Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30005805
Length (bp)939
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30005805) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30005805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30005805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30005805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005805SMESG000041571.1 SmedASXL_000474SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005805SMESG000041571.1 dd_Smed_v6_18972_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30005805SMESG000041571.1 SMED30005805smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30005805SMESG000041571.1 Contig34813newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30005805SMESG000041571.1 Contig34813uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30005805SMESG000041571.1 OX_Smed_1.0.01134ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX1-1 (NK1 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:24975])

HSP 1 Score: 129.798 bits (325), Expect = 6.596e-34
Identity = 58/65 (89.23%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  258 KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 322          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX1-2 (NK1 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:31652])

HSP 1 Score: 127.487 bits (319), Expect = 7.229e-34
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  162 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 226          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: GBX1 (gastrulation brain homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4185])

HSP 1 Score: 88.5817 bits (218), Expect = 2.827e-19
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            KSRR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  260 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG 322          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: GBX2 (gastrulation brain homeobox 2 [Source:HGNC Symbol;Acc:HGNC:4186])

HSP 1 Score: 87.4261 bits (215), Expect = 5.186e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  246 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 308          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: MNX1 (motor neuron and pancreas homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4979])

HSP 1 Score: 81.6481 bits (200), Expect = 6.155e-18
Identity = 39/67 (58.21%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  295 QSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKK 495
            Q+ ++L  K RR RTAFT +QL+ LE++FK  +YLS  +R  +A SL LTE QVKIWFQNRR KWK+
Sbjct:   20 QAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 86          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-1 (Homeobox protein ceh-1 [Source:UniProtKB/Swiss-Prot;Acc:P53547])

HSP 1 Score: 124.02 bits (310), Expect = 1.644e-34
Identity = 67/125 (53.60%), Postives = 84/125 (67.20%), Query Frame = 1
Query:  208 DSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQN--SSKKTELS--LPQRP 570
            + +   +L+  R  +  S  +  +    +   +S KLK RRARTAFTYEQLV+LENKFK++RYLSV ERLNLA  LQL+E QVKIWFQNRRTKWKK NPG D +  Q   SS +T++   LP  P
Sbjct:    2 NGFRVEDLLSEREKDSNSDEATHQKSPADGGKSSRKLKMRRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQLQLSETQVKIWFQNRRTKWKKHNPGQDANTPQTPPSSDETQIQPILPANP 126          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-31 (Homeobox protein ceh-31 [Source:UniProtKB/Swiss-Prot;Acc:Q22910])

HSP 1 Score: 84.7297 bits (208), Expect = 7.035e-19
Identity = 39/69 (56.52%), Postives = 52/69 (75.36%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ-NPGSDVHH 522
            K+R+ART FT +QL  LEN F+  +YLSV +R+ LAH + LT+ QVK W+QNRRTKWK+Q + G D+ H
Sbjct:   93 KARKARTIFTDKQLQELENTFEKQKYLSVQDRMELAHRMGLTDTQVKTWYQNRRTKWKRQASVGMDLLH 161          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 83.9593 bits (206), Expect = 9.129e-19
Identity = 37/60 (61.67%), Postives = 48/60 (80.00%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            KSR+ART FT +QL  LEN F+  +YLSV +R++LAH + LT+ QVK W+QNRRTKWK+Q
Sbjct:   94 KSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQ 153          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-30 (Homeobox protein ceh-30 [Source:UniProtKB/Swiss-Prot;Acc:Q22909])

HSP 1 Score: 83.9593 bits (206), Expect = 9.129e-19
Identity = 37/60 (61.67%), Postives = 48/60 (80.00%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            KSR+ART FT +QL  LEN F+  +YLSV +R++LAH + LT+ QVK W+QNRRTKWK+Q
Sbjct:   94 KSRKARTIFTDKQLQELENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQ 153          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: vab-15 (Homeobox protein vab-15 [Source:UniProtKB/Swiss-Prot;Acc:Q09604])

HSP 1 Score: 77.0258 bits (188), Expect = 2.510e-16
Identity = 35/57 (61.40%), Postives = 44/57 (77.19%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKK 495
            R+ RT F+ +QL+SLE KF+S +YLS+ ER   + SLQLTE QVKIWFQNRR K K+
Sbjct:  130 RKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKR 186          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: slou (gene:FBgn0002941 transcript:FBtr0084123)

HSP 1 Score: 129.413 bits (324), Expect = 4.052e-33
Identity = 59/64 (92.19%), Postives = 60/64 (93.75%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:  546 RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDV 609          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: slou (gene:FBgn0002941 transcript:FBtr0330389)

HSP 1 Score: 129.028 bits (323), Expect = 5.569e-33
Identