Protein kinase N2

Overview
NameProtein kinase N2
Smed IDSMED30005823
Length (bp)3674
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase N2 (SMED30005823) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase N2 (SMED30005823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase N2 (SMED30005823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase N2 (SMED30005823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005823SMESG000014536.1 SMESG000014533.1 SmedASXL_007007SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005823SMESG000014536.1 SMESG000014533.1 SmedASXL_007007SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30005823SMESG000014536.1 SMESG000014533.1 dd_Smed_v4_7015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 dd_Smed_v4_7015_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 dd_Smed_v4_7015_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SMED30005823smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SmWIOct06_027551GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SMED_04690_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SMED_04690_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SMED_04690_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005823SMESG000014536.1 SMESG000014533.1 SMED_04690_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase N2 vs. Ensembl Human
Match: PKN2 (protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:9406])

HSP 1 Score: 303.523 bits (776), Expect = 1.795e-86
Identity = 151/323 (46.75%), Postives = 214/323 (66.25%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG   +    VK+H FF  IDW+ L  +++ PPFIP +    D   F+ EFT++ P+     +  + SE + E+FR+FD    W
Sbjct:  613 AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADW 935          
BLAST of Protein kinase N2 vs. Ensembl Human
Match: PKN2 (protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:9406])

HSP 1 Score: 303.138 bits (775), Expect = 6.214e-86
Identity = 151/323 (46.75%), Postives = 214/323 (66.25%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG   +    VK+H FF  IDW+ L  +++ PPFIP +    D   F+ EFT++ P+     +  + SE + E+FR+FD    W
Sbjct:  661 AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADW 983          
BLAST of Protein kinase N2 vs. Ensembl Human
Match: PKN1 (protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:9405])

HSP 1 Score: 301.597 bits (771), Expect = 8.490e-86
Identity = 145/304 (47.70%), Postives = 203/304 (66.78%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  +    +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF ++ W  L +R+L PPF+P L   TD   F+ EFT +  T+
Sbjct:  612 LEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTL 915          
BLAST of Protein kinase N2 vs. Ensembl Human
Match: PKN1 (protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:9405])

HSP 1 Score: 301.597 bits (771), Expect = 1.062e-85
Identity = 145/304 (47.70%), Postives = 203/304 (66.78%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  +    +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF ++ W  L +R+L PPF+P L   TD   F+ EFT +  T+
Sbjct:  618 LEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTL 921          
BLAST of Protein kinase N2 vs. Ensembl Human
Match: PKN3 (protein kinase N3 [Source:HGNC Symbol;Acc:HGNC:17999])

HSP 1 Score: 284.648 bits (727), Expect = 2.952e-80
Identity = 139/299 (46.49%), Postives = 196/299 (65.55%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILST-TPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN 3313
            L     L VLG+GHFGKVLL +   T    AIK+++K    +  E +SL+ E+ IL  +    +PFL++L+ CFQ+  H  F  E+V GGD M  +H+  F E  ARFY++C+VL  +FLH++ IIYRDLKLDN+L+D  G+ K+ DFGL K  + +  +T+TFCGTPEFLAPE++ ++ YTR +DWW LGVLLYEM++GE PFPGD + E+F  I++   P    LS +    I++LL++ PEKRLG G +   ++K   FF + +W  L +R + PPF+P L    D +YFE EFT 
Sbjct:  556 LQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDEIESLYCEKRILEAVGCTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFCGTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPGFLSVQGLEFIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLCGPADLRYFEGEFTG 854          
BLAST of Protein kinase N2 vs. Ensembl Celegans
Match: pkn-1 (Protein Kinase N (PKN) homolog [Source:UniProtKB/TrEMBL;Acc:G5EGE3])

HSP 1 Score: 304.294 bits (778), Expect = 1.212e-86
Identity = 149/337 (44.21%), Postives = 209/337 (62.02%), Query Frame = 2
Query: 2390 FRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASI--DWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXXXXXXX-XXLFRNFD 3388
            F S       +++  L++VLG+GHFGKV+L++   T +  A+K ++K       E +SL  E+ I  +  +  +PFL+NL GCFQ+  H+FF +EY  GGD M H+H   F E    FY +C+VL  +FLH  +IIYRD+KLDN+L+D  GY K+ DFGL K NM    KT+TFCGTPEFLAPE++ + +YTR IDWW LGVL++EM++GE PF GDD+ EIF  I+S      + LS ES ++++RLL++ PEKRLGYG      +K   FF  I  +W+KL +R++ PPF P++ +  D   F+ EFT +                   LF NFD
Sbjct:  671 FASSDGAPLTVEQFRLISVLGRGHFGKVILSQHNPTSNYYALKVLKKGDILGRDEVESLMVEKRIFEVSSRARHPFLVNLNGCFQTNEHVFFCMEYSMGGDLMRHIHDDVFDEVRGCFYAACVVLGLDFLHKHNIIYRDIKLDNLLLDREGYVKIADFGLCKENMGPFDKTSTFCGTPEFLAPEVLSDSSYTRAIDWWGLGVLIFEMLVGEPPFSGDDEEEIFDSIISEDVRYPRYLSVESIAIMRRLLRKVPEKRLGYGERDAEDIKIQRFFRHISWEWDKLLNREIRPPFQPQIRNPEDVSNFDLEFTQEKARFSAASSTRPITEADQRLFNNFD 1007          
BLAST of Protein kinase N2 vs. Ensembl Celegans
Match: pkn-1 (Protein Kinase N (PKN) homolog [Source:UniProtKB/TrEMBL;Acc:G5EGE3])

HSP 1 Score: 304.294 bits (778), Expect = 6.742e-86
Identity = 147/327 (44.95%), Postives = 207/327 (63.30%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASI--DWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXXXXXXX-XXLFRNFD 3388
            +++  L++VLG+GHFGKV+L++   T +  A+K ++K       E +SL  E+ I  +  +  +PFL+NL GCFQ+  H+FF +EY  GGD M H+H   F E    FY +C+VL  +FLH  +IIYRD+KLDN+L+D  GY K+ DFGL K NM    KT+TFCGTPEFLAPE++ + +YTR IDWW LGVL++EM++GE PF GDD+ EIF  I+S      + LS ES ++++RLL++ PEKRLGYG      +K   FF  I  +W+KL +R++ PPF P++ +  D   F+ EFT +                   LF NFD
Sbjct:  807 VEQFRLISVLGRGHFGKVILSQHNPTSNYYALKVLKKGDILGRDEVESLMVEKRIFEVSSRARHPFLVNLNGCFQTNEHVFFCMEYSMGGDLMRHIHDDVFDEVRGCFYAACVVLGLDFLHKHNIIYRDIKLDNLLLDREGYVKIADFGLCKENMGPFDKTSTFCGTPEFLAPEVLSDSSYTRAIDWWGLGVLIFEMLVGEPPFSGDDEEEIFDSIISEDVRYPRYLSVESIAIMRRLLRKVPEKRLGYGERDAEDIKIQRFFRHISWEWDKLLNREIRPPFQPQIRNPEDVSNFDLEFTQEKARFSAASSTRPITEADQRLFNNFD 1133          
BLAST of Protein kinase N2 vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 262.307 bits (669), Expect = 1.404e-74
Identity = 141/303 (46.53%), Postives = 193/303 (63.70%), Query Frame = 2
Query: 2435 LLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI---KSLSPESTSLIKRLLKRDPEKRLGYGCEG-----TRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
             LTVLG+G FGKVLL +   TK + AIK ++K     D + +    E+ +L L  K +  FL+ L  CFQ+   L+F +E+V GGD M  + +   F E  A FY + I +   FLH + IIYRDLKLDNV+++  G+ K+TDFG+ K N+  D  T TFCGTP+++APEII  + Y + +DWWA GVLL+EM+ G+ PF G+D+ E+F+ I  T  N+   KSLS E+ SL K LL ++P KRL  GC G     +R +KEH FF  IDW K+ +RQ+ PPF PKL    DT  F+SEFT++
Sbjct:  350 FLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPS--FLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAI--TEHNVSYPKSLSKEAVSLCKALLIKNPSKRL--GCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKSADDTSNFDSEFTHE 646          
BLAST of Protein kinase N2 vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 262.692 bits (670), Expect = 2.449e-74
Identity = 141/303 (46.53%), Postives = 193/303 (63.70%), Query Frame = 2
Query: 2435 LLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI---KSLSPESTSLIKRLLKRDPEKRLGYGCEG-----TRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
             LTVLG+G FGKVLL +   TK + AIK ++K     D + +    E+ +L L  K +  FL+ L  CFQ+   L+F +E+V GGD M  + +   F E  A FY + I +   FLH + IIYRDLKLDNV+++  G+ K+TDFG+ K N+  D  T TFCGTP+++APEII  + Y + +DWWA GVLL+EM+ G+ PF G+D+ E+F+ I  T  N+   KSLS E+ SL K LL ++P KRL  GC G     +R +KEH FF  IDW K+ +RQ+ PPF PKL    DT  F+SEFT++
Sbjct:  395 FLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPS--FLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAI--TEHNVSYPKSLSKEAVSLCKALLIKNPSKRL--GCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPKLKSADDTSNFDSEFTHE 691          
BLAST of Protein kinase N2 vs. Ensembl Celegans
Match: akt-2 (Serine/threonine-protein kinase akt-2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XTG7])

HSP 1 Score: 253.062 bits (645), Expect = 8.289e-73
Identity = 127/307 (41.37%), Postives = 190/307 (61.89%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIK---SLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            +D  + L VLGQG FGKV+L +   +  + AIK I+K      +E      E  +L       +PFL  L   FQ++ H+ F +E+  GG+   H+ +   F E   RFY S I+LA  +LH ++I+YRD+KL+N+L+D  G+ K+TDFGL K  +K+  KT+TFCGTPE+LAPE+IE+ +Y R +DWW +GV++YEM+ G  PF   ++ ++F +I  TT ++K    LSPE+ +L+  LL+R P KRLG G +  R+V    FF  +DW     +++ PPF P +   TDT +F+ EFT+ PV +
Sbjct:  177 MDDFDFLKVLGQGTFGKVILCREKSSDKLYAIKIIRKEMVVDRSEVAHTLTENRVLYACV---HPFLTLLKYSFQAQYHICFVMEFANGGELFTHLQRCKTFSEARTRFYGSEIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYLAPEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELI--TTCDLKFPNRLSPEAVTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTSFFDREFTSMPVQL 478          
BLAST of Protein kinase N2 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0088605)

HSP 1 Score: 294.664 bits (753), Expect = 9.323e-87
Identity = 146/330 (44.24%), Postives = 218/330 (66.06%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXX-XXXXXXXLFRNFDTDLQW 3403
            +D   LL+VLG+GHFGKV+L+++       AIK+++K       E +SL +E+ I  +     +PFL+NL  CFQ+E+H+ F +EY AGGD M H+H   F+E  A FY +C+VL  ++LH+  IIYRDLKLDN+L+D  GY K+ DFGL K  M +  +T TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+++PE+RLG        VK+ +FF SI W+ L  R++ PPF+P ++ + D   F+ EFT++   +    E    +E +  LF++F    +W
Sbjct:  260 MDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSYTAEW 589          
BLAST of Protein kinase N2 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0339291)

HSP 1 Score: 296.975 bits (759), Expect = 3.291e-83
Identity = 146/330 (44.24%), Postives = 218/330 (66.06%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXX-XXXXXXXLFRNFDTDLQW 3403
            +D   LL+VLG+GHFGKV+L+++       AIK+++K       E +SL +E+ I  +     +PFL+NL  CFQ+E+H+ F +EY AGGD M H+H   F+E  A FY +C+VL  ++LH+  IIYRDLKLDN+L+D  GY K+ DFGL K  M +  +T TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+++PE+RLG        VK+ +FF SI W+ L  R++ PPF+P ++ + D   F+ EFT++   +    E    +E +  LF++F    +W
Sbjct:  837 MDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSYTAEW 1166          
BLAST of Protein kinase N2 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0088601)

HSP 1 Score: 297.36 bits (760), Expect = 3.409e-83
Identity = 146/330 (44.24%), Postives = 218/330 (66.06%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXX-XXXXXXXLFRNFDTDLQW 3403
            +D   LL+VLG+GHFGKV+L+++       AIK+++K       E +SL +E+ I  +     +PFL+NL  CFQ+E+H+ F +EY AGGD M H+H   F+E  A FY +C+VL  ++LH+  IIYRDLKLDN+L+D  GY K+ DFGL K  M +  +T TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+++PE+RLG        VK+ +FF SI W+ L  R++ PPF+P ++ + D   F+ EFT++   +    E    +E +  LF++F    +W
Sbjct:  860 MDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSYTAEW 1189          
BLAST of Protein kinase N2 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0088603)

HSP 1 Score: 296.975 bits (759), Expect = 4.382e-83
Identity = 146/330 (44.24%), Postives = 218/330 (66.06%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXX-XXXXXXXLFRNFDTDLQW 3403
            +D   LL+VLG+GHFGKV+L+++       AIK+++K       E +SL +E+ I  +     +PFL+NL  CFQ+E+H+ F +EY AGGD M H+H   F+E  A FY +C+VL  ++LH+  IIYRDLKLDN+L+D  GY K+ DFGL K  M +  +T TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+++PE+RLG        VK+ +FF SI W+ L  R++ PPF+P ++ + D   F+ EFT++   +    E    +E +  LF++F    +W
Sbjct:  875 MDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSYTAEW 1204          
BLAST of Protein kinase N2 vs. Ensembl Fly
Match: Pkn (gene:FBgn0020621 transcript:FBtr0301511)

HSP 1 Score: 297.745 bits (761), Expect = 4.810e-83
Identity = 146/330 (44.24%), Postives = 218/330 (66.06%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXX-XXXXXXXLFRNFDTDLQW 3403
            +D   LL+VLG+GHFGKV+L+++       AIK+++K       E +SL +E+ I  +     +PFL+NL  CFQ+E+H+ F +EY AGGD M H+H   F+E  A FY +C+VL  ++LH+  IIYRDLKLDN+L+D  GY K+ DFGL K  M +  +T TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+++PE+RLG        VK+ +FF SI W+ L  R++ PPF+P ++ + D   F+ EFT++   +    E    +E +  LF++F    +W
Sbjct:  954 MDNFRLLSVLGRGHFGKVILSQLRSNNQYYAIKALKKGDIIARDEVESLLSEKRIFEVANAMRHPFLVNLYSCFQTEQHVCFVMEYAAGGDLMMHIHTDVFLEPRAVFYAACVVLGLQYLHENKIIYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFGDRTGTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSLEAIAVMRRLLRKNPERRLGSSERDAEDVKKQAFFRSIVWDDLLLRKVKPPFVPTINHLEDVSNFDEEFTSEKAQLTPPKEPRHLTEEEQLLFQDFSYTAEW 1283          
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 330.487 bits (846), Expect = 2.878e-96
Identity = 153/319 (47.96%), Postives = 211/319 (66.14%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++VLG+GHFGKVLLA+   T  + AIK+++K    T  E DSL  E+ I   I    +PFL+NL GCFQ+  H+ F +EY  GGD M H+H + F E  ARFY +C++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M +  +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + +SPES S+I++LL+++ EKRLG G +   +VK+H FF  IDW  L ++++ PPF+P +    D   F+ EFT  +PV          S    E F +FD
Sbjct:  598 ISVLGRGHFGKVLLAEFKRTGKLYAIKALKKGDVVTRDEVDSLMCEKRIFETINASRHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEFTRLKPVLTPPQTPFFLSAEQQEFFADFD 916          
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 330.487 bits (846), Expect = 4.160e-96
Identity = 153/319 (47.96%), Postives = 211/319 (66.14%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++VLG+GHFGKVLLA+   T  + AIK+++K    T  E DSL  E+ I   I    +PFL+NL GCFQ+  H+ F +EY  GGD M H+H + F E  ARFY +C++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M +  +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + +SPES S+I++LL+++ EKRLG G +   +VK+H FF  IDW  L ++++ PPF+P +    D   F+ EFT  +PV          S    E F +FD
Sbjct:  617 ISVLGRGHFGKVLLAEFKRTGKLYAIKALKKGDVVTRDEVDSLMCEKRIFETINASRHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEFTRLKPVLTPPQTPFFLSAEQQEFFADFD 935          
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 330.487 bits (846), Expect = 4.160e-96
Identity = 153/319 (47.96%), Postives = 211/319 (66.14%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++VLG+GHFGKVLLA+   T  + AIK+++K    T  E DSL  E+ I   I    +PFL+NL GCFQ+  H+ F +EY  GGD M H+H + F E  ARFY +C++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M +  +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + +SPES S+I++LL+++ EKRLG G +   +VK+H FF  IDW  L ++++ PPF+P +    D   F+ EFT  +PV          S    E F +FD
Sbjct:  617 ISVLGRGHFGKVLLAEFKRTGKLYAIKALKKGDVVTRDEVDSLMCEKRIFETINASRHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEFTRLKPVLTPPQTPFFLSAEQQEFFADFD 935          
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Match: BX321890.2 (protein kinase N3 [Source:NCBI gene;Acc:323182])

HSP 1 Score: 330.102 bits (845), Expect = 4.592e-96
Identity = 153/319 (47.96%), Postives = 211/319 (66.14%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++VLG+GHFGKVLLA+   T  + AIK+++K    T  E DSL  E+ I   I    +PFL+NL GCFQ+  H+ F +EY  GGD M H+H + F E  ARFY +C++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M +  +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + +SPES S+I++LL+++ EKRLG G +   +VK+H FF  IDW  L ++++ PPF+P +    D   F+ EFT  +PV          S    E F +FD
Sbjct:  617 ISVLGRGHFGKVLLAEFKRTGKLYAIKALKKGDVVTRDEVDSLMCEKRIFETINASRHPFLVNLYGCFQTPDHVCFVMEYSPGGDLMTHIHNNIFSERQARFYSACVLLGLEFLHQNRIVYRDLKLDNLLMDSDGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSNYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFMSPESVSVIQKLLQKNSEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPSIKTAADVSNFDEEFTRLKPVLTPPQTPFFLSAEQQEFFADFD 935          
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Match: PKN2 (zgc:153916 [Source:NCBI gene;Acc:567134])

HSP 1 Score: 303.908 bits (777), Expect = 1.309e-86
Identity = 150/330 (45.45%), Postives = 214/330 (64.85%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            L   + + VLG+GHFGKVLLA    T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  + FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      K LS E+ S+++RLL+R+PE+RLG G     +VK H FF  +DW  L ++++ PPF+P +    D   F+ EFT++ P+     +  + +  + +LF +FD    W
Sbjct:  634 LSDFKCVAVLGRGHFGKVLLADYKTTGEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHADVFSETRSVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFKDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPKYLSTEAISIMRRLLRRNPERRLGAGERDAEEVKRHPFFRDMDWPGLLAKKIRPPFVPTITSREDVSNFDDEFTSEAPILTPPREPRILTLGEQDLFADFDYIADW 963          
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Match: jph3 (junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974])

HSP 1 Score: 314.694 bits (805), Expect = 4.770e-91
Identity = 141/304 (46.38%), Postives = 205/304 (67.43%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            +D    ++VLG+GHFGKVLL +  ET    AIK+++K    +  E +SL  E+ I   +    +PFL+NL GCFQ++ H  F +EY+ GGD M H+H + F E  ARFY +C+VL  +FLH++ IIYRDLKLDN+LMD  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YT  +DWW LGVL++EM++GE PFPGDD+ E+F  I++      + LS ++ ++I++LL++ PE+RLG G     ++K   FF  IDW+ LY++Q+ PP +P L D  D + F+ EFT Q   +
Sbjct:  520 VDDFTFISVLGRGHFGKVLLGQFKETGKNFAIKALKKRDIVSRDELESLQCEKRIFEAVNSSGHPFLVNLFGCFQTQGHACFVMEYMPGGDLMMHIHSNVFSEPTARFYSACVVLGLQFLHEKKIIYRDLKLDNLLMDASGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTYAVDWWGLGVLIFEMLVGECPFPGDDEEEVFDSIVNEEVRYPRFLSNDAINIIRKLLRKSPERRLGAGVGDAEEIKPQLFFQEIDWDALYAQQVKPPVVPILSDPFDIRNFDEEFTGQKAIL 823          
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Match: jph3 (junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974])

HSP 1 Score: 314.309 bits (804), Expect = 7.205e-91
Identity = 141/304 (46.38%), Postives = 205/304 (67.43%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            +D    ++VLG+GHFGKVLL +  ET    AIK+++K    +  E +SL  E+ I   +    +PFL+NL GCFQ++ H  F +EY+ GGD M H+H + F E  ARFY +C+VL  +FLH++ IIYRDLKLDN+LMD  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YT  +DWW LGVL++EM++GE PFPGDD+ E+F  I++      + LS ++ ++I++LL++ PE+RLG G     ++K   FF  IDW+ LY++Q+ PP +P L D  D + F+ EFT Q   +
Sbjct:  532 VDDFTFISVLGRGHFGKVLLGQFKETGKNFAIKALKKRDIVSRDELESLQCEKRIFEAVNSSGHPFLVNLFGCFQTQGHACFVMEYMPGGDLMMHIHSNVFSEPTARFYSACVVLGLQFLHEKKIIYRDLKLDNLLMDASGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTYAVDWWGLGVLIFEMLVGECPFPGDDEEEVFDSIVNEEVRYPRFLSNDAINIIRKLLRKSPERRLGAGVGDAEEIKPQLFFQEIDWDALYAQQVKPPVVPILSDPFDIRNFDEEFTGQKAIL 835          
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Match: jph3 (junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974])

HSP 1 Score: 313.923 bits (803), Expect = 9.792e-91
Identity = 141/304 (46.38%), Postives = 205/304 (67.43%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            +D    ++VLG+GHFGKVLL +  ET    AIK+++K    +  E +SL  E+ I   +    +PFL+NL GCFQ++ H  F +EY+ GGD M H+H + F E  ARFY +C+VL  +FLH++ IIYRDLKLDN+LMD  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YT  +DWW LGVL++EM++GE PFPGDD+ E+F  I++      + LS ++ ++I++LL++ PE+RLG G     ++K   FF  IDW+ LY++Q+ PP +P L D  D + F+ EFT Q   +
Sbjct:  526 VDDFTFISVLGRGHFGKVLLGQFKETGKNFAIKALKKRDIVSRDELESLQCEKRIFEAVNSSGHPFLVNLFGCFQTQGHACFVMEYMPGGDLMMHIHSNVFSEPTARFYSACVVLGLQFLHEKKIIYRDLKLDNLLMDASGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTYAVDWWGLGVLIFEMLVGECPFPGDDEEEVFDSIVNEEVRYPRFLSNDAINIIRKLLRKSPERRLGAGVGDAEEIKPQLFFQEIDWDALYAQQVKPPVVPILSDPFDIRNFDEEFTGQKAIL 829          
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Match: jph3 (junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974])

HSP 1 Score: 314.309 bits (804), Expect = 1.355e-90
Identity = 141/304 (46.38%), Postives = 205/304 (67.43%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            +D    ++VLG+GHFGKVLL +  ET    AIK+++K    +  E +SL  E+ I   +    +PFL+NL GCFQ++ H  F +EY+ GGD M H+H + F E  ARFY +C+VL  +FLH++ IIYRDLKLDN+LMD  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YT  +DWW LGVL++EM++GE PFPGDD+ E+F  I++      + LS ++ ++I++LL++ PE+RLG G     ++K   FF  IDW+ LY++Q+ PP +P L D  D + F+ EFT Q   +
Sbjct:  560 VDDFTFISVLGRGHFGKVLLGQFKETGKNFAIKALKKRDIVSRDELESLQCEKRIFEAVNSSGHPFLVNLFGCFQTQGHACFVMEYMPGGDLMMHIHSNVFSEPTARFYSACVVLGLQFLHEKKIIYRDLKLDNLLMDASGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTYAVDWWGLGVLIFEMLVGECPFPGDDEEEVFDSIVNEEVRYPRFLSNDAINIIRKLLRKSPERRLGAGVGDAEEIKPQLFFQEIDWDALYAQQVKPPVVPILSDPFDIRNFDEEFTGQKAIL 863          
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Match: jph3 (junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974])

HSP 1 Score: 313.538 bits (802), Expect = 1.457e-90
Identity = 141/300 (47.00%), Postives = 204/300 (68.00%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            +D    ++VLG+GHFGKVLL +  ET    AIK+++K    +  E +SL  E+ I   +    +PFL+NL GCFQ++ H  F +EY+ GGD M H+H + F E  ARFY +C+VL  +FLH++ IIYRDLKLDN+LMD  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YT  +DWW LGVL++EM++GE PFPGDD+ E+F  I++      + LS ++ ++I++LL++ PE+RLG G     ++K   FF  IDW+ LY++Q+ PP +P L D  D + F+ EFT Q
Sbjct:  542 VDDFTFISVLGRGHFGKVLLGQFKETGKNFAIKALKKRDIVSRDELESLQCEKRIFEAVNSSGHPFLVNLFGCFQTQGHACFVMEYMPGGDLMMHIHSNVFSEPTARFYSACVVLGLQFLHEKKIIYRDLKLDNLLMDASGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTYAVDWWGLGVLIFEMLVGECPFPGDDEEEVFDSIVNEEVRYPRFLSNDAINIIRKLLRKSPERRLGAGVGDAEEIKPQLFFQEIDWDALYAQQVKPPVVPILSDPFDIRNFDEEFTGQ 841          
BLAST of Protein kinase N2 vs. Ensembl Mouse
Match: Pkn1 (protein kinase N1 [Source:MGI Symbol;Acc:MGI:108022])

HSP 1 Score: 304.294 bits (778), Expect = 8.952e-87
Identity = 150/325 (46.15%), Postives = 212/325 (65.23%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXX-XXXXXXXXXXLFRNFD 3388
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  + +  +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF S+ W+ L +R+L PPF+P L   TD   F+ EFT +  T+         +  +   FR+FD
Sbjct:  616 LEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFD 940          
BLAST of Protein kinase N2 vs. Ensembl Mouse
Match: Pkn1 (protein kinase N1 [Source:MGI Symbol;Acc:MGI:108022])

HSP 1 Score: 304.294 bits (778), Expect = 9.811e-87
Identity = 150/325 (46.15%), Postives = 212/325 (65.23%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXX-XXXXXXXXXXLFRNFD 3388
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  + +  +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF S+ W+ L +R+L PPF+P L   TD   F+ EFT +  T+         +  +   FR+FD
Sbjct:  621 LEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFD 945          
BLAST of Protein kinase N2 vs. Ensembl Mouse
Match: Pkn2 (protein kinase N2 [Source:MGI Symbol;Acc:MGI:109211])

HSP 1 Score: 301.212 bits (770), Expect = 8.940e-86
Identity = 148/323 (45.82%), Postives = 212/323 (65.63%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG G +    VK+H FF   DW+ L  +++ PPF+P +    D   F+ EFT++ P+     +  +  E + E+F +FD    W
Sbjct:  612 AVLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPREPRILLEEEQEMFHDFDYVADW 934          
BLAST of Protein kinase N2 vs. Ensembl Mouse
Match: Pkn2 (protein kinase N2 [Source:MGI Symbol;Acc:MGI:109211])

HSP 1 Score: 300.442 bits (768), Expect = 3.278e-85
Identity = 148/323 (45.82%), Postives = 212/323 (65.63%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG G +    VK+H FF   DW+ L  +++ PPF+P +    D   F+ EFT++ P+     +  +  E + E+F +FD    W
Sbjct:  660 AVLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPREPRILLEEEQEMFHDFDYVADW 982          
BLAST of Protein kinase N2 vs. Ensembl Mouse
Match: Pkn2 (protein kinase N2 [Source:MGI Symbol;Acc:MGI:109211])

HSP 1 Score: 300.056 bits (767), Expect = 3.329e-85
Identity = 148/323 (45.82%), Postives = 212/323 (65.63%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG G +    VK+H FF   DW+ L  +++ PPF+P +    D   F+ EFT++ P+     +  +  E + E+F +FD    W
Sbjct:  644 AVLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGREDVSNFDDEFTSEAPILTPPREPRILLEEEQEMFHDFDYVADW 966          
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Match: sp|Q63433|PKN1_RAT (Serine/threonine-protein kinase N1 OS=Rattus norvegicus OX=10116 GN=Pkn1 PE=1 SV=2)

HSP 1 Score: 306.605 bits (784), Expect = 9.611e-87
Identity = 150/325 (46.15%), Postives = 213/325 (65.54%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXX-XXXXXXXXXXLFRNFD 3388
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  + +  +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF ++DW+ L +R+L PPF+P L   TD   F+ EFT +  T+         +  +   FR+FD
Sbjct:  616 LEDFKFLAVLGRGHFGKVLLSEFHSSGELFAIKALKKGDIVARDEVESLMCEKRILATVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRTLDWDALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFD 940          
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Match: sp|P70268|PKN1_MOUSE (Serine/threonine-protein kinase N1 OS=Mus musculus OX=10090 GN=Pkn1 PE=1 SV=3)

HSP 1 Score: 304.294 bits (778), Expect = 6.262e-86
Identity = 150/325 (46.15%), Postives = 212/325 (65.23%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXX-XXXXXXXXXXLFRNFD 3388
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  + +  +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF S+ W+ L +R+L PPF+P L   TD   F+ EFT +  T+         +  +   FR+FD
Sbjct:  616 LEDFKFLAVLGRGHFGKVLLSEFRSSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTRAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSTERDAEDVKKQPFFRSLGWDVLLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAAEQAAFRDFD 940          
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Match: sp|A7MBL8|PKN2_DANRE (Serine/threonine-protein kinase N2 OS=Danio rerio OX=7955 GN=pkn2 PE=2 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 8.317e-86
Identity = 150/330 (45.45%), Postives = 214/330 (64.85%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            L   + + VLG+GHFGKVLLA    T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  + FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      K LS E+ S+++RLL+R+PE+RLG G     +VK H FF  +DW  L ++++ PPF+P +    D   F+ EFT++ P+     +  + +  + +LF +FD    W
Sbjct:  647 LSDFKCVAVLGRGHFGKVLLADYKTTGEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHADVFSETRSVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFKDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPKYLSTEAISIMRRLLRRNPERRLGAGERDAEEVKRHPFFRDMDWPGLLAKKIRPPFVPTITSREDVSNFDDEFTSEAPILTPPREPRILTLGEQDLFADFDYIADW 976          
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Match: sp|A1A4I4|PKN1_BOVIN (Serine/threonine-protein kinase N1 OS=Bos taurus OX=9913 GN=PKN1 PE=2 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.538e-85
Identity = 149/325 (45.85%), Postives = 211/325 (64.92%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXX-XXXXXXXXXXLFRNFD 3388
            L+  + L VLG+GHFGKVLL++   +  + AIK+++K       E +SL  E+ IL  +    +PFL+NL GCFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVLLYEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG        VK+  FF ++ W+ L +R+L PPF+P L   TD   F+ EFT +  T+         +  +   FR+FD
Sbjct:  614 LEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTNAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVFYSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWDALLARRLPPPFVPTLAGRTDVSNFDEEFTGEAPTLSPPRDARPLTATEQAAFRDFD 938          
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Match: sp|Q16513|PKN2_HUMAN (Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2 PE=1 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 2.984e-85
Identity = 151/323 (46.75%), Postives = 214/323 (66.25%), Query Frame = 2
Query: 2441 TVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
             VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  ++LH+  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG   +    VK+H FF  IDW+ L  +++ PPFIP +    D   F+ EFT++ P+     +  + SE + E+FR+FD    W
Sbjct:  661 AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADW 983          
BLAST of Protein kinase N2 vs. TrEMBL
Match: A0A5C6NIS9 (Non-specific serine/threonine protein kinase OS=Takifugu flavidus OX=433684 GN=D4764_20G0008470 PE=3 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 5.638e-97
Identity = 158/340 (46.47%), Postives = 219/340 (64.41%), Query Frame = 2
Query: 2411 HQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSK---------PNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFDTDL 3397
            H  +D  + ++VLG+GHFGKVLLA+   +  + AIK+++K    +  E DSL  E+ I  +I    +PFL+NL GCFQ+E H+ F + Y  GGD M H+H S F E+ ARFY SC++L  EFLH   IIYRDLKLDN+LMD  G+ ++ DFGL K           M    +T+TFCGTPEFLAPE++ E NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LSP+S SLI++LL+++PE RLG G E   +VK H FF + DW+ L ++++ PPF+P +    D   F+ EFT  +PV        V +    ++F +FD  L
Sbjct:   20 HLQMDDFKCISVLGRGHFGKVLLAEFKRSGKLYAIKALKKGDIVSRDEVDSLVCEKRIFEVINASRHPFLVNLHGCFQTEEHVCFVMAYSPGGDLMTHIHTSIFTEKQARFYSSCVLLGLEFLHQNKIIYRDLKLDNLLMDADGFVRIADFGLCKEGMSHVMSCAGMGHGDRTSTFCGTPEFLAPEVLTESNYTRSVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDDVRCPRFLSPQSASLIQQLLQKNPETRLGAGEEDALQVKSHRFFQATDWDALLAKRVKPPFLPVIRSPKDVSNFDEEFTRLRPVLTLPRTACVLTPQQQQIFADFDFSL 359          
BLAST of Protein kinase N2 vs. TrEMBL
Match: A0A3Q2ZNH1 (Non-specific serine/threonine protein kinase OS=Kryptolebias marmoratus OX=37003 PE=3 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 9.298e-97
Identity = 152/309 (49.19%), Postives = 212/309 (68.61%), Query Frame = 2
Query: 2402 SVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS-LSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPV 3322
            S+    +D   L++VLG+GHFGKVLLA+  +T  + AIK+++K    T  E DSL +E+ I  +I    +PFL+NL GCFQ+  H+ F +EY+ GGD M H+H   F E   RFY +C++L  EFLH   IIYRDLKLDN+LMD  G+ K+TDFGL K  M    +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPG+D+ E+F  I++      + L P++ S++++LLKR+P KRLG G     +VK   F+ +IDW  L S++L PPF+P + ++TD   F+S+FT  QP 
Sbjct:  136 SLSRMQVDDFRLISVLGRGHFGKVLLAEFKKTGRLYAIKALKKRDIVTRDEVDSLMSEKRIFEMINASRHPFLVNLHGCFQTSDHVCFVMEYLPGGDLMIHIHSDVFSEAQTRFYSACVLLGLEFLHLNKIIYRDLKLDNLLMDADGFVKITDFGLCKEGMGHGDRTSTFCGTPEFLAPEVLTDDNYTRAVDWWGLGVLIYEMLVGESPFPGEDEEEVFDSIVNDDVQYPTNLPPDAVSIMQKLLKRNPLKRLGAGERDANEVKGEKFYETIDWEALMSKKLKPPFLPSIKELTDVSNFDSDFTRLQPA 444          
BLAST of Protein kinase N2 vs. TrEMBL
Match: A0A3Q1CAR4 (Non-specific serine/threonine protein kinase OS=Amphiprion ocellaris OX=80972 PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.049e-95
Identity = 152/325 (46.77%), Postives = 216/325 (66.46%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++  + ++VLG+GHFGKVLLA+  ++  + AIK+++K    T  E DSL  E++I  +I    +PFL+NL GCFQ+  H+ F + Y  GGD M H+H S F E+  +FY SC++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M    +T+TFCGTPEFLAPE++ + NYTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LSPES SLI++LL+++PE RLG G E   ++K   FF  IDW+ L +++L PPF+P +    D   F+ EFT  +PV        + +    E+F +FD
Sbjct:   24 MEDFKCISVLGRGHFGKVLLAEYKKSGKLYAIKALKKGDIVTRDEVDSLMCEKKIFEVINGTRHPFLVNLYGCFQTADHVCFVMAYSPGGDLMTHIHTSIFTEKQTQFYSSCVLLGLEFLHQNKIVYRDLKLDNLLMDADGFVRIADFGLCKEGMGHGDRTSTFCGTPEFLAPEVLIDNNYTRSVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDDVRYPRFLSPESVSLIQKLLQKNPEMRLGAGEEDASEIKRQKFFQEIDWDALLAKKLKPPFLPVIRAPQDVSNFDKEFTRLKPVLTLPRTPCILTAEQQEIFADFD 348          
BLAST of Protein kinase N2 vs. TrEMBL
Match: A0A1A8IK28 (Protein kinase N3 (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=PKN3 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 2.041e-95
Identity = 152/304 (50.00%), Postives = 212/304 (69.74%), Query Frame = 2
Query: 2417 VLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIK-SLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPV 3322
            ++D   L++VLG+GHFGKVLLA+  +T  + AIK+++K    T  E DSL +E+ I  +I    +PFL+NL GCFQ+  H+ F +EY+AGGD M H+H   F E   RFY +C++L  EFLH   IIYRDLKLDN+LMD  G+ K+TDFGL K  +    +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPG+D+ E+F  I++       SL P++ S++++LLK++P KRLG G    ++VK   FF  IDW  L +++L PPF+P + D TD   F+S+FT  QPV
Sbjct:  312 LMDDFRLISVLGRGHFGKVLLAEFKKTGRLYAIKALKKRDIVTRGEVDSLMSEKRIFEMINASRHPFLVNLHGCFQTSDHVCFVMEYLAGGDLMIHIHNDVFSEAQTRFYSACVLLGLEFLHLNKIIYRDLKLDNLLMDADGFVKITDFGLCKEGVGHGDQTSTFCGTPEFLAPEVLTDDSYTRAVDWWGLGVLVYEMLVGESPFPGEDEEEVFDSIVNNDVQYPTSLHPDAVSIMQKLLKKNPLKRLGAGERDAKEVKGEKFFQPIDWEALMTKKLKPPFLPSIKDSTDVSNFDSDFTQLQPV 615          
BLAST of Protein kinase N2 vs. TrEMBL
Match: A0A1A8KCJ3 (Protein kinase N3 (Fragment) OS=Nothobranchius kuhntae OX=321403 GN=PKN3 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 3.979e-95
Identity = 148/293 (50.51%), Postives = 204/293 (69.62%), Query Frame = 2
Query: 2450 GQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIK-SLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPV 3322
            G+GHFGKVLLA+  +T  + AIK+++K    T  E DSL +E+ I  +I    +PFL+NL GCFQ+  H+ F +EY+AGGD M H+H   F E   RFY +C++L  EFLH   IIYRDLKLDN+LMD  G+ K+TDFGL K  +    +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPG+D+ E+F  I++       SL P++ S++++LLK++P KRLG G    ++VK   FF  IDW  L +++L PPF+P + D TD   F+S+FT  QPV
Sbjct:    1 GRGHFGKVLLAEFKKTGRLYAIKALKKRDIVTRGEVDSLMSEKRIFEMINASRHPFLVNLHGCFQTSDHVCFVMEYLAGGDLMIHIHNDVFSEAQTRFYSACVLLGLEFLHLNKIIYRDLKLDNLLMDADGFVKITDFGLCKEGVGHGDQTSTFCGTPEFLAPEVLTDDSYTRAVDWWGLGVLVYEMLVGESPFPGEDEEEVFDSIVNNDVQYPTSLHPDAVSIMQKLLKKNPLKRLGAGERDAKEVKGEKFFQPIDWEALMTKKLKPPFLPSIKDSTDVSNFDSDFTQLQPV 293          
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Match: pkn3 (protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131-1902])

HSP 1 Score: 329.717 bits (844), Expect = 1.125e-96
Identity = 153/328 (46.65%), Postives = 214/328 (65.24%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFDTDL 3397
            ++  + ++VLG+GHFGKVLLA+   T  + AIK+++K    T  E DSL  E+ I   I   ++PFL+NL GCFQ+  H+ F +EY  GGD M H+H S F E   RFY +C++L  EFLH   I+YRDLKLDN+LMD  G+ ++ DFGL K  M +  +T+TFCGTPEFLAPE++ +  YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LSPES S+I++LL+++PEKRLG G +   +VK+H FF  IDW  L ++++ PPF+P +    D   F+ EFT  +PV                +F +FD  L
Sbjct:  534 MEDFKCISVLGRGHFGKVLLAEHKSTGKMYAIKALKKGDVVTRDEVDSLMCEKRIFETINASHHPFLVNLHGCFQTCDHVCFVMEYSPGGDLMTHIHNSIFTERQTRFYAACVLLGLEFLHQNQIVYRDLKLDNLLMDADGFVRIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDSTYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSPESVSIIQKLLQKNPEKRLGAGEQDANEVKKHRFFQGIDWEALLAKRVKPPFLPTIKTSGDVSNFDEEFTRLKPVLTPPQTPFFLGAEQQGIFADFDFSL 861          
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Match: pkn2 (serine/threonine-protein kinase N2 [Source:NCBI gene;Acc:103040528])

HSP 1 Score: 305.834 bits (782), Expect = 6.600e-88
Identity = 157/347 (45.24%), Postives = 226/347 (65.13%), Query Frame = 2
Query: 2387 TFRSRSVCHQ------VLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            TFR+ ++C        VL   + + VLG+GHFGKVLLA+   T  + AIK+++K    +  E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+PE+RLG G     +VK+H FF ++DW  L  +++ PPF+P +   +D   F+ EFT++ PV     D+   S  + E+F +FD    W
Sbjct:  534 TFRA-ALCENLYFFTPVLRDFKCVAVLGRGHFGKVLLAEYSSTGEMFAIKALKKGDIVSRDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRATFYAACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGFRDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISVMRRLLRRNPERRLGGGERDAEEVKKHLFFRNMDWTGLLGKKVKPPFVPVIQSPSDVSNFDEEFTSEAPVLTPPRDQRPLSREEQEMFTDFDYIADW 879          
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Match: zgc:153916 (serine/threonine-protein kinase N2 [Source:NCBI gene;Acc:103027669])

HSP 1 Score: 304.294 bits (778), Expect = 1.701e-87
Identity = 150/337 (44.51%), Postives = 220/337 (65.28%), Query Frame = 2
Query: 2399 RSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            + +C  + D  + + VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLH+  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R+P++RLG G     +VK+H F  ++DW  L ++++ PPF+P +    D   F+ EFT++ P+     +  V +  + ELF +FD    W
Sbjct:  537 QQLCFSIRD-FKCVAVLGRGHFGKVLLAEYRSTGEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTKEHVCFVMEYAAGGDLMMHIHADVFSEPRAVFYAACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYQDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPDRRLGAGERDAEEVKKHPFLRNVDWGALLAKKIQPPFVPTIKGREDVSNFDDEFTSEAPILTPPREPRVLTANEQELFTDFDYIADW 872          
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Match: pkn1a (protein kinase N1a [Source:ZFIN;Acc:ZDB-GENE-061207-17])

HSP 1 Score: 304.294 bits (778), Expect = 2.025e-87
Identity = 145/300 (48.33%), Postives = 204/300 (68.00%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            L    L+ VLG+GHFGKVLLA+  ++ S+ AIK+++K       E +SL  E+ I   +    +PFL+NL  CFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+R+PE+RLG G +   +VK+ SFF ++DW  L  R+L PPF+P +    D   F+ EFT +
Sbjct:  552 LQDFRLIAVLGRGHFGKVLLAEYKKSGSMYAIKALKKGDIVARDEVESLMCEKRIFETVNTSQHPFLVNLFACFQTPEHVCFVMEYTAGGDLMMHIHADVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSSEAIAIMRRLLRRNPERRLGSGEKDAEEVKKQSFFRNMDWEALLLRKLPPPFVPSIGGKEDVSNFDEEFTAE 851          
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Match: pkn1b (protein kinase N1b [Source:ZFIN;Acc:ZDB-GENE-070424-87])

HSP 1 Score: 299.671 bits (766), Expect = 4.384e-87
Identity = 151/325 (46.46%), Postives = 213/325 (65.54%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFD 3388
            L    L+ VLG+GHFGKVLL++   + ++ AIK+++K       E +SL  E+ I   +   ++PFL+NL  CFQ++ H+ F +EY AGGD M H+H   F E  + FY +C+VL  +FLHD  I+YRDLKLDN+L+D  G+ K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+ SL++RLL+R+PE+RLG        VK+  FF +IDW  L  R++VPPF+P L    D   F++EFT + P      +    S  D E FR+FD
Sbjct:  396 LQDFRLVAVLGRGHFGKVLLSEYKRSGTLYAIKALKKGDIIARDEVESLMCEKRIFETVNSSHHPFLVNLFACFQTDEHVCFVMEYTAGGDLMMHIHADVFSEPRSVFYAACVVLGLQFLHDNKIVYRDLKLDNLLLDTDGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTDSSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISLMRRLLRRNPERRLGSTERDAEDVKKQPFFRNIDWEALLQRKVVPPFVPSLGGREDVSNFDAEFTTEAPALTPPRERRTLSRKDQEWFRDFD 720          
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 1.116e-70
Identity = 123/317 (38.80%), Postives = 190/317 (59.94%), Query Frame = 2
Query: 2387 TFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEED-ARFYISCIVLAFEFLH-DQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            T  S+      ++  + L +LG+G FGKV+L +   T    A+K ++K       E      E  +L   +   +PFL  L   FQ+   L F +EYV GG+   H+ +     ED  RFY + IV A ++LH +++++YRDLKL+N+++D  G+ K+ DFGL K  +       TFCGTPE+LAPE++E+ +Y R +DWW LGV++YEM+ G  PF   D  ++F +IL       ++LS ++ +L+  LLK+DP++RLG G +  +++  HSFFA I W  +Y R++ PPF P++   TDT+YF+ EFT Q +TI
Sbjct:  136 TILSKPKSKVTMNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVL---QTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITI 449          
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 243.047 bits (619), Expect = 6.922e-70
Identity = 120/287 (41.81%), Postives = 179/287 (62.37%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVH---KSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKL 3268
            LD   LL VLG+G FGKV+LA++ E     AIK+++K       + +    E+ +L++  +H  PFL +L G FQ++ HLFF +E++ GGD M H+    K        RFY + ++   +FLH  +IIYRDLKLDNVL+D  G+ K+ DFG+ K ++      TTFCGTP+++APEI+  + Y   +DWW++GVL+YEM++G+SPF G D+ E+F  I   TP+  + LS  S +++  L +RD  KRLG        ++ H FF +IDW  L +R++ PPF PK+
Sbjct:  249 LDHFHLLKVLGKGSFGKVMLAELKEQGKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEH--PFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLG----AVGDIRLHPFFKNIDWPSLEARKITPPFKPKV 529          
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 222.246 bits (565), Expect = 7.818e-66
Identity = 113/270 (41.85%), Postives = 172/270 (63.70%), Query Frame = 2
Query: 2468 KVLLAKV-IETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVH-KSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKL 3268
            +V LA++    ++  AIK+++K       + +    E+ IL L   H  P+L +L   FQ++ HL F +EY+ GGD M H+  K  F  + A FY + IV   +FLHDQ IIYRDLKLDN+L+D  G+ K+ DFG+ K N+  D +  TFCGTP+++APEI+  + Y   +DWW+ GVLLYEM++G+SPF GDD+ E+F  I ++ P   + ++ +S  ++  LL+R+P KRLG     T ++++H FF +I+W  L  R+L PPF P++
Sbjct:    1 QVFLAELKSRPRNFFAIKALKKDVVIMSDDVECTLVEKRILSLAWGH--PYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGV----TGEIRQHPFFRTINWEALEKRELEPPFKPRV 264          
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.246 bits (565), Expect = 8.778e-64
Identity = 114/302 (37.75%), Postives = 180/302 (59.60%), Query Frame = 2
Query: 2429 LELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPEST-SLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
             + LTVLG+G FGKVLLAK        A+K ++K+      E   + AER +L+   +H  PFL+ L   FQS   L+F ++YV GG+   H+ +   F E  A+FY + I  A  +LH  +I+YRDLK +N+L+D  G+  LTDFGL K  +   + T TFCGTPE+LAPE++++  Y R +DWW LG +LYEM+ G  PF   + ++++  IL     ++  +  +  S+++ LL +DP +RLG       ++K H FF++I+WN L ++++  P+ P +    D   F+  FT +P+++
Sbjct:   92 FDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRH--PFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSM 390          
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001814.1 (pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gene:ENSPMAG00000001637.1 transcript:ENSPMAT00000001814.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 197.593 bits (501), Expect = 6.742e-57
Identity = 105/266 (39.47%), Postives = 153/266 (57.52%), Query Frame = 2
Query: 2507 CAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS-LSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFE 3298
             ++K+ ++ +     + +    E+ IL  I   + PFL+ L   F+   +L+  LEYV GG+   H+ +   F E  +RFY + IVLAFE+LH  D+IYRDLK +N+L+D  GY ++TDFG +K   +   +T T CGTPE+LAPEII  K Y + +DWWALGVL+YEM  G  PF  D   +I+  I+S      S  S +   L++ LL+ D  KR G    G   +K H +F++ DW  +Y R++  PFIPK     D   F+
Sbjct:    7 VSLKATKRTKVVKLKQVEHTLNEKRILQAI---SFPFLVRLEYSFKDNSNLYMVLEYVPGGEMFSHLRRIGRFSEPHSRFYAAQIVLAFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAK---RVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFSTTDWIAIYQRKVEAPFIPKCKGPGDASNFD 266          
BLAST of Protein kinase N2 vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 290.812 bits (743), Expect = 4.602e-82
Identity = 133/304 (43.75%), Postives = 202/304 (66.45%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIK-SLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTI 3328
            LD   LL VLG+G+FGKV+L+K   T  +CAIK ++K     + + +S  AE+++ +L  K  +PFL NL   FQ+E  ++FA+E++ GGD M HV         A+FY + ++LA ++ HD  +IYRDLKL+N+L+   G+ K+ D+GL K  M +  +T+TFCGTPEF+APEI++E+ YT+ +DWWA GVLLY+M+L +SPF GDD+ E+F+ IL+  P     ++ E   + + LL +DPEKRLG G     +V E  FF +I+++ + + ++ PP+IP++    DT YFE EFT+ P T+
Sbjct:  821 LDNFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTSAPPTL 1124          
BLAST of Protein kinase N2 vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 234.572 bits (597), Expect = 1.033e-65
Identity = 119/302 (39.40%), Postives = 182/302 (60.26%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHK-SPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI--KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            +D  +LL V+G+G FGKV+  +  +T+ V A+K+I+K+   + +E     AER +L  +   + PF++ L   FQS   L+F L ++ GG+   H+ K   F    ARFY + ++ A + LH  D++YRDLK +N+L+D  G+  L DFGL K NMK D KT TFCGTPE+LAPE++    YT+ +DWW LGVLLYEM+ G  P+  +D  +++  IL   P +       ++  L+  LL RDP +RLGY   G  +++ H FF+ + W +L  +  +PP+ P + +  DT  F+ EFT +
Sbjct:  344 IDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARV---DCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQ-EPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY--NGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTRE 639          
BLAST of Protein kinase N2 vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 235.728 bits (600), Expect = 3.435e-65
Identity = 124/312 (39.74%), Postives = 188/312 (60.26%), Query Frame = 2
Query: 2387 TFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSP-FIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPE-IIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS--LSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFT 3310
            T++     H      E+L +LG+G FG+V   K  +T+ + A+K + K       E      ER IL+     ++PF++ L   FQ+   L+   +Y++GG+   H+ K   F E+ A+FYI+ +VLA E LHD DI+YRDLK +N+L+D +G   L DFGLSK ++K   +T TFCGT E+LAPE +++E  YT+++D+W+LGVL++EM  G SPF  +++++++  I           LS E  S +K LL R+P+ RLG   +G R+++ H FFA IDW  L  +++ PPF P L   TDT  F+ EFT
Sbjct:  398 TYKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLK--DRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDG-RELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFT 706          
BLAST of Protein kinase N2 vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 231.491 bits (589), Expect = 1.053e-64
Identity = 119/303 (39.27%), Postives = 180/303 (59.41%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHV-HKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTT---PNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            +D  +LL V+G+G FGKV+  +  +T+ + A+K+++KA   +  E     AER +L  +   + PF++ L   FQS   L+  L ++ GG+   H+ H+  F    +RFYI+ ++ A + LH  D+IYRDLK +N+L+D  G+  L DFGL K NMK + KT TFCGTPE+LAPEI+  + YT+ +DWW LG+LLYEM+ G  P+  ++   ++  IL      P+     P +  L+  LL RDP +RL  G  GT +++ H FF  I W KL  +  +PP+ P +    DT  F+ EFT +
Sbjct:  341 IDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARV---DCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPD--GFDPAAKDLLIGLLSRDPSRRL--GVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKE 636          
BLAST of Protein kinase N2 vs. Ensembl Yeast
Match: KIN82 (Putative serine/threonine protein kinase; implicated in the regulation of phospholipid asymmetry through the activation of phospholipid translocases (flippases); involved in the phosphorylation of upstream inhibitory kinase Ypk1p along with Fpk1p; has a redundant role in the cellular response to mating pheromone; KIN82 has a paralog, FPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000000687])

HSP 1 Score: 206.453 bits (524), Expect = 5.327e-56
Identity = 126/324 (38.89%), Postives = 176/324 (54.32%), Query Frame = 2
Query: 2375 SFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMG--HVHKSPFI-EEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLS-------KPNMK----WDTK-------TTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTT---PNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDD 3274
            SF   F+  +V  Q  +K+ LL   GQG  GKV L +  +T  + A+K + K       +   +  E+EIL      ++PF++ L   FQ++ +L+  +EY  GG+F       KS  I EEDA+FY S +V A E+LH    IYRDLK +N+L+   G+  L+DF LS       KP MK     DTK       T +F GT E+LAPE+I    +T  +DWW LG+L+YEM+ G +PF GD+  E FS IL+     P+ K +S     LIK+LL ++  KRLG    G   +K H FF  + W+ L  R   PP IP L+D
Sbjct:  309 SFGNKFQDITVEPQSFEKIRLL---GQGDVGKVYLVRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILAT---SDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGHTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNILTKDVKFPHDKEVSKNCKDLIKKLLNKNEAKRLG-SKSGAADIKRHPFFKKVQWSFL--RNQDPPLIPALND 623          
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Match: EDO43312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ0])

HSP 1 Score: 297.745 bits (761), Expect = 3.646e-85
Identity = 143/337 (42.43%), Postives = 217/337 (64.39%), Query Frame = 2
Query: 2402 SVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPE-IIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            +  H  +     ++VLG+GHFGKV+LA+   T  + AIK+++K       E +SL AE+ I +   K  +PFL+NL  CFQ++ H+ F +EY  GGD M H+H   F E    FY +C+VL  ++LHD +I+YRDLKLDN+L+D  GY K+ DFGL K +M +  +T TFCGTPEFLAPE ++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ ++++RLL+R+PE+RLG   +   +VK+  FF  + W+ L +R++ PPF+P++    D   F+ EFT+ +P+     +    +  +  LF +F+    W
Sbjct:  603 NTSHMSMSNFRCISVLGRGHFGKVILAEYRNTNELFAIKALKKGDIIAREEVESLLAEKRIFLTANKTRHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMHIHADVFAESRTVFYTACVVLGLQYLHDHEIVYRDLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEMLVTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIAIMRRLLRRNPERRLGAAEKDAEEVKKQPFFRDMRWDDLLARKIRPPFVPQVKHAEDVSNFDEEFTSEEPILTPPKEARSLNPDEQGLFADFNYTADW 939          
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 253.447 bits (646), Expect = 1.604e-71
Identity = 137/312 (43.91%), Postives = 192/312 (61.54%), Query Frame = 2
Query: 2393 RSRSVCHQV-LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKS-PFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS-LSPESTSLIKRLLKRDPEKRLGYGCEGTR-KVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            R R V  ++ L     + VLG+G FGKVLLA+   T  V AIK ++K     D + +    ER +L L   H  PFL +L   FQ+   LFF +EYV GGD M  + KS  F E  +RFY + +VLA +FLH   +IYRDLKLDNVL+D  G+ KL DFG+ K NM     TTTFCGTP+++APEI++E+ Y   +DWWALGVL+YEM+ G+ PF  +++ ++F  IL         LS E+ S++K  + ++  KRLG     T   ++EH+FF  I++ KL +RQ+ PPF PK+   TD   F+++FT +
Sbjct:  370 RRRHVLRKMTLKDFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGH--PFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKE 679          
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 243.817 bits (621), Expect = 1.522e-69
Identity = 125/313 (39.94%), Postives = 196/313 (62.62%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEED-ARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPF--------PGDDDRE-IFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLG-YGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPV 3322
            ++   L+ V+G+G + KV+L ++ +TK + A+K ++K     D + D +  E+ +    +  N+PFL+ L  CFQ+   LFF +EYV+GGD M H+ +   + ED ARFY + I  A  FLH++ +IYRDLKLDNVL+D  G+ KLTD+G+ K  ++    T+TFCGTP ++APEI+  ++Y   +DWWALGVLLYEM+ G SPF        P  +  + +F +IL     I +SLS ++ S++K  L ++P +RLG +   G   +  H+FF ++ W +L +RQ+ PPF P+ +D    + F+ +FTN+ V
Sbjct:  219 VNDFNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFE--QASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDV 529          
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Match: EDO31895 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWM6])

HSP 1 Score: 239.965 bits (611), Expect = 6.048e-68
Identity = 121/302 (40.07%), Postives = 190/302 (62.91%), Query Frame = 2
Query: 2426 KLELLTVLGQGHFGKVLLAKVI---ETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKS-PFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS-LSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            + ELL VLGQG FGKV L + +   +  ++ A+K ++KA         ++  ER+IL+ ++   +PF++ L   FQ+E  ++  L+++ GGD    + K   F EED +FY++ + LA + LH   IIYRDLK +N+L+D  G+  LTDFGLSK + + D KT +FCGT E++APE++  + +++  DWW+ GVL++EM+ G  PF G D ++  +MIL     +   L+PE+ SL+++L KR+P  RLG G  G   +K+H FF++I+W  LY R++ PPF P      D  YF+ EFT++
Sbjct:    8 QFELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVLKKATLKVRDRMRTM-KERDILVDVQ---HPFIVRLNYAFQTEGKVYLILDFLRGGDLFTRLSKEIMFTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDASGHVALTDFGLSKES-EHDQKTYSFCGTVEYMAPEVVNRRGHSQAADWWSYGVLMFEMLTGSLPFQGKDRKDTMNMILKAKLGMPQFLTPEAQSLLRQLFKRNPLNRLGAGDLGIEDIKKHPFFSTINWELLYKREIKPPFKPAAGRADDAFYFDPEFTSK 304          

HSP 2 Score: 89.3521 bits (220), Expect = 3.914e-18
Identity = 59/220 (26.82%), Postives = 109/220 (49.55%), Query Frame = 2
Query: 2387 TFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFI-EEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVL-MDIHGYA---KLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPF 3031
             F  R+ C  +LD+ E+   +G+G +              C  K+  K  A    E        E+ IL+R  ++P +++L   +++ + ++  +E + GG+ +  + K   + E +A   +  +     FLH++ +++RDLK  N++  D  G     ++ DFG +K     +    T C T  F+APE+++++ Y    D W+LGVLLY M+ G +PF
Sbjct:  344 AFPIRTTC--ILDEYEIKEEIGKGAYSSC---------RRCVNKADGKEYAVKIFEKPKKDPSEEMEILLRFGHHPNIVHLRDAYEAGKQVYIVMELMRGGELLDRILKHKCLSEREAGNIMYTLTSTIAFLHEEGVVHRDLKPSNIMYADDSGTPESLRIVDFGFAKQMRATNGLLMTPCYTANFVAPEVLKKQGYDAACDIWSLGVLLYTMLSGLTPF 552          
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 230.335 bits (586), Expect = 1.754e-66
Identity = 117/298 (39.26%), Postives = 177/298 (59.40%), Query Frame = 2
Query: 2435 LLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEED-ARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKS-LSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPV 3322
             L V+G+G FGKV L+K  +     AIK + K+      E   + AER +L+    H  PFL+ L   FQ++  L+F L+YV GG+   H+ +  +  E  ARFY + I  A  +LH   IIYRDLK +N+L+D  G+  LTDFGL K  +     T+TFCGTPE+LAPE++ +++Y + +DWW LG +LYEM+ G  PF   D  E++  IL     +++ +S  +  +++ LL++D  KRLG G      ++ HSFF SI+W +L +R + PP+ P +    D ++F+ EF  +PV
Sbjct:   76 FLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTH--PFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPV 371          
BLAST of Protein kinase N2 vs. Ensembl Medaka
Match: pkn3 (serine/threonine-protein kinase N2 [Source:NCBI gene;Acc:101157143])

HSP 1 Score: 315.849 bits (808), Expect = 3.766e-91
Identity = 152/325 (46.77%), Postives = 208/325 (64.00%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTN-QPVTIXXXXXXXXXXXXXXLFRNFD 3388
            ++  + L+VLG+GHFGKVLLA+  ++  + AIK+++K    T  E DSL  E+ I   I K  +PFL+NL GCFQ+  H+ F + Y +GGD M H+H   F      FY SC++L  EFLH   I+YRDLKLDN+LMD  G+ K+ DFGL K  M    +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM+LGE PFPGDD+ EIF  I++       SLS E+ SLI++LL++DP  RLG G E   ++K H FF  ++W+ L +++L PPF P +    D   F+ EFT  +PV          +    ELF +FD
Sbjct:  599 MEDFQCLSVLGRGHFGKVLLAEYKKSGKLYAIKALKKGEIVTRDEIDSLMCEKRIFEAINKAQHPFLVNLHGCFQTADHVCFVMAYSSGGDLMKHIHNHIFNRNQTLFYSSCVLLGLEFLHQNKIVYRDLKLDNLLMDAEGFVKIADFGLCKEGMGHGDRTSTFCGTPEFLAPEVLIDNSYTRCVDWWELGVLIYEMLLGECPFPGDDEEEIFDSIVNEEVRCPASLSKEAQSLIQQLLQKDPTLRLGAGEEDASEIKRHPFFQGMNWDALLAKKLKPPFQPVIRAPQDVSNFDEEFTQLKPVLTLPRTPCPLTSEQQELFADFD 923          
BLAST of Protein kinase N2 vs. Ensembl Medaka
Match: pkn2 (protein kinase N2 [Source:NCBI gene;Acc:101158798])

HSP 1 Score: 310.457 bits (794), Expect = 8.078e-89
Identity = 151/330 (45.76%), Postives = 215/330 (65.15%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ-PVTIXXXXXXXXXXXXXXLFRNFDTDLQW 3403
            L     + VLG+GHFGKVLLA+   T  + AIK+++K       E DSL  E+ I   +    +PFL+NL  CFQ+  H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ E +YTR +DWW LGVL++EM++GESPFPGDD+ E+F  I++      + LS E+ S+++RLL+R PE+RLG G +   +VK+H FF ++DW  L ++++ PPF+P + D  D   F+ EFT++ P+     +  + +  +  LF +FD    W
Sbjct:  645 LQDFRCVAVLGRGHFGKVLLAEYKSTGEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVNLFACFQTPEHVCFVMEYAAGGDLMMHIHADVFSEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYRDRTSTFCGTPEFLAPEVLTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRSPERRLGAGEKDAEEVKKHPFFRNMDWGGLLAKKVKPPFVPTIQDANDVSNFDEEFTSEAPILTPPREPRMLNSEEQGLFSDFDYIADW 974          
BLAST of Protein kinase N2 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 303.523 bits (776), Expect = 3.481e-88
Identity = 144/297 (48.48%), Postives = 203/297 (68.35%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 3307
            L    L+ VLG+GHFGKVLL++  +T ++ AIK+++K       E DSL  E+ I  ++   ++PFLINL  CFQ+ +H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG G +   +VK+  FF S+DW  L  R++ PPF+P +    D   F+ EF
Sbjct:  429 LQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSIRGKEDVSNFDEEF 725          
BLAST of Protein kinase N2 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 305.064 bits (780), Expect = 1.012e-87
Identity = 144/297 (48.48%), Postives = 203/297 (68.35%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 3307
            L    L+ VLG+GHFGKVLL++  +T ++ AIK+++K       E DSL  E+ I  ++   ++PFLINL  CFQ+ +H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG G +   +VK+  FF S+DW  L  R++ PPF+P +    D   F+ EF
Sbjct:  547 LQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSIRGKEDVSNFDEEF 843          
BLAST of Protein kinase N2 vs. Ensembl Medaka
Match: pkn1a (protein kinase N1 [Source:NCBI gene;Acc:101164700])

HSP 1 Score: 305.064 bits (780), Expect = 2.495e-87
Identity = 144/297 (48.48%), Postives = 203/297 (68.35%), Query Frame = 2
Query: 2420 LDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEF 3307
            L    L+ VLG+GHFGKVLL++  +T ++ AIK+++K       E DSL  E+ I  ++   ++PFLINL  CFQ+ +H+ F +EY AGGD M H+H   F E  A FY +C+VL  +FLHD  I+YRDLKLDN+L+D  GY K+ DFGL K  M +  +T+TFCGTPEFLAPE++ + +YTR +DWW LGVL+YEM++GESPFPGDD+ E+F  I++      + LS E+  +++RLL+R+PE+RLG G +   +VK+  FF S+DW  L  R++ PPF+P +    D   F+ EF
Sbjct:  602 LQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIIARDEVDSLMCEKRIFEIVNMSHHPFLINLFACFQTSQHVCFVMEYTAGGDLMMHIHTDVFTEPRAVFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRSVDWEALLQRKVPPPFVPSIRGKEDVSNFDEEF 898          
BLAST of Protein kinase N2 vs. Planmine SMEST
Match: SMESG000014536.1 (SMESG000014536.1)

HSP 1 Score: 1981.84 bits (5133), Expect = 0.000e+0
Identity = 1027/1073 (95.71%), Postives = 1028/1073 (95.81%), Query Frame = 2
Query:  281 MYFLFNRIHIESAYISSLNKSFVYGLKIKSNKKDNEKLNNLRLYSVEKKKLFAVSLKLLLQENLCMNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYNTK---------------TKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHXXXXXXXXXXXXIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENKISGLCRMVRRFVIKSFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS----------------ASTHSKHCNNISQASTKTNQTADKCVHHDWXXXXXXXXXXLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANXXXXXXXXXXXXXXXXXNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXXXXXXXXXLFRNFDTDLQWQ 3406
            MYFLFNRIHIESAYISSLNKSFVYGLKIKSNKKDNEKLNNLRLYSVEKKKLFAVSLKLLLQENLCMNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYN+K               TKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHLVAVAVVSLQALIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENK              SFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS                ASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ
Sbjct:    1 MYFLFNRIHIESAYISSLNKSFVYGLKIKSNKKDNEKLNNLRLYSVEKKKLFAVSLKLLLQENLCMNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYNSKDCLNVFHRNLNYPAKTKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHLVAVAVVSLQALIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENK--------------SFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMISVTTVSLCAIELIFTVQASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ 1059          
BLAST of Protein kinase N2 vs. Planmine SMEST
Match: SMESG000014533.1 (SMESG000014533.1)

HSP 1 Score: 1853.57 bits (4800), Expect = 0.000e+0
Identity = 962/1008 (95.44%), Postives = 963/1008 (95.54%), Query Frame = 2
Query:  476 MNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYNTK---------------TKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHXXXXXXXXXXXXIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENKISGLCRMVRRFVIKSFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS----------------ASTHSKHCNNISQASTKTNQTADKCVHHDWXXXXXXXXXXLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANXXXXXXXXXXXXXXXXXNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXXXXXXXXXLFRNFDTDLQWQ 3406
            MNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYN+K               TKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHLVAVAVVSLQALIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENK              SFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS                ASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ
Sbjct:    1 MNTAGMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFCRLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFKSEYNSKDCLNVFHRNLNYPAKTKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWEDPKEIGETKHLVAVAVVSLQALIENKHHSNSINISMEPDGFMTGLVKYTPIKRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSLWLDWFQNHVDRLAIPVDSNRNEPEQKENK--------------SFGLNNKKLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMISVTTVSLCAIELIFTVQASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ 994          
BLAST of Protein kinase N2 vs. Planmine SMEST
Match: SMESG000014536.1 (SMESG000014536.1)

HSP 1 Score: 1237.25 bits (3200), Expect = 0.000e+0
Identity = 646/662 (97.58%), Postives = 646/662 (97.58%), Query Frame = 2
Query: 1469 MPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS----------------ASTHSKHCNNISQASTKTNQTADKCVHHDWXXXXXXXXXXLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANXXXXXXXXXXXXXXXXXNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIXXXXXXXXXXXXXXLFRNFDTDLQWQ 3406
            MPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMIS                ASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ
Sbjct:    1 MPNRVPKTPKFNQTNPRAICKFNHPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKKNKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVTRSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSILQSPFPLDSQYDFIPNSCRSVSRSMISVTTVSLCAIELIFTVQASTHSKHCNNISQASTKTNQTADKCVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDGHGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLELLTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHDDEEVDSEFDDELFRNFDTDLQWQ 662          
BLAST of Protein kinase N2 vs. Planmine SMEST
Match: SMESG000065035.1 (SMESG000065035.1)

HSP 1 Score: 285.034 bits (728), Expect = 1.249e-80
Identity = 140/294 (47.62%), Postives = 198/294 (67.35%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            ++VLG+GHFGKVLLA+        AIK+++KA      E ++L +E+ I   I +  +PFL+NL+ CFQS  H+ F +EY  GGD M H+    F E  A FY  CIVL  +FLH + I+YRDLKLDN+L+D  GY K+ DFGL K NM    +T+TFCGTPEFLAPE++ E++YTR +DWW LGVL+YEM++GE PFPGD++ EIF  I++      + LS E+T +++RL++R PE RLG        VK+  FF S++++ L ++++ P F+PKL +  D   F+SEFT +
Sbjct:  574 ISVLGRGHFGKVLLAQYKSNGKYYAIKALKKAEILARNELETLTSEKRIFQTITESKHPFLVNLLSCFQSTEHVLFVMEYARGGDLMMHIQTDIFEEPRAVFYAGCIVLGIDFLHSKKIVYRDLKLDNLLLDEQGYVKMADFGLCKENMGHGDRTSTFCGTPEFLAPEVLVERDYTRSVDWWGLGVLIYEMLVGECPFPGDNEEEIFDSIVNHEIRYPRHLSMEATLIMRRLMRRTPENRLGASARDAEDVKKQPFFRSLNFDDLLAKRVKPTFVPKLANEEDVSNFDSEFTQE 867          
BLAST of Protein kinase N2 vs. Planmine SMEST
Match: SMESG000065035.1 (SMESG000065035.1)

HSP 1 Score: 284.648 bits (727), Expect = 1.255e-80
Identity = 140/294 (47.62%), Postives = 198/294 (67.35%), Query Frame = 2
Query: 2438 LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREILILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDARFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMKWDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPGDDDREIFSMILSTTPNI-KSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKVKEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQ 3316
            ++VLG+GHFGKVLLA+        AIK+++KA      E ++L +E+ I   I +  +PFL+NL+ CFQS  H+ F +EY  GGD M H+    F E  A FY  CIVL  +FLH + I+YRDLKLDN+L+D  GY K+ DFGL K NM    +T+TFCGTPEFLAPE++ E++YTR +DWW LGVL+YEM++GE PFPGD++ EIF  I++      + LS E+T +++RL++R PE RLG        VK+  FF S++++ L ++++ P F+PKL +  D   F+SEFT +
Sbjct:  559 ISVLGRGHFGKVLLAQYKSNGKYYAIKALKKAEILARNELETLTSEKRIFQTITESKHPFLVNLLSCFQSTEHVLFVMEYARGGDLMMHIQTDIFEEPRAVFYAGCIVLGIDFLHSKKIVYRDLKLDNLLLDEQGYVKMADFGLCKENMGHGDRTSTFCGTPEFLAPEVLVERDYTRSVDWWGLGVLIYEMLVGECPFPGDNEEEIFDSIVNHEIRYPRHLSMEATLIMRRLMRRTPENRLGASARDAEDVKKQPFFRSLNFDDLLAKRVKPTFVPKLANEEDVSNFDSEFTQE 852          
The following BLAST results are available for this feature:
BLAST of Protein kinase N2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PKN21.795e-8646.75protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN26.214e-8646.75protein kinase N2 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN18.490e-8647.70protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN11.062e-8547.70protein kinase N1 [Source:HGNC Symbol;Acc:HGNC:940... [more]
PKN32.952e-8046.49protein kinase N3 [Source:HGNC Symbol;Acc:HGNC:179... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn-11.212e-8644.21Protein Kinase N (PKN) homolog [Source:UniProtKB/... [more]
pkn-16.742e-8644.95Protein Kinase N (PKN) homolog [Source:UniProtKB/... [more]
pkc-21.404e-7446.53Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-22.449e-7446.53Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
akt-28.289e-7341.37Serine/threonine-protein kinase akt-2 [Source:Uni... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkn9.323e-8744.24gene:FBgn0020621 transcript:FBtr0088605[more]
Pkn3.291e-8344.24gene:FBgn0020621 transcript:FBtr0339291[more]
Pkn3.409e-8344.24gene:FBgn0020621 transcript:FBtr0088601[more]
Pkn4.382e-8344.24gene:FBgn0020621 transcript:FBtr0088603[more]
Pkn4.810e-8344.24gene:FBgn0020621 transcript:FBtr0301511[more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn32.878e-9647.96protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn34.160e-9647.96protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn34.160e-9647.96protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
BX321890.24.592e-9647.96protein kinase N3 [Source:NCBI gene;Acc:323182][more]
PKN21.309e-8645.45zgc:153916 [Source:NCBI gene;Acc:567134][more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jph34.770e-9146.38junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974][more]
jph37.205e-9146.38junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974][more]
jph39.792e-9146.38junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974][more]
jph31.355e-9046.38junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974][more]
jph31.457e-9047.00junctophilin 3 [Source:Xenbase;Acc:XB-GENE-987974][more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkn18.952e-8746.15protein kinase N1 [Source:MGI Symbol;Acc:MGI:10802... [more]
Pkn19.811e-8746.15protein kinase N1 [Source:MGI Symbol;Acc:MGI:10802... [more]
Pkn28.940e-8645.82protein kinase N2 [Source:MGI Symbol;Acc:MGI:10921... [more]
Pkn23.278e-8545.82protein kinase N2 [Source:MGI Symbol;Acc:MGI:10921... [more]
Pkn23.329e-8545.82protein kinase N2 [Source:MGI Symbol;Acc:MGI:10921... [more]
back to top
BLAST of Protein kinase N2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63433|PKN1_RAT9.611e-8746.15Serine/threonine-protein kinase N1 OS=Rattus norve... [more]
sp|P70268|PKN1_MOUSE6.262e-8646.15Serine/threonine-protein kinase N1 OS=Mus musculus... [more]
sp|A7MBL8|PKN2_DANRE8.317e-8645.45Serine/threonine-protein kinase N2 OS=Danio rerio ... [more]
sp|A1A4I4|PKN1_BOVIN1.538e-8545.85Serine/threonine-protein kinase N1 OS=Bos taurus O... [more]
sp|Q16513|PKN2_HUMAN2.984e-8546.75Serine/threonine-protein kinase N2 OS=Homo sapiens... [more]
back to top
BLAST of Protein kinase N2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5C6NIS95.638e-9746.47Non-specific serine/threonine protein kinase OS=Ta... [more]
A0A3Q2ZNH19.298e-9749.19Non-specific serine/threonine protein kinase OS=Kr... [more]
A0A3Q1CAR41.049e-9546.77Non-specific serine/threonine protein kinase OS=Am... [more]
A0A1A8IK282.041e-9550.00Protein kinase N3 (Fragment) OS=Nothobranchius kuh... [more]
A0A1A8KCJ33.979e-9550.51Protein kinase N3 (Fragment) OS=Nothobranchius kuh... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn31.125e-9646.65protein kinase N3 [Source:ZFIN;Acc:ZDB-GENE-030131... [more]
pkn26.600e-8845.24serine/threonine-protein kinase N2 [Source:NCBI ge... [more]
zgc:1539161.701e-8744.51serine/threonine-protein kinase N2 [Source:NCBI ge... [more]
pkn1a2.025e-8748.33protein kinase N1a [Source:ZFIN;Acc:ZDB-GENE-06120... [more]
pkn1b4.384e-8746.46protein kinase N1b [Source:ZFIN;Acc:ZDB-GENE-07042... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008480.11.116e-7038.80pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
PRKCD6.922e-7041.81protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD7.818e-6641.85protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000006766.18.778e-6437.75pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000001814.16.742e-5739.47pep scaffold:Pmarinus_7.0:GL481074:830:17391:1 gen... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKC14.602e-8243.75Protein serine/threonine kinase; essential for cel... [more]
YPK11.033e-6539.40S/T protein kinase; phosphorylates, downregulates ... [more]
SCH93.435e-6539.74AGC family protein kinase; functional ortholog of ... [more]
YPK21.053e-6439.27Protein kinase similar to S/T protein kinase Ypk1p... [more]
KIN825.327e-5638.89Putative serine/threonine protein kinase; implicat... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO433123.646e-8542.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355851.604e-7143.91Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449381.522e-6939.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318956.048e-6840.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378001.754e-6639.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase N2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkn33.766e-9146.77serine/threonine-protein kinase N2 [Source:NCBI ge... [more]
pkn28.078e-8945.76protein kinase N2 [Source:NCBI gene;Acc:101158798][more]
pkn1a3.481e-8848.48protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
pkn1a1.012e-8748.48protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
pkn1a2.495e-8748.48protein kinase N1 [Source:NCBI gene;Acc:101164700][more]
back to top
BLAST of Protein kinase N2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014536.10.000e+095.71SMESG000014536.1[more]
SMESG000014533.10.000e+095.44SMESG000014533.1[more]
SMESG000014536.10.000e+097.58SMESG000014536.1[more]
SMESG000065035.11.249e-8047.62SMESG000065035.1[more]
SMESG000065035.11.255e-8047.62SMESG000065035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005823 ID=SMED30005823|Name=Protein kinase N2|organism=Schmidtea mediterranea sexual|type=transcript|length=3674bp
ATCTATATAAATCTTATATGACATCAATCTAATAAATATGAACGAGGCTG
AAGCTAAAACCAAGAACTTAAATGTACTGAAAAGTCAAATGGTTGATGTC
ATTGATAGTCTTAGACTGAACCATGCAGTTCATGAATTATTACCTTTGTT
AAATTTGCTACAAACCTTAGAAAACAATATCACTAATATTAATTCATTAG
ATTTCCAAAGCTGGAATACTTTAAATGTATTAGAGATGAATCACAAATTG
GGATTTGATAAGATTAATCTCACTCAAAAAATGTATTTCCTATTCAATAG
AATACATATCGAAAGTGCTTATATTTCATCTTTGAACAAGTCTTTTGTGT
ATGGGCTAAAGATAAAATCCAATAAGAAAGACAATGAAAAGCTAAATAAT
TTGCGACTGTATTCCGTTGAAAAGAAGAAATTATTTGCAGTTTCATTGAA
ACTGTTGCTACAGGAAAATTTATGTATGAACACTGCTGGAATGACTCTGG
AAAGAATAACCGACTTGCTTTTGGAGAACCTTGATAATGGAATAATGAAC
ATTTATGATTACATTTACCAGGAATGTAGCATTTGCAATAAGAATCACGA
AACTTGCCAACTGGAATCGGGACCGTTCTGCTTCTGTAGGTTGAAGTCTC
TCAACATAAACGAAAGCCAGCACTATTCAGGAATAATAAAATTCAAATTT
TGCTCATTTATGGGAATGTACTCGACAAGTTATCTGAAAGAAATCCTTAT
AAACAACGCACCAAGATTGGTAGATAACCAATTCAAGAGCGAATATAACA
CAAAGACCAAACGCCGTTGCGAAGTCGTTATAAAAGAACAAATAGTTTGT
TCTGATTGGACAACTGGTCCATTGATGATTTCTGGGGAGTTCGAAGTGTA
CAATGCCAAGGAAATTGAAGTTCAAGTTTGGGAGGATCCTAAAGAAATCG
GCGAAACGAAACATCTCGTTGCAGTCGCTGTCGTTTCTTTGCAAGCGTTG
ATCGAGAACAAACACCATTCGAATTCAATCAACATCTCGATGGAACCCGA
CGGTTTCATGACAGGCCTGGTGAAATATACCCCGATCAAAAGATCGATCT
CGGAAAATCCAGAATTGAACAAAGAAAACCGACCGCTTTTACGCAAAATC
GGAGTCAAGCGCAGAATGAATATCATGGCTAAACTCACCGGGCACCGCTT
GGCACGTCATGTCGAGGCTCATATTCCCGTATCGTTATGGCTAGATTGGT
TCCAGAACCATGTCGACAGGCTGGCCATCCCGGTTGATAGCAACAGGAAC
GAACCGGAACAGAAGGAAAATAAGATCTCAGGCCTGTGCAGAATGGTCAG
ACGGTTTGTCATTAAAAGCTTCGGTTTGAACAATAAAAAACTTTTGATTA
CTCCTTGCAAAAGTCCATTGGTGAACAAAATAGCCAATGAAAGTTATCGA
CAGATTTCTAAGTCACCAATGCCAAACCGAGTGCCCAAAACTCCGAAATT
CAATCAGACCAATCCCAGGGCTATTTGTAAATTTAATCATCCTAAAGAGA
TCCGATTTGCAGACCAGGATTCTGTGTCGGCTATGAACGAGACATCGGAA
TGTCAATCAGAATTCATGATTTCCACCCCTCTCAAAACCAAAAGTTCAAT
CTCAAATGACCGTACTCCGTTTTTCGAAGCCAAGAAAAATAAGCTCGACA
ATCTGATGTCACCTATACACCCGATTAATCGCAAAACACCCCAGAGACTC
ACTACTTATTATAATGAACAAATAAATCCTCATATAAACGATATTCTCAG
AGCTACCACAGGCTTTATGGCCGATTGCTCGGTGACAAGGAGCAACATAA
ATTTAACCGATATCAATGAATTTGATTCAACTCGAATGACAAAATGCAAC
TCCATAAACAACTCTAAAACCAAACTCGACGATAGTGATGAACCGAGAGA
TATGAGACAAGCAACAATTTGCCACAAGAGCATTTTACAATCACCTTTTC
CACTGGACTCTCAATATGATTTCATTCCAAACTCATGTAGATCTGTGTCG
AGGAGTATGATCTCGGCGAGCACCCATTCCAAGCATTGCAATAACATTTC
CCAGGCATCGACAAAGACCAATCAGACAGCAGATAAGTGCGTTCATCATG
ATTGGGATTCGTGTTGTTATGATGATTCATCGTATCTTAGTGAGAAGAAC
ATCACTAAGAACTCGTTTAAGCAAGGGATCGATATCAGATGTCTGGAATC
TTCCATTGGTGCCAGTGATCATGGTAGTTTCGATGGTCATGGGGATATTG
AGACTGAGGTCGCTAATGGCGATGGAGAGGGGGAGCGGGAGGAAGACGAG
GAGGACATTGATATCGATAACAACTCGTTCAATGGTACATTTAGATCTCG
ATCCGTTTGCCACCAAGTTCTCGATAAGTTGGAATTGTTGACTGTGCTCG
GTCAAGGACATTTCGGCAAAGTCCTGCTTGCGAAAGTCATAGAAACGAAA
AGCGTCTGTGCAATTAAAAGCATCCAGAAAGCAAGAGCAGCCACAGATAC
GGAATATGATAGCCTGTTTGCCGAGAGGGAGATTTTAATTTTGATCAGGA
AACACAATAATCCGTTTCTCATCAATTTGATTGGATGTTTTCAATCAGAG
CGTCACTTATTCTTCGCCCTAGAATATGTGGCCGGGGGAGATTTCATGGG
CCACGTGCATAAAAGTCCATTCATTGAAGAGGATGCGAGATTTTATATAA
GTTGTATTGTCCTAGCATTTGAGTTCTTGCACGACCAAGATATTATATAC
AGAGATCTGAAACTGGACAATGTCCTAATGGACATACACGGCTATGCGAA
ACTAACAGATTTCGGCCTCAGCAAACCAAACATGAAGTGGGATACTAAAA
CGACAACATTTTGTGGAACTCCAGAGTTTCTCGCTCCGGAAATCATCGAA
GAGAAAAATTATACTCGAGTCATTGATTGGTGGGCTTTGGGAGTTCTGCT
TTATGAAATGATTCTCGGGGAGTCTCCATTTCCCGGCGATGACGACAGGG
AGATATTCTCGATGATTTTATCGACTACTCCTAACATTAAAAGTCTTTCT
CCAGAATCTACATCTCTCATCAAGCGGTTATTAAAAAGAGATCCCGAAAA
GCGACTCGGATACGGGTGTGAAGGGACTCGTAAAGTGAAAGAACATTCGT
TTTTTGCTTCCATAGACTGGAATAAGTTATATTCTCGACAGCTCGTGCCT
CCTTTCATTCCTAAATTGGATGACGTCACCGATACTCAGTATTTCGAAAG
CGAATTCACTAATCAGCCAGTGACCATTGAGCATGACGACGAGGAGGTAG
ATTCAGAATTCGATGACGAGCTATTCAGGAATTTCGACACGGATTTGCAG
TGGCAATGATGATAACAATAAAAATGATAATATTATATTGCTGAAATTTT
GCATTTTTTTTTCGTTTTTGATAACTATTATTAGTAATTTTCTAGTGTAA
TGTTATCTCGTCACTGATGTTCATATTACTGACAAATGTTATCCAATCGC
ATTACTTGCACCGGCCGCTAGTCTCCAGCCACATTTTGTAATGCTGCTTT
TAATAACAATAAACATTTTTATGTTTACCCGCACACTTTTTATATCATTC
TCATCATTTCCGCAGATCGGAAGA
back to top

protein sequence of SMED30005823-orf-1

>SMED30005823-orf-1 ID=SMED30005823-orf-1|Name=SMED30005823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1124bp
MNEAEAKTKNLNVLKSQMVDVIDSLRLNHAVHELLPLLNLLQTLENNITN
INSLDFQSWNTLNVLEMNHKLGFDKINLTQKMYFLFNRIHIESAYISSLN
KSFVYGLKIKSNKKDNEKLNNLRLYSVEKKKLFAVSLKLLLQENLCMNTA
GMTLERITDLLLENLDNGIMNIYDYIYQECSICNKNHETCQLESGPFCFC
RLKSLNINESQHYSGIIKFKFCSFMGMYSTSYLKEILINNAPRLVDNQFK
SEYNTKTKRRCEVVIKEQIVCSDWTTGPLMISGEFEVYNAKEIEVQVWED
PKEIGETKHLVAVAVVSLQALIENKHHSNSINISMEPDGFMTGLVKYTPI
KRSISENPELNKENRPLLRKIGVKRRMNIMAKLTGHRLARHVEAHIPVSL
WLDWFQNHVDRLAIPVDSNRNEPEQKENKISGLCRMVRRFVIKSFGLNNK
KLLITPCKSPLVNKIANESYRQISKSPMPNRVPKTPKFNQTNPRAICKFN
HPKEIRFADQDSVSAMNETSECQSEFMISTPLKTKSSISNDRTPFFEAKK
NKLDNLMSPIHPINRKTPQRLTTYYNEQINPHINDILRATTGFMADCSVT
RSNINLTDINEFDSTRMTKCNSINNSKTKLDDSDEPRDMRQATICHKSIL
QSPFPLDSQYDFIPNSCRSVSRSMISASTHSKHCNNISQASTKTNQTADK
CVHHDWDSCCYDDSSYLSEKNITKNSFKQGIDIRCLESSIGASDHGSFDG
HGDIETEVANGDGEGEREEDEEDIDIDNNSFNGTFRSRSVCHQVLDKLEL
LTVLGQGHFGKVLLAKVIETKSVCAIKSIQKARAATDTEYDSLFAEREIL
ILIRKHNNPFLINLIGCFQSERHLFFALEYVAGGDFMGHVHKSPFIEEDA
RFYISCIVLAFEFLHDQDIIYRDLKLDNVLMDIHGYAKLTDFGLSKPNMK
WDTKTTTFCGTPEFLAPEIIEEKNYTRVIDWWALGVLLYEMILGESPFPG
DDDREIFSMILSTTPNIKSLSPESTSLIKRLLKRDPEKRLGYGCEGTRKV
KEHSFFASIDWNKLYSRQLVPPFIPKLDDVTDTQYFESEFTNQPVTIEHD
DEEVDSEFDDELFRNFDTDLQWQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0017049GTP-Rho binding
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0000166nucleotide binding
GO:0004697protein kinase C activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007165signal transduction
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000961AGC-kinase, C-terminalSMARTSM00133pkinase_C_6coord: 1063..1121
e-value: 8.5E-12
score: 55.2
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 1063..1129
score: 14.859
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 804..1062
e-value: 6.4E-85
score: 298.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 806..1062
e-value: 1.5E-61
score: 208.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 804..1062
score: 45.658
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 890..1093
e-value: 9.4E-111
score: 371.8
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 802..1112
e-value: 9.4E-111
score: 371.8
NoneNo IPR availablePANTHERPTHR24356SERINE/THREONINE-PROTEIN KINASEcoord: 296..1128
NoneNo IPR availablePANTHERPTHR24356:SF210SERINE/THREONINE-PROTEIN KINASE Ncoord: 296..1128
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 810..833
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 925..937
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 800..1106