), Query Frame = 1
Query:  247 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDG---TFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            +  Y+T K  I  +K +G + R FQ+ ++ Y+I +  ++K+GYQ+    + SSV+ K+KG+ +++      ++W   D V+PPQ     F+ TN + T NQ  G CPE   V D  C   ++C +G+ +  G+GV TGRC+        TCEI AWCP+E+     +   +L +  +FTV ++N I F      +SN+   T     K C Y+       YCPIF V  +I N +     ++ T GG I + I WNC+LD    +C P YSF+RL  ++    + + G+NFR+A Y+ +     +R L+KV+G+R  I V GKAG+FS++   +NIGSGLAL+   +F CD++++   SK
Sbjct:   12 LLDYKTEKFVIAKNKKVGVLFRLFQLTVIGYLIGWVFIWKKGYQETEEAIQSSVITKLKGVDLTNSSQFGLQLWGAEDYVIPPQGDRVFFVVTNYLVTPNQRLGYCPESPKVPDGFCTNDNECVEGESVLAGHGVKTGRCLND----TGTCEINAWCPVEHGHAPVE--PMLAKAENFTVYVKNFIKFPKFGFFKSNVLPITNSTYLKTCRYDKDHH--PYCPIFLVGDVI-NWTGYTFQDLATRGGSIGIGIEWNCDLDKDESHCNPEYSFTRLDSSENSQHSVTSGYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSK 362          
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Match: p2rx5 (purinergic receptor P2X, ligand-gated ion channel, 5 [Source:ZFIN;Acc:ZDB-GENE-030319-5])

HSP 1 Score: 243.817 bits (621), Expect = 1.984e-74
Identity = 129/360 (35.83%), Postives = 203/360 (56.39%), Query Frame = 1
Query:  247 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDG---TFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            +  Y+T K  I  +K +G + R FQ+ ++ Y+I +  ++K+GYQ+    + SSV+ K+KG+ +++      ++W   D V+PPQ     F+ TN + T NQ  G CPE   V D  C   ++C +G+ +  G+GV TGRC+        TCEI AWCP+E+     +   +L +  +FTV ++N I F      +SN+   T     K C Y+       YCPIF V  +I N +     ++ T GG I + I WNC+LD    +C P YSF+RL  ++    + + G+NFR+A Y+ +     +R L+KV+G+R  I V GKAG+FS++   +NIGSGLAL+   +F CD++++   SK
Sbjct:   12 LLDYKTEKFVIAKNKKVGVLFRLFQLTVIGYLIGWVFIWKKGYQETEEAIQSSVITKLKGVDLTNSSQFGLQLWGAEDYVIPPQGDRVFFVVTNYLVTPNQRLGYCPESPKVPDGFCTNDNECVEGESVLAGHGVKTGRCLND----TGTCEINAWCPVEHGHAPVE--PMLAKAENFTVYVKNFIKFPKFGFFKSNVLPITNSTYLKTCRYDKDHH--PYCPIFLVGDVI-NWTGYTFQDLATRGGSIGIGIEWNCDLDKDESHCNPEYSFTRLDSSENSQHSVTSGYNFRFARYYNDAAGQTYRNLFKVYGIRFDILVNGKAGRFSIIPTVINIGSGLALMGAGVFACDMILLYMMSK 362          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 275.018 bits (702), Expect = 4.181e-87
Identity = 146/361 (40.44%), Postives = 214/361 (59.28%), Query Frame = 1
Query:  250 FRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFR-GTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            F Y+T K  I  +K +G + R  Q+ IL Y++ +  V K+GYQ+    + SS++ K+KG+  ++  ++  ++WD+ D V+PPQ  N  F+ TN I T NQ Q TCPE   + DA C K SDC +G+P+  GNGV TGRC+K+       TCEI AWCPIE       K+ LL +  +FTV I+N+I F   +  ++N+     G   K C Y+  D    YCPIF +  ++ + + SE   M   GGVI + I WNCNLD  A  C P+YSF+RL     + + S G+NFR+A Y+ + +  ++R L K +G+R  I V GKAGKF+++   +NIGSGLALL    F CD++++    K +
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKP--KTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSN 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 274.248 bits (700), Expect = 4.698e-87
Identity = 146/362 (40.33%), Postives = 214/362 (59.12%), Query Frame = 1
Query:  247 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFR-GTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
             F Y+T K  I  +K +G + R  Q+ IL Y++ +  V K+GYQ+    + SS++ K+KG+  ++  ++  ++WD+ D V+PPQ  N  F+ TN I T NQ Q TCPE   + DA C K SDC +G+P+  GNGV TGRC+K+       TCEI AWCPIE       K+ LL +  +FTV I+N+I F   +  ++N+     G   K C Y+  D    YCPIF +  ++ + + SE   M   GGVI + I WNCNLD  A  C P+YSF+RL     + + S G+NFR+A Y+ + +  ++R L K +G+R  I V GKAGKF+++   +NIGSGLALL    F CD++++    K +
Sbjct:   13 FFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKP--KTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSN 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 273.863 bits (699), Expect = 6.290e-87
Identity = 146/361 (40.44%), Postives = 214/361 (59.28%), Query Frame = 1
Query:  250 FRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFR-GTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            F Y+T K  I  +K +G + R  Q+ IL Y++ +  V K+GYQ+    + SS++ K+KG+  ++  ++  ++WD+ D V+PPQ  N  F+ TN I T NQ Q TCPE   + DA C K SDC +G+P+  GNGV TGRC+K+       TCEI AWCPIE       K+ LL +  +FTV I+N+I F   +  ++N+     G   K C Y+  D    YCPIF +  ++ + + SE   M   GGVI + I WNCNLD  A  C P+YSF+RL     + + S G+NFR+A Y+ + +  ++R L K +G+R  I V GKAGKF+++   +NIGSGLALL    F CD++++    K +
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKP--KTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSN 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 274.633 bits (701), Expect = 1.024e-86
Identity = 146/361 (40.44%), Postives = 214/361 (59.28%), Query Frame = 1
Query:  250 FRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFR-GTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            F Y+T K  I  +K +G + R  Q+ IL Y++ +  V K+GYQ+    + SS++ K+KG+  ++  ++  ++WD+ D V+PPQ  N  F+ TN I T NQ Q TCPE   + DA C K SDC +G+P+  GNGV TGRC+K+       TCEI AWCPIE       K+ LL +  +FTV I+N+I F   +  ++N+     G   K C Y+  D    YCPIF +  ++ + + SE   M   GGVI + I WNCNLD  A  C P+YSF+RL     + + S G+NFR+A Y+ + +  ++R L K +G+R  I V GKAGKF+++   +NIGSGLALL    F CD++++    K +
Sbjct:   14 FDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKK--PKTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSN 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Match: p2rx5 (purinergic receptor P2X, ligand gated ion channel, 5 [Source:NCBI gene;Acc:100485445])

HSP 1 Score: 274.248 bits (700), Expect = 1.059e-86
Identity = 146/362 (40.33%), Postives = 214/362 (59.12%), Query Frame = 1
Query:  247 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFR-GTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
             F Y+T K  I  +K +G + R  Q+ IL Y++ +  V K+GYQ+    + SS++ K+KG+  ++  ++  ++WD+ D V+PPQ  N  F+ TN I T NQ Q TCPE   + DA C K SDC +G+P+  GNGV TGRC+K+       TCEI AWCPIE       K+ LL +  +FTV I+N+I F   +  ++N+     G   K C Y+  D    YCPIF +  ++ + + SE   M   GGVI + I WNCNLD  A  C P+YSF+RL     + + S G+NFR+A Y+ + +  ++R L K +G+R  I V GKAGKF+++   +NIGSGLALL    F CD++++    K +
Sbjct:   13 FFDYKTEKYVIAKNKKVGILFRVVQLSILAYLVGWVFVVKKGYQETDTSIQSSIITKLKGVAFTNTSELGERLWDVVDYVIPPQGENVFFVVTNLIVTPNQRQSTCPESFGIPDAECSKNSDCPEGEPVVAGNGVKTGRCLKTGAVNATGTCEIFAWCPIEKKKKP--KTPLLGKAENFTVYIKNSIRFPKFDFSKTNILETDNGSYLKTCRYSKDDH---YCPIFHLGKIV-SWAGSEFQSMAIEGGVIGIQIEWNCNLDKLASECHPHYSFTRLDNKFTEKSVSSGYNFRFAKYYRDANGNDYRTLIKAYGIRFDIMVNGKAGKFNIIPTIINIGSGLALLGAGAFFCDLVLLYLIKKSN 368          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 277.33 bits (708), Expect = 2.122e-88
Identity = 146/365 (40.00%), Postives = 217/365 (59.45%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--DTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCF 1305
            CS     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  K KG+ V++   +  +IWD+ D VVP QE N++FI TN I T NQ+QGTCPE  D T   ++C   ++C  G      +G+ TGRCV  F  + KTCE+ AWCP+END  +    A LK   +FT+L++N I +   N  + N+         K CIYNA  +   +CPIF++  ++ +   S   EM   GG++ + I W+CNLD +A +C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +N+GSGLALL +A  +CD++++ C 
Sbjct:    5 CSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKT---SICDSDANCTLGSSDTHSSGIGTGRCVP-FNASVKTCEVAAWCPVENDAGV-PTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx4 (purinergic receptor P2X, ligand-gated ion channel 4 [Source:MGI Symbol;Acc:MGI:1338859])

HSP 1 Score: 253.062 bits (645), Expect = 2.373e-79
Identity = 142/365 (38.90%), Postives = 207/365 (56.71%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--DTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCF 1305
            CS     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  K KG+ V++   +  +IWD+ D VVP QE N++FI TN I T NQ+QGTCPE  D T   ++C   ++C  G      +G+ TGRCV  F  + KTCE+ AWCP+END            VP   +L          N+  S L         K CIYNA  +   +CPIF++  ++ +   S   EM   GG++ + I W+CNLD +A +C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +N+GSGLALL +A  +CD++++ C 
Sbjct:    5 CSVLRAFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKT---SICDSDANCTLGSSDTHSSGIGTGRCVP-FNASVKTCEVAAWCPVENDA----------GVPTRNIL---------PNITTSYL---------KSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 334          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx1 (purinergic receptor P2X, ligand-gated ion channel, 1 [Source:MGI Symbol;Acc:MGI:1098235])

HSP 1 Score: 249.21 bits (635), Expect = 2.181e-77
Identity = 134/350 (38.29%), Postives = 194/350 (55.43%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIA 1269
            R+  +     F Y+T ++ ++ +K +G I R  Q+++LVYVI +  VY++GYQ   GL SSV VK+KG+ V+  + +  ++WD+ D V P    ++  + TN I T  Q+QG C E+   E  +CQ  S C  GK      G+ TG CV  F GT KTCEI  WCP+E D  I    ALL E  +FT+ I+N+I F    V R NL     G   KKC+Y+    L   CP+F +  ++   S  +   +   GGV+ + I W C+LD+   +C P Y F  LY  +   S G+NFR+A +F  +    R L+KVFG+R  I V GKAGKF ++     IGSG+ +  +A
Sbjct:    4 RLQDELSAFFFEYDTPRMVLVRNKKVGVIFRLIQLVVLVYVIGWVFVYEKGYQTSSGLISSVSVKLKGLAVTQLQGLGPQVWDVADYVFPAHGDSSFVVMTNFIMTPQQAQGHCAENP--EGGICQDDSGCTPGKAERKAQGIRTGNCV-PFNGTVKTCEIFGWCPVEVDDKI-PSPALLHEAENFTLFIKNSISFPRFKVNRRNLVEEVNGTYMKKCLYHKI--LHPLCPVFSLGYVVRE-SGQDFRSLAEKGGVVGITIDWECDLDWHVRHCKPIYQFHGLY-GEKNLSPGFNFRFARHFVQNGTNRRHLFKVFGIRFDILVDGKAGKFDIIPTMTTIGSGIGIFGVA 345          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 248.825 bits (634), Expect = 2.737e-77
Identity = 132/366 (36.07%), Postives = 208/366 (56.83%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDH-VEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            R+     +  + YET KV ++ ++ +GF+ R  Q+LIL+Y + Y  + ++ YQD   G  SS++ KVKGI +S+ K     +WD+ + V PP+  + + I T    T +Q+ GTCPE   V  + C    DC  G+    GNG+ TGRCV  + G +KTCE+ AWCP+E+ T   +   L K  P+FT+LI+N+I +      + N+ S     + K C ++   +   YCPIF++  ++    ++   E+   GGVI VII WNC+LD S   C P YSF RL       S G+NFR+A Y++++     R L K +G+RI + V G+AGKFSL+   +N+ + L  + +  F+CD +++   +K
Sbjct:   17 RLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSETGPESSIITKVKGITMSEHK-----VWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTS--ENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLGFIVEQAGEN-FTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNK 371          
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Match: P2rx2 (purinergic receptor P2X, ligand-gated ion channel, 2 [Source:MGI Symbol;Acc:MGI:2665170])

HSP 1 Score: 249.21 bits (635), Expect = 3.723e-77
Identity = 132/366 (36.07%), Postives = 208/366 (56.83%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDH-VEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            R+     +  + YET KV ++ ++ +GF+ R  Q+LIL+Y + Y  + ++ YQD   G  SS++ KVKGI +S+ K     +WD+ + V PP+  + + I T    T +Q+ GTCPE   V  + C    DC  G+    GNG+ TGRCV  + G +KTCE+ AWCP+E+ T   +   L K  P+FT+LI+N+I +      + N+ S     + K C ++   +   YCPIF++  ++    ++   E+   GGVI VII WNC+LD S   C P YSF RL       S G+NFR+A Y++++     R L K +G+RI + V G+AGKFSL+   +N+ + L  + +  F+CD +++   +K
Sbjct:   17 RLARGCWSAFWDYETPKVIVVRNRRLGFVHRMVQLLILLYFVWYVFIVQKSYQDSETGPESSIITKVKGITMSEHK-----VWDVEEYVKPPEGGSVVSIITRIEVTPSQTLGTCPESMRVHSSTCHLDDDCVAGQLDMQGNGIRTGRCVPYYHGDSKTCEVSAWCPVEDGTS--ENHFLGKMAPNFTILIKNSIHYPKFKFSKGNIASQKSDYL-KHCTFDQDSD--PYCPIFRLGFIVEQAGEN-FTELAHKGGVIGVIINWNCDLDLSESECNPKYSFRRLDPKYDPASSGYNFRFAKYYKINGTTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSIGVGSFLCDWILLTFMNK 371          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q99571|P2RX4_HUMAN (P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX4 PE=1 SV=2)

HSP 1 Score: 283.493 bits (724), Expect = 6.395e-90
Identity = 147/368 (39.95%), Postives = 222/368 (60.33%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDA--LCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            C+     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  KVKG+ V++   +  +IWD+ D V+P QE N++F+ TN I T NQ+QG CPE   + DA  +C+  + C  G      NGV TGRCV +F G+ KTCE+ AWCP+E+DT +  + A LK   +FT+L++N I +   N  + N+         K CIY+A  +   +CPIF++  ++ N   S   +M   GG++ + + W+CNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +NIGSGLALL +A  +CDI+++ C  K+
Sbjct:    5 CAALAAFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPE---IPDATTVCKSDASCTAGSAGTHSNGVSTGRCV-AFNGSVKTCEVAAWCPVEDDTHV-PQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTD--PFCPIFRLGKIVENAGHS-FQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGMATVLCDIIVLYCMKKR 364          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q5E9U1|P2RX4_BOVIN (P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.550e-88
Identity = 145/363 (39.94%), Postives = 220/363 (60.61%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCF 1305
            C+     +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV VK KG+ +++   +  +IWD+ D V+P QE N++FI TN + T NQ+QG CPE    +  +C+  ++C  G      +GV TGRCV SF GT KTCE+ AWCP+E+DT +  K A LK   +FT+L++N I +   N  + N+         K CIY+A  +   +CPIF++  ++ +   S   ++   GG++ + I WNCNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   EHR L K +G+R  I V GKAGKF ++   +NIGSGLALL +A  +CD++++ C 
Sbjct:    5 CTVLGAFLFEYDTPRIVLIRSRKVGLMNRTVQLLILAYVIGWVFVWEKGYQETDSVVSSVTVKAKGVTMTNTSKLGFRIWDVADYVIPAQEENSVFIMTNMVITMNQTQGLCPE-IPGKTTVCETDANCTAGSAGTHSSGVATGRCV-SFNGTLKTCEVAAWCPVEDDTEV-PKPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTAYLKTCIYDAKTD--PFCPIFRLGKIVESAGHS-FQDIAIEGGIMGIQIKWNCNLDRAASFCLPRYSFRRLDTRDLAHNVSPGYNFRFAKYYSDLKGAEHRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9JJX6|P2RX4_MOUSE (P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 8.678e-88
Identity = 146/365 (40.00%), Postives = 218/365 (59.73%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--DTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCF 1305
            CS   + +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  K KG+ V++   +  +IWD+ D VVP QE N++FI TN I T NQ+QGTCPE  D T   ++C   ++C  G      +G+ TGRCV  F  + KTCE+ AWCP+END  +    A LK   +FT+L++N I +   N  + N+         K CIYNA  +   +CPIF++  ++ +   S   EM   GG++ + I W+CNLD +A +C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +N+GSGLALL +A  +CD++++ C 
Sbjct:    5 CSVLGSFLFEYDTPRIVLIRSRKVGLMNRVVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVVPAQEENSLFIMTNMIVTVNQTQGTCPEIPDKT---SICDSDANCTLGSSDTHSSGIGTGRCVP-FNASVKTCEVAAWCPVENDAGV-PTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNARTD--PFCPIFRLGQIVADAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASHCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGNEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|P51577|P2RX4_RAT (P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2rx4 PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 2.513e-87
Identity = 147/365 (40.27%), Postives = 217/365 (59.45%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPE--DTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCF 1305
            CS   + +F Y+T ++ +I  + +G + R  Q+LIL YVI +  V+++GYQ+   + SSV  K KG+ V++   +  +IWD+ D V+P QE N++FI TN I T NQ+Q TCPE  D T   ++C   +DC  G      +GV TGRCV  F  + KTCE+ AWCP+END  +    A LK   +FT+L++N I +   N  + N+         K CIYNA  +   +CPIF++ T++ +   S   EM   GG++ + I W+CNLD +A  C P YSF RL   D     S G+NFR+A Y+ ++   E R L K +G+R  I V GKAGKF ++   +N+GSGLALL +A  +CD++++ C 
Sbjct:    5 CSVLGSFLFEYDTPRIVLIRSRKVGLMNRAVQLLILAYVIGWVFVWEKGYQETDSVVSSVTTKAKGVAVTNTSQLGFRIWDVADYVIPAQEENSLFIMTNMIVTVNQTQSTCPEIPDKT---SICNSDADCTPGSVDTHSSGVATGRCVP-FNESVKTCEVAAWCPVENDVGV-PTPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTSYLKSCIYNAQTD--PFCPIFRLGTIVEDAGHS-FQEMAVEGGIMGIQIKWDCNLDRAASLCLPRYSFRRLDTRDLEHNVSPGYNFRFAKYYRDLAGKEQRTLTKAYGIRFDIIVFGKAGKFDIIPTMINVGSGLALLGVATVLCDVIVLYCM 361          
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Match: sp|Q9UBL9|P2RX2_HUMAN (P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX2 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 5.689e-79
Identity = 133/365 (36.44%), Postives = 213/365 (58.36%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            R+     + ++ YET KV ++ ++ +G + R  Q+LIL+Y + Y  + ++ YQ+   G  SS++ KVKGI  S+ K     +WD+ + V PP+  +   I T    T +Q+QGTCPE   V +A C   +DC  G+   LGNG+ TGRCV  ++G +KTCE+  WCP+E+   +     L    P+FT+LI+N+I +   +  + N+   T G + K+C ++ + +L  YCPIFK+  ++    +S   E+   GGVI VII W+C+LD  A  C P YSF RL       S G+NFR+A Y++++    R L K +G+RI + V G+AGKFSL+   +N+ + L  + +  F+CD +++   +K
Sbjct:   16 RLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHK-----VWDVEEYVKPPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASV--SQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYL-KRCTFHEASDL--YCPIFKLGFIVEKAGES-FTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCDWILLTFMNK 369          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A267EI98 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g1 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 3.002e-102
Identity = 159/368 (43.21%), Postives = 229/368 (62.23%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSD--RKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKT-CEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            +   +    +FRYET+KV  I    +  I R  Q+LI+ YVI + +VYK+GYQDF  + S V  KVKG+  ++     I  +IWD+ D VVPPQE NA FITTNA+ T +Q+QG C ED +V  A C   +DC  GKP  LGNGV TGRCV S +  NKT CEI AWCP+E D +      +  E  +FTVLI+++I F    V+R N+  +      + C+YN   ++  YCP+F++  ++         ++ T+GGV+ + + W+CNLD+ A  C P Y F RL   +   +KGWNFRYANY+ ++  +HR L K +GLR ++ V G+AG+F+++ L+MN+GSGLALL IA  +CD++++    KK
Sbjct:   12 KTVDRGFGALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLP-AGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKK 374          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A267GN82 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018619g2 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 3.168e-102
Identity = 159/368 (43.21%), Postives = 229/368 (62.23%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSD--RKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKT-CEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            +   +    +FRYET+KV  I    +  I R  Q+LI+ YVI + +VYK+GYQDF  + S V  KVKG+  ++     I  +IWD+ D VVPPQE NA FITTNA+ T +Q+QG C ED +V  A C   +DC  GKP  LGNGV TGRCV S +  NKT CEI AWCP+E D +      +  E  +FTVLI+++I F    V+R N+  +      + C+YN   ++  YCP+F++  ++         ++ T+GGV+ + + W+CNLD+ A  C P Y F RL   +   +KGWNFRYANY+ ++  +HR L K +GLR ++ V G+AG+F+++ L+MN+GSGLALL IA  +CD++++    KK
Sbjct:   12 KTVDRGFGALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLP-AGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIATVGGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKK 374          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A1I8J6R2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.670e-100
Identity = 159/368 (43.21%), Postives = 228/368 (61.96%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSD--RKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKT-CEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            +   +    +FRYET+KV  I    +  I R  Q+LI+ YVI + +VYK+GYQDF  + S V  KVKG+  ++     I  +IWD+ D VVPPQE NA FITTNA+ T +Q+QG C ED +V  A C   +DC  GKP  LGNGV TGRCV S +  NKT CEI AWCP+E D +      +  E  +FTVLI+++I F    V+R N+  +      + C+YN   ++  YCP+F++  ++         ++ T GGV+ + + W+CNLD+ A  C P Y F RL   +   +KGWNFRYANY+ ++  +HR L K +GLR ++ V G+AG+F+++ L+MN+GSGLALL IA  +CD++++    KK
Sbjct:   12 KTVDRGFGALFRYETSKVVQISSIKVSVIYRLIQLLIIAYVIGWVVVYKKGYQDFDDVVSGVTTKVKGVQYTNLTGTSIGARIWDVADYVVPPQENNAFFITTNAVVTRDQTQGACDEDPSV--APCFSDADCPAGKPQMLGNGVNTGRCVPSSQAPNKTSCEILAWCPVEVDQLP-AGGTMFPEAVNFTVLIKDSIEFPLFGVKRRNVLDYYNSSQLQNCVYNPDTDM--YCPVFRIGDILKLAGIDNFTKIAT-GGVVSITVNWDCNLDWDASYCNPTYRFRRLDDENTKIAKGWNFRYANYYRINDTDHRTLIKAYGLRFVVYVTGRAGRFNVIPLTMNLGSGLALLGIATVLCDMIVLYLHHKK 373          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A2C9M3Y3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075112 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.348e-94
Identity = 157/376 (41.76%), Postives = 228/376 (60.64%), Query Frame = 1
Query:  223 ICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGI---GVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKS-ALLKEVPDFTVLIRNTIIFDTINVQRSNL----FSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDH----VEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            +CS   + +F Y T ++  I  K +GFI RF Q++IL Y+I Y IVYK+GYQ+F    S++  K+KG+    +S   DI  + WD+ D V+PPQE+ A F+ TN I T NQ+Q TCPED T++ + C   S C +GK L  GNG  TG+CV S    +  CEI  WC +E+D+     +  +L    +FT+ I+N I F    V+R NL     + +   IN  C YNA+D   KYCP F++ T++   +    + +   GGVI V+I W+CNLD+S D+C P YSF RL   D + S+G+NFRYA+Y+ V       ++R LYK  G+  +I V+GKAGKFS++ L +N GSGLALL++   +CD++++     K
Sbjct:   13 VCSCVASTLFEYYTPRIVHIKSKKVGFINRFLQLVILSYIIGYVIVYKKGYQEFDTCQSAITTKLKGVVFSNLSHLSDIGVRTWDVADYVIPPQEIGATFVMTNVIPTLNQTQSTCPEDPTIDGSFCIDDSSCPQGKILDKGNGPFTGKCVNSANEKSHVCEIYGWCLVEDDSRYKNMTDPVLSGSHNFTMFIKNNIEFPKFGVRRRNLPDVATNESTAFIN-NCTYNATDPQAKYCPFFRLDTIVQG-AGYPYSAVAVEGGVIEVVINWDCNLDFSVDDCLPEYSFKRLDRGDYSISRGFNFRYADYYAVKENDTFKQYRNLYKATGIIFVINVQGKAGKFSIIPLLLNFGSGLALLALTTVICDLIVLYVLKAK 386          
BLAST of P2X purinoceptor 4 vs. TrEMBL
Match: A0A2C9M3W4 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106075112 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 4.279e-94
Identity = 157/376 (41.76%), Postives = 228/376 (60.64%), Query Frame = 1
Query:  223 ICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGI---GVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKS-ALLKEVPDFTVLIRNTIIFDTINVQRSNL----FSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDH----VEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKK 1314
            +CS   + +F Y T ++  I  K +GFI RF Q++IL Y+I Y IVYK+GYQ+F    S++  K+KG+    +S   DI  + WD+ D V+PPQE+ A F+ TN I T NQ+Q TCPED T++ + C   S C +GK L  GNG  TG+CV S    +  CEI  WC +E+D+     +  +L    +FT+ I+N I F    V+R NL     + +   IN  C YNA+D   KYCP F++ T++   +    + +   GGVI V+I W+CNLD+S D+C P YSF RL   D + S+G+NFRYA+Y+ V       ++R LYK  G+  +I V+GKAGKFS++ L +N GSGLALL++   +CD++++     K
Sbjct:   13 VCSCVASTLFEYYTPRIVHIKSKKVGFINRFLQLVILSYIIGYVIVYKKGYQEFDTCQSAITTKLKGVVFSNLSHLSDIGVRTWDVADYVIPPQEIGATFVMTNVIPTLNQTQSTCPEDPTIDGSFCIDDSSCPQGKILDKGNGPFTGKCVNSANEKSHVCEIYGWCLVEDDSRYKNMTDPVLSGSHNFTMFIKNNIEFPKFGVRRRNLPDVATNESTAFIN-NCTYNATDPQAKYCPFFRLDTIVQG-AGYPYSAVAVEGGVIEVVINWDCNLDFSVDDCLPEYSFKRLDRGDYSISRGFNFRYADYYAVKENDTFKQYRNLYKATGIIFVINVQGKAGKFSIIPLLLNFGSGLALLALTTVICDLIVLYVLKAK 386          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx8 (purinergic receptor P2X, ligand-gated ion channel, 8 [Source:ZFIN;Acc:ZDB-GENE-030319-7])

HSP 1 Score: 258.84 bits (660), Expect = 2.000e-81
Identity = 140/358 (39.11%), Postives = 207/358 (57.82%), Query Frame = 1
Query:  250 FRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFY-GLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYFEVDHVE-HRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            F Y+T K  I  +K +G + R  Q+ +L Y+I +  + K+GYQ+    + SSV+ KVKG+ +++      ++W   D V+P Q  + +FITTN IET NQ  G C E   V D  C+K  DC +G+ +  GNGV TGRC+K  R +  TCEI  WCPIE    +     LL +  +FT+ I+N I F      +SN+         K C+Y+A      YCPIF++  ++   S  +  +M  LGG I ++I W+C+LD    +C P Y+F+RL  N    + S G+NFRYA+YF+    E HR L KV+G+R  I+V G+AGKF+++   +NIGSGLAL+    F CD++++    K
Sbjct:   13 FDYKTEKYVIAKNKKVGILYRVIQLSLLGYIIGWVFLTKKGYQETEESIQSSVITKVKGVLLTNSSGTGPRLWGPEDYVIPQQGEDVLFITTNFIETPNQKLGYCAESFKVLDGRCRKNEDCPEGEAVVAGNGVRTGRCLKKDRNSTGTCEIYGWCPIEKSQRLI--VPLLGKTENFTIYIKNFIRFPKFGFSKSNVLDTAGDSYLKTCLYDAIAH--PYCPIFRLGDIVLR-SGHDFQDMALLGGSIGILIEWHCDLDKGYSHCHPRYTFTRLDFNSTANSVSSGYNFRYAHYFKNPAGETHRTLLKVYGIRFDIQVHGRAGKFNIIPTIINIGSGLALMGAGSFFCDMVLLYMMKK 365          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.825 bits (634), Expect = 9.480e-77
Identity = 139/360 (38.61%), Postives = 200/360 (55.56%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYFEVDHVEH-RMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            C       F Y T K  +I  K +G I R  Q L++ Y+I Y  V+K+GYQD   + SSV  KVKGI +++  D+  +IWD+ D ++PPQE N+ F+ TN   T NQ+Q  CPE+   E + C    DCKKG      +GV TGRCV  F    KTCE+ AWCP+E          +L E  +FTVLI+N++ +   N  R N+          KC++  S +    CPIF++  ++    + +   M   GGV+ V I W+C+LD  A+ C P Y+F RL   D     + G+NFR+A Y++  + E  R L K +G+R  I V GKAGKF++V   +NIG+GL L+ +   VCD  ++
Sbjct:   72 CVSLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPGPESS-CSSDQDCKKGFRNGRLSGVRTGRCVH-FSERIKTCEVLAWCPLEKYDEP-PDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVF--SRDTDPDCPIFRLRDIVAEAGE-DFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVL 425          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx4a (purinergic receptor P2X, ligand-gated ion channel, 4a [Source:ZFIN;Acc:ZDB-GENE-020806-2])

HSP 1 Score: 248.825 bits (634), Expect = 5.094e-76
Identity = 139/360 (38.61%), Postives = 200/360 (55.56%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYFEVDHVEH-RMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            C       F Y T K  +I  K +G I R  Q L++ Y+I Y  V+K+GYQD   + SSV  KVKGI +++  D+  +IWD+ D ++PPQE N+ F+ TN   T NQ+Q  CPE+   E + C    DCKKG      +GV TGRCV  F    KTCE+ AWCP+E          +L E  +FTVLI+N++ +   N  R N+          KC++  S +    CPIF++  ++   +  +   M   GGV+ V I W+C+LD  A+ C P Y+F RL   D     + G+NFR+A Y++  + E  R L K +G+R  I V GKAGKF++V   +NIG+GL L+ +   VCD  ++
Sbjct:   72 CVSLTRCFFDYSTPKTLVIRSKTVGAINRLCQALVIAYIIGYVCVWKKGYQDTDTVISSVTTKVKGIALTNTSDLGTRIWDVADYIIPPQEENSFFVLTNLNITPNQTQSHCPENPGPESS-CSSDQDCKKGFRNGRLSGVRTGRCVH-FSERIKTCEVLAWCPLEKYDEP-PDPPMLAEAENFTVLIKNSVRYPKFNFSRRNILPHINSTYLSKCVF--SRDTDPDCPIFRLRDIVAE-AGEDFQAMAVHGGVMGVQIRWDCDLDMPANWCVPRYTFRRLDNKDPENNVAPGYNFRFAKYYKSSNGEEIRTLIKGYGIRFDIMVFGKAGKFNVVPTLLNIGAGLGLMGLVTVVCDWFVL 425          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 238.424 bits (607), Expect = 1.754e-73
Identity = 135/360 (37.50%), Postives = 194/360 (53.89%), Query Frame = 1
Query:  241 NHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGT-FSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            +  F YET +  ++ ++ +G + R  Q+ +LVY+I +  +Y++GYQ       SV  K+KG+  ++     +K+WD+ D V P Q   +  + TN I T  Q+Q TCPE    ++  C    DCKKG+    GNG MTG+CV     T  TCEI +WCP+E+D  I     LL    ++T+ I+N+I F   NV RSNL         K C+++   + L  CPIFK+   I   S     ++   GG I ++I W CNLD     C P Y F  LY +     S G+NFR A Y+  D VE R L KVFGLRI I V G A KF ++     IGSG+ +  +A  VCD++++    K+D
Sbjct:   11 DFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISG-EQKVWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPELPDGKNT-CHSDEDCKKGEFKRTGNGEMTGKCVN----TTNTCEIMSWCPVEDDRQI-PDPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRD 360          
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:103022360])

HSP 1 Score: 238.039 bits (606), Expect = 2.618e-73
Identity = 135/360 (37.50%), Postives = 194/360 (53.89%), Query Frame = 1
Query:  241 NHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGT-FSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            +  F YET +  ++ ++ +G + R  Q+ +LVY+I +  +Y++GYQ       SV  K+KG+  ++     +K+WD+ D V P Q   +  + TN I T  Q+Q TCPE    ++  C    DCKKG+    GNG MTG+CV     T  TCEI +WCP+E+D  I     LL    ++T+ I+N+I F   NV RSNL         K C+++   + L  CPIFK+   I   S     ++   GG I ++I W CNLD     C P Y F  LY +     S G+NFR A Y+  D VE R L KVFGLRI I V G A KF ++     IGSG+ +  +A  VCD++++    K+D
Sbjct:   11 DFFFEYETPRQVLVRNRRVGVVCRLIQLGVLVYIIGWVFIYEKGYQTEDTAIGSVFTKMKGVAYTNISG-EQKVWDVSDYVYPDQGAESFVVMTNFIITVGQTQSTCPELPDGKNT-CHSDEDCKKGEFKRTGNGEMTGKCVN----TTNTCEIMSWCPVEDDRQI-PDPPLLLAAENYTLFIKNSITFPEFNVVRSNLVEGVDQNYIKTCMFHPEKDPL--CPIFKLGD-IAQYSGFNFTQIAQGGGAIGILIDWECNLDLRIQKCIPKYRFHGLYGSSSEGASVGYNFRKAKYYVEDKVEKRTLMKVFGLRIDIIVHGLARKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYLLPKRD 360          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008095.1 (pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 gene:ENSPMAG00000007268.1 transcript:ENSPMAT00000008095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.973 bits (624), Expect = 1.835e-76
Identity = 137/359 (38.16%), Postives = 202/359 (56.27%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKD-IHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            C   V   F Y+T K+ I  D+ +G + R  Q++IL Y+I +  V K+GYQ+      +SV+ KVKG+ +++  +   +++WD  D V+PPQ  +  F+ TN + T  Q QG C E+  V  A CQ+  DC  G+  + GNG+ TGRCV +  GT + CE+ AWCP+EN      + A+L+E  +FTV I+ ++ F   NV R N+         K C ++     L  CP+F++  L      S  ++M T GGVI V + W+C+LD     C   Y FSRL       + G NFR+A Y   D  E R L KV+G+R  + V GKAGKFS+V   +N+G+GLALL    F+CD+ ++
Sbjct:    6 CGALVCSAFEYKTEKLMIARDRSVGVVYRLMQLVILAYIIGWVFVVKKGYQETDPDPETSVITKVKGVALTNSTEGPGQRLWDTADYVIPPQGESRFFVVTNLVSTPRQRQGLCAENPNVPGARCQEDGDCPAGRTFNTGNGICTGRCVPT-NGTARVCEVHAWCPVENSPT--PREAVLREAENFTVFIKVSVNFTRFNVHRRNVLEEGDSSYLKSCEFHPERSPL--CPVFRLGELAVRAGAS-FSDMATRGGVIAVHLAWDCDLDRDLSACAAQYRFSRLDSERSRVAAGHNFRFARYSWQDGAETRSLLKVYGVRFDVMVSGKAGKFSIVPTLLNLGAGLALLGAGAFLCDLFLL 358          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007719.1 (pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 gene:ENSPMAG00000006964.1 transcript:ENSPMAT00000007719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 1.270e-57
Identity = 116/339 (34.22%), Postives = 169/339 (49.85%), Query Frame = 1
Query:  304 ILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND--GTFSKGWNFRYANYF-EVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSK 1311
            IL F   ++LV      ++Y  GYQ+F G+ SS   KVKG       ++   + D  D V+ P+E N+ F+ TN IET NQ QG C ED  V  A C   +DC+ G     G GV TG CV     T K+CE+ AWCP+  D+            P   +L  N                       K C Y+   +    CPIF +  ++    + +  E+   GGV  ++I WNCNLD +   C PNY F RL   +   T S G+NFR+  Y+ +   +E R L K +G+R ++EV G+AGK SL+   +++GSG+ LL +   +CD++++ C  K
Sbjct:   31 ILTFLVFVMLVISYTGWVIYTHGYQEFDGVVSSSTAKVKGA-----TEVTGMVMDAADYVISPEEPNSFFVMTNFIETPNQKQGACAEDPDV--APCSSDTDCRAGVTDPEGEGVFTGLCV-PINNTTKSCEVNAWCPLPKDS----------NPPKHNILGSNASYL-------------------KSCRYHRQSD--PECPIFILGDIVSEAGE-DFKELAIEGGVFSIMIEWNCNLDLNEQACKPNYKFRRLDKENRNKTISPGYNFRFPKYYKDAKGIETRTLVKAYGIRFMVEVIGQAGKASLLRSLISLGSGVGLLGMVWVICDLIVLFCCRK 329          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008762.1 (pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 gene:ENSPMAG00000007911.1 transcript:ENSPMAT00000008762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.4 bits (433), Expect = 2.213e-49
Identity = 115/324 (35.49%), Postives = 167/324 (51.54%), Query Frame = 1
Query:  244 HIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQ-GTC--PEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANY--FEVDHVEHRMLYKVFGLRILIEVRGK 1200
            +IF Y    V  I +K  G I    +++IL Y   Y + ++  Y+++  ++S+V VKVKG    D  +   + +D  D VVP QE N  F+ TN I T NQ+Q  TC  PE      + CQ   DC +    HLG+G+ TGRC++ +  T K+CE+  WCP+E  T    +  LL    + TV I+N + F   N +R N      G     C Y+  D+    CPIF++  +   ++    + M   GG+I ++I+W+C L  S   C P YSF RL  N  T  +G+NFR   Y   E D V+ R L K FG+R  I V G+
Sbjct:   12 NIFFYPRELVIGIENKYCGPIHMVVRIVILGYGARYVVGFEHAYREYEDVTSAVRVKVKGTAKVDIPNEGVRTFDSADYVVPDQEPNTFFVMTNFIVTKNQTQVTTCCNPEAMKFSVSPCQNDGDCTRDASKHLGSGIQTGRCIR-YDATCKSCEVMGWCPVERRTSP-PQPPLLPATENATVYIQNHVYFIKNNKERENFPLNLEGKDLSSCRYHPRDD--PSCPIFRLGDITA-MAGHSFSSMSVQGGIIAIVISWDCKL--SEVECFPAYSFHRLDRNYTT-KRGYNFRSLVYKSMETD-VQTRTLVKAFGIRFNILVTGQ 326          
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000196.1 (pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gene:ENSPMAG00000000176.1 transcript:ENSPMAT00000000196.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.832e-10
Identity = 36/98 (36.73%), Postives = 49/98 (50.00%), Query Frame = 1
Query:  643 GVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLI 936
            G  TGRCV  F     TCE+ AWCP+E +     K  LL+   +FT+LI+N I F   NV + NL         K C ++     L  CPIF +  ++
Sbjct:    1 GEKTGRCV-PFDKNVSTCEVNAWCPVEVEGKNTGKR-LLRSAENFTILIKNNIRFPKFNVSKGNLPENMDKNFLKSCHHHPKHNNL--CPIFSLRDIL 94          
BLAST of P2X purinoceptor 4 vs. Ensembl Nematostella
Match: EDO41363 (P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S4Q4])

HSP 1 Score: 249.98 bits (637), Expect = 2.996e-78
Identity = 139/372 (37.37%), Postives = 213/372 (57.26%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRK-------IWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTN-KTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            C K ++ +  Y T+K+  I  K +G I R  Q+ I+ Y+I Y I+YK+GYQ+     SSV  K+KG   ++              +WD  D V+PP+E +A F+ TN + T +Q QGTCPE   + +  C +  +C + +    G+G  TG+CV S +    K CE+ AWCP+E D     +   LK   +FTVLI+NT+ F +  V + N+         K C Y+     L  CPIF++ T+     + + N++   GGVI +IITWNC+ D    +C P YSF RL   +   +KG+NFR+ANY+  +   HR L+K +G+R ++ V G+ GKF++V L +N+GSGLALLSIA  +CD++++    +K+
Sbjct:    5 CGKVIDSLLEYNTSKIVHIKSKKVGLINRLIQLAIIGYIIGYVIIYKKGYQEVEKPYSSVTTKLKGTSFTNLTGNESFPLYGGPFVWDQADYVIPPEENDAFFVATNMVITPDQRQGTCPESPDIANVKCTRDENCTRMEETSYGHGFQTGKCVPSDQEKGIKVCEVFAWCPVELDITPMPQFPSLK---NFTVLIKNTVQFPSFGVSKRNIAPDADTSTLKSCQYDKDTSPL--CPIFRLETITKEAGQ-DFNKLAYKGGVIGIIITWNCDFDSLLYSCKPVYSFRRLDNANAPIAKGYNFRHANYYVKNDTLHRTLFKAYGIRFVVTVTGQGGKFNVVPLFLNLGSGLALLSIATVLCDVVVLYVLRRKE 370          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx5 (P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001])

HSP 1 Score: 258.455 bits (659), Expect = 2.348e-80
Identity = 133/353 (37.68%), Postives = 207/353 (58.64%), Query Frame = 1
Query:  247 IFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQD-FYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLN-DGTFSKGWNFRYANYFEVDHVE-HRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            +  Y+T K  I  ++ IG + R +Q+ +L Y+I +  V K+GYQ+    + +SV+ KVKG+ + +       +W   D V+PP      FI TN IET NQ  G C E   V + +CQ   DC +G+ +  G+G+MTG C+ S      TCEI AWCP+E+        ALL E  +FT+ I+N I F      +SN+   +     KKC Y+  +    YCPIF++  L+ N + ++  +M   GG + ++I WNC+LD  +  C P YSF+RL +N + + + G+NFR+A Y++ +  E +R LYKV+G+R  I + G+AGKF++V   + IGSG+AL+ I  FVCD++++
Sbjct:   11 LLNYKTEKYVIAENRRIGILFRLYQLAVLGYIIGWVFVVKKGYQEKEEAVQTSVITKVKGVSLINSSQTGPYLWSAEDYVIPPNGEQVFFIVTNYIETPNQRLGFCAESPKVPNGMCQSDEDCLEGESIAAGHGIMTGLCLNS----TGTCEIYAWCPVEHSKR--PTEALLSEAENFTIYIKNFIRFPKFEFSKSNVLETSDDSYLKKCSYDRENH--PYCPIFRLRDLVRN-TGNDFQDMAAKGGSVGILIEWNCDLDKDSSECNPRYSFTRLDMNLNSSITSGYNFRHARYYKDEKGETYRTLYKVYGIRFDIMINGQAGKFNIVPTIIAIGSGVALMGIGAFVCDMILL 354          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 237.654 bits (605), Expect = 3.142e-73
Identity = 131/364 (35.99%), Postives = 194/364 (53.30%), Query Frame = 1
Query:  241 NHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND-----GTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            +  F YET +  ++ +K +G + R  Q+ +L Y+I +  +Y++GYQ      SSV  KVKG+G ++   + R +WD  D V PPQ  ++  + TN I T NQ+ G CPE       +C+  +DCK G      +G +TG CVK      KTCE+ AWCP+E+D  I     LL    +FT+ I+N++ F    + RSNL     G   K C+++  +  L  CPIFK+  ++  +S      M   GG I ++I W CN DY    C P Y F  LY N         S G+NFRYA Y+  D +E R L KVFG+R  I V+    KF ++     IGSG+ +  +A  VCD++++    ++D
Sbjct:   11 DFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVER-VWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPE--LPGRYICKSDTDCKGGTYNRTVDGKLTGVCVKE----TKTCELLAWCPLEDDRNI-PNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRD 363          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx1 (purinergic receptor P2X 1 [Source:NCBI gene;Acc:101169631])

HSP 1 Score: 238.039 bits (606), Expect = 4.862e-73
Identity = 131/364 (35.99%), Postives = 194/364 (53.30%), Query Frame = 1
Query:  241 NHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLND-----GTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            +  F YET +  ++ +K +G + R  Q+ +L Y+I +  +Y++GYQ      SSV  KVKG+G ++   + R +WD  D V PPQ  ++  + TN I T NQ+ G CPE       +C+  +DCK G      +G +TG CVK      KTCE+ AWCP+E+D  I     LL    +FT+ I+N++ F    + RSNL     G   K C+++  +  L  CPIFK+  ++  +S      M   GG I ++I W CN DY    C P Y F  LY N         S G+NFRYA Y+  D +E R L KVFG+R  I V+    KF ++     IGSG+ +  +A  VCD++++    ++D
Sbjct:   11 DFFFEYETPRQVLVRNKRVGVVCRLIQLGVLAYIIGWVFIYEKGYQITETAVSSVFTKVKGVGSTNISGVER-VWDPSDYVFPPQGDSSFVVMTNYILTENQTMGKCPE--LPGRYICKSDTDCKGGTYNRTVDGKLTGVCVKE----TKTCELLAWCPLEDDRNI-PNPPLLMSAENFTLFIKNSVTFPLFGITRSNLVEEIDGKTIKNCLFDPDNSPL--CPIFKLGDIV-KLSGFTFETMAKQGGAIGLVIDWTCNFDYDVKKCKPKYEFHGLYGNPRVKDTSKASVGYNFRYAKYYMGDKMEKRTLMKVFGIRFDIIVQSLGRKFDIIPTLTAIGSGVGIFGVATVVCDLVLLYVLPRRD 363          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx4b (purinergic receptor P2X 4 [Source:NCBI gene;Acc:101168548])

HSP 1 Score: 234.572 bits (597), Expect = 4.364e-71
Identity = 135/367 (36.78%), Postives = 212/367 (57.77%), Query Frame = 1
Query:  226 CSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL-YLNDGT-FSKGWNFRYANYFE-VDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            C   ++H+F YET K  +I    +G + RF Q+L+++YV+ Y  V ++GYQ+   + S+V  KVKG   ++  D+  ++WD+ D V+PPQ  ++ FI TN + T  Q+Q  CPE       +C+   DC +G      NG+ TG C ++F  T KTCE+ +WCP+E DT + KK ALL    +FTVLI+N+I +   N    N+           C +N   +    CPIF++  +I   ++++  EM   GG++ ++I W+C+LD+ A  C P YSF RL   N G   + G+NFR+A +++  D VE R L K +G+R  + V G AGKF +V   +N+G+ L+ LS+   V D +++ C  K+D
Sbjct:    7 CRGFLHHVFDYETAKTLVIPHFGVGIVFRFTQLLVVLYVVGYVCVVQKGYQETDSVISTVTTKVKGFAYTNTSDMDPRMWDVADYVIPPQGDSSFFILTNLVVTPEQTQSHCPELPN-PSTVCKDDCDCIEGYNDPRRNGIRTGLC-ENFSTTVKTCEVFSWCPLEVDTRLPKK-ALLAAAENFTVLIKNSITYPKFNFHGRNILPHVNSSYLAHCEFNRLTD--PDCPIFRLKRIISE-AEADFQEMAVKGGILGILIDWSCDLDWWAGKCLPKYSFHRLDNQNQGNDVAPGYNFRFAKFYKRADGVEERTLIKAYGIRFEVIVFGTAGKFGIVPAIVNLGAALSFLSLVPIVADWVMLTCMRKRD 367          
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Match: p2rx3b (purinergic receptor P2X 3 [Source:NCBI gene;Acc:101174325])

HSP 1 Score: 214.927 bits (546), Expect = 2.164e-64
Identity = 125/358 (34.92%), Postives = 198/358 (55.31%), Query Frame = 1
Query:  238 VNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDF-YGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRL--YLNDGTFSKGWNFRYANYFEVDH-VEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIIN 1299
            + + F YET K  ++    IG I R  Q+LI+ Y I +  + ++ YQ     + SSV+ KVKG GV      + ++ D+ D V P Q  +   I T  I T NQ QG CPE  + +  +C   SDC   +      G++TGRCV SF  T KTCEIK WCP E DT+   K   + EV +FT+ I+N+I F   N  + N          KKC ++  +    YCPIF+V  ++ + +  + +++   GGVI + I+W C+LD S ++C P+YSF+RL         S G+NFR+A Y+++++  ++R L K + +R  + V G AGKF+++   +N+ +    + +   +CDI+++N
Sbjct:    5 IKNFFTYETTKSVVVKSWTIGIINRVVQLLIITYFIGWVFLCEKAYQIIDTAIESSVMTKVKGFGVH-----NGQVMDVADYVTPTQGASVFCIITKTITTENQVQGLCPE--SEKRWICYNDSDCNPQRNKPGDYGILTGRCV-SFNDTKKTCEIKGWCPAEIDTV---KITPMMEVENFTIFIKNSIRFPKFNYTKGNFLPSINRTYIKKCNFDKVNNT--YCPIFRVGDVV-HYADQDFSKLADKGGVIGIKISWMCDLDKSDEHCKPSYSFNRLDTMSQKNEVSPGYNFRFAKYYKMENGTDYRTLIKAYAIRFDVIVNGNAGKFNMIPTLINMVAAFTSVGVGTVLCDIILLN 348          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 369/371 (99.46%), Postives = 369/371 (99.46%), Query Frame = 1
Query:  205 MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 1317
            MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQK SDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNIS SELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD
Sbjct:    1 MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILIINCFSKKD 371          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046729.1 (SMESG000046729.1)

HSP 1 Score: 725.317 bits (1871), Expect = 0.000e+0
Identity = 352/354 (99.44%), Postives = 352/354 (99.44%), Query Frame = 1
Query:  205 MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSI 1266
            MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQK SDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNIS SELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSI
Sbjct:    1 MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKDSDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISNSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSI 354          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046751.1 (SMESG000046751.1)

HSP 1 Score: 434.491 bits (1116), Expect = 1.440e-149
Identity = 210/360 (58.33%), Postives = 267/360 (74.17%), Query Frame = 1
Query:  226 CSKAVN----HIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILI 1293
            CS   N    ++  Y T K+++I +  I +  R  Q  IL+YV +YS+  K+GYQD YGLSSSV+VK KG+G + + +  R +WDI D+VVPPQE+NA+FITTN +ET NQ+QG CPE+  V ++ C+  +DC   K L+LGNG MTG+CV +     KTCEI+AWCP+ENDT     S ++KEVP++TVLI+NTIIFD +NVQRSNLF+ T  II   CIYNASD LLKYCPIFKVS+ IG I+ ++L E+L  GG+IRVIITWNCNLD   D+C P YSF RL+   G FSKGWNFRYANY+E ++ EHR L+KV+GLRILIEVRGKA K S  TLSMN+GSG+ALL+IA  VCD ++
Sbjct:    5 CSSCCNILRANVLDYPTYKIAVIQNTNIVYFFRILQAGILLYVFIYSLWLKKGYQDSYGLSSSVVVKTKGVGFASKTNSQRVLWDIADSVVPPQEVNALFITTNVVETYNQTQGMCPENPVVFNSTCKTDADCPIKKILYLGNGPMTGKCVNASPDI-KTCEIRAWCPLENDTFDENYSNIIKEVPNYTVLIKNTIIFDEVNVQRSNLFACTSEIIPASCIYNASDSLLKYCPIFKVSSFIGTINDTDLTELLVYGGIIRVIITWNCNLDDKYDHCRPEYSFERLFTKYGKFSKGWNFRYANYYERNNKEHRALFKVYGLRILIEVRGKARKLSFFTLSMNVGSGIALLTIATIVCDFIM 363          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000046895.1 (SMESG000046895.1)

HSP 1 Score: 413.69 bits (1062), Expect = 1.244e-141
Identity = 204/359 (56.82%), Postives = 265/359 (73.82%), Query Frame = 1
Query:  220 RICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            R  +K     F YETNK+  I+ K IGF+ RFFQ+L++VY+I Y ++Y RGYQD YGLSSSV+VKVKGI  +      R++WDI D ++PPQE  A F+TTNAIET NQ+Q  C ED  V  A C    DC + K + LGNGVMTGRCV S  G  KTCEI +WCP+ENDT++     +LKE+PDFT+LIRNTI+FD ++V+RSNLF+W    I K C++N +D  LKYCPIFK+S+ +G I+  E+ ++LT GG+I+VII WNC+LD+S + C P YSF+RL   DG  SKGWNFR+ANY+  +  E+R+LYKVFGLRIL EVRGKA KFS +TL+MNIGSG+ALL++A  +CD +I+
Sbjct:    7 RQTTKVKKAFFEYETNKIVQINSKKIGFLFRFFQLLLIVYIIGYVLIYMRGYQDSYGLSSSVVVKVKGISSTADSVSRRRMWDISDIIIPPQENGATFVTTNAIETLNQTQSICAEDYNVPGARCVNDYDCIENKAIILGNGVMTGRCVNSVYGI-KTCEIYSWCPLENDTMVDPDKYILKEIPDFTILIRNTILFDELHVKRSNLFAWENNWIPKTCLFNPNDNWLKYCPIFKISSFLGTITPVEMKQLLTFGGIIQVIINWNCDLDFSENQCKPEYSFNRLDPKDGKLSKGWNFRFANYYVNNGREYRILYKVFGLRILFEVRGKARKFSAITLTMNIGSGVALLAVATVLCDFIIL 364          
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Match: SMESG000028996.1 (SMESG000028996.1)

HSP 1 Score: 304.294 bits (778), Expect = 4.832e-99
Identity = 163/364 (44.78%), Postives = 233/364 (64.01%), Query Frame = 1
Query:  217 FRICSKA-VNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYSIVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIH-RKIWDIPDTVVPPQEMNAIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMTGRCVKSFRGTNKTCEIKAWCPIENDTIIFK--KSALLKEVPDFTVLIRNTIIFDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKSELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWNFRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLALLSIAIFVCDILII 1296
            +R C ++ ++ I  YET K+  I +K IG I RF Q++IL YVI Y IVYK+GYQ+     S+V+ KVKG+ +++R       IWD+ D V+PPQE NA FIT+NA+ T  Q+QG CPED     A C+  +DC   +P+ LG+GV TG C+      N+TCE+ AWCP+E+     K  K  LL  V +FTV I+N I F    V RSN+ S     +   C Y++S+     CPIF++  +I N++    +++L  GGVI   I W+CNLD S +NC P YSF+RL  +D   +KGWNFR+ANY+ ++  ++R L K +G+R +I V  KAGKFS++ L+MN+GSGLALL+IA  +CD +++
Sbjct:    3 YRRCLRSCISVIIEYETVKIVSIKNKKIGLIFRFIQLVILSYVIGYVIVYKKGYQETEPGISAVISKVKGVSLTNRSFAGGETIWDVADYVIPPQEENAFFITSNALITKKQTQGKCPEDKNTVGAQCKTNADCVPLEPIILGDGVKTGVCI-----NNQTCEVYAWCPVESSAEDSKTVKLPLLNNVNNFTVYIKNNIEFRKFKVFRSNIPSNFNKSMLSSCRYSSSNTK---CPIFQIG-MILNLTGKSYDDILKTGGVISFSINWDCNLDVSLENCFPTYSFNRLDSDDIKLAKGWNFRHANYYYINETQYRDLIKAYGIRFVISVSSKAGKFSIIPLTMNLGSGLALLAIATIICDFIVL 357          
The following BLAST results are available for this feature:
BLAST of P2X purinoceptor 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2RX41.332e-9039.95purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX41.598e-8638.28purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
P2RX21.445e-8036.44purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX21.185e-7936.44purinergic receptor P2X 2 [Source:HGNC Symbol;Acc:... [more]
P2RX48.742e-7939.17purinergic receptor P2X 4 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx4b3.122e-8239.13purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a2.324e-7736.89purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a9.029e-7536.27purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx51.984e-7435.83purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx51.984e-7435.83purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx54.181e-8740.44purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx54.698e-8740.33purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx56.290e-8740.44purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.024e-8640.44purinergic receptor P2X, ligand gated ion channel,... [more]
p2rx51.059e-8640.33purinergic receptor P2X, ligand gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
P2rx42.122e-8840.00purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx42.373e-7938.90purinergic receptor P2X, ligand-gated ion channel ... [more]
P2rx12.181e-7738.29purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx22.737e-7736.07purinergic receptor P2X, ligand-gated ion channel,... [more]
P2rx23.723e-7736.07purinergic receptor P2X, ligand-gated ion channel,... [more]
back to top
BLAST of P2X purinoceptor 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99571|P2RX4_HUMAN6.395e-9039.95P2X purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RX... [more]
sp|Q5E9U1|P2RX4_BOVIN2.550e-8839.94P2X purinoceptor 4 OS=Bos taurus OX=9913 GN=P2RX4 ... [more]
sp|Q9JJX6|P2RX4_MOUSE8.678e-8840.00P2X purinoceptor 4 OS=Mus musculus OX=10090 GN=P2r... [more]
sp|P51577|P2RX4_RAT2.513e-8740.27P2X purinoceptor 4 OS=Rattus norvegicus OX=10116 G... [more]
sp|Q9UBL9|P2RX2_HUMAN5.689e-7936.44P2X purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RX... [more]
back to top
BLAST of P2X purinoceptor 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EI983.002e-10243.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GN823.168e-10243.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J6R22.670e-10043.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9M3Y32.348e-9441.76Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9M3W44.279e-9441.76Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx82.000e-8139.11purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a9.480e-7738.61purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx4a5.094e-7638.61purinergic receptor P2X, ligand-gated ion channel,... [more]
p2rx11.754e-7337.50purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx12.618e-7337.50purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008095.11.835e-7638.16pep scaffold:Pmarinus_7.0:GL481209:13988:23244:1 g... [more]
ENSPMAT00000007719.11.270e-5734.22pep scaffold:Pmarinus_7.0:GL477301:21784:46999:1 g... [more]
ENSPMAT00000008762.12.213e-4935.49pep scaffold:Pmarinus_7.0:GL477338:26903:57888:-1 ... [more]
ENSPMAT00000000196.11.832e-1036.73pep scaffold:Pmarinus_7.0:GL482356:953:3300:-1 gen... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413632.996e-7837.37P2X purinoceptor [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
p2rx52.348e-8037.68P2X purinoceptor 5 [Source:NCBI gene;Acc:101173001... [more]
p2rx13.142e-7335.99purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx14.862e-7335.99purinergic receptor P2X 1 [Source:NCBI gene;Acc:10... [more]
p2rx4b4.364e-7136.78purinergic receptor P2X 4 [Source:NCBI gene;Acc:10... [more]
p2rx3b2.164e-6434.92purinergic receptor P2X 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of P2X purinoceptor 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046729.10.000e+099.46SMESG000046729.1[more]
SMESG000046729.10.000e+099.44SMESG000046729.1[more]
SMESG000046751.11.440e-14958.33SMESG000046751.1[more]
SMESG000046895.11.244e-14156.82SMESG000046895.1[more]
SMESG000028996.14.832e-9944.78SMESG000028996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005825 ID=SMED30005825|Name=P2X purinoceptor 4|organism=Schmidtea mediterranea sexual|type=transcript|length=1511bp
GTCATTGATTATAAATATTGTATAAAGTTATTTATAATTATTTGATTACC
AATTAAAACAACAGCTCTAAATATAATATCCAATAGAAATTGAGAAAGGG
AAGTGTAAATATATCTCTATTGATTAGTTTTCCAGTTGGATTAATTTGTG
GAGTGAAATTTCTGTGCCGTATAAAATAAAAAAAATAGAAGGGATTCCCT
AAACATGACTTGCGAATTCCGAATATGCTCGAAAGCCGTCAATCACATTT
TCAGATACGAAACCAATAAAGTCTCCATAATTCATGATAAATGCATTGGA
TTTATACTTAGGTTTTTCCAAGTCTTGATATTGGTATATGTCATTCTGTA
TTCAATCGTTTACAAGCGCGGATATCAAGACTTTTACGGTTTATCCAGCA
GCGTATTGGTCAAAGTCAAAGGTATTGGAGTTTCAGATAGGAAGGATATT
CATCGAAAGATTTGGGATATTCCCGACACAGTAGTCCCACCCCAAGAAAT
GAATGCAATTTTCATCACGACCAATGCGATCGAGACTGCTAATCAGAGCC
AAGGAACCTGCCCGGAGGATACCACAGTAGAAGACGCACTCTGTCAAAAA
GCTTCAGATTGTAAAAAAGGAAAACCTCTGCATCTTGGAAATGGTGTCAT
GACGGGGCGATGTGTCAAATCGTTTAGAGGTACCAATAAAACCTGTGAGA
TCAAGGCATGGTGCCCAATTGAAAATGATACGATAATTTTTAAGAAAAGC
GCCTTATTAAAAGAAGTGCCAGATTTTACCGTTCTAATTCGTAATACAAT
CATTTTTGATACTATCAACGTGCAAAGATCAAACTTGTTTTCTTGGACAA
GAGGAATTATAAACAAGAAATGCATTTATAATGCAAGTGATGAGCTGCTG
AAATACTGTCCGATCTTCAAGGTTTCTACGCTGATTGGAAACATTAGTAA
ATCTGAACTGAATGAAATGTTAACTCTTGGAGGAGTAATAAGAGTAATAA
TAACTTGGAACTGCAATCTTGATTATTCCGCGGACAACTGCACGCCAAAT
TATTCGTTTTCACGGCTGTATTTGAACGATGGGACGTTTAGCAAAGGGTG
GAATTTCAGATATGCAAATTATTTTGAAGTTGACCACGTTGAACATAGAA
TGCTCTACAAAGTCTTTGGATTAAGAATACTTATTGAAGTACGAGGTAAG
GCCGGGAAATTCAGTCTGGTAACATTATCAATGAATATTGGATCCGGTCT
CGCTCTTTTGTCAATAGCAATTTTTGTGTGTGACATTTTAATAATAAATT
GTTTTTCAAAAAAAGACAAATATCAGTACAAATATGAAGTTCATAAAAAA
AAGAAAAAGGATAAGTCTCAAATGCTGAAGGAAAAAGAAGAGCCTGTTTG
ATTTTCATCTTAATATTATAGTCTGTAAATATTATCGCCCATCAGTGCTT
ATACTTGCGCATATTATTATTTTTTTATATTTTTTAATATTTCTGTTAAT
AAATCTTTGTG
back to top

protein sequence of SMED30005825-orf-1

>SMED30005825-orf-1 ID=SMED30005825-orf-1|Name=SMED30005825-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MTCEFRICSKAVNHIFRYETNKVSIIHDKCIGFILRFFQVLILVYVILYS
IVYKRGYQDFYGLSSSVLVKVKGIGVSDRKDIHRKIWDIPDTVVPPQEMN
AIFITTNAIETANQSQGTCPEDTTVEDALCQKASDCKKGKPLHLGNGVMT
GRCVKSFRGTNKTCEIKAWCPIENDTIIFKKSALLKEVPDFTVLIRNTII
FDTINVQRSNLFSWTRGIINKKCIYNASDELLKYCPIFKVSTLIGNISKS
ELNEMLTLGGVIRVIITWNCNLDYSADNCTPNYSFSRLYLNDGTFSKGWN
FRYANYFEVDHVEHRMLYKVFGLRILIEVRGKAGKFSLVTLSMNIGSGLA
LLSIAIFVCDILIINCFSKKDKYQYKYEVHKKKKKDKSQMLKEKEEPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0001614purinergic nucleotide receptor activity
GO:0004931extracellular ATP-gated cation channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001429P2X_purnocptor
IPR027309P2X_extracellular_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0098794postsynapse
Vocabulary: biological process
TermDefinition
GO:0098655cation transmembrane transport
GO:0033198response to ATP
GO:0035590purinergic nucleotide receptor signaling pathway
GO:0060079excitatory postsynaptic potential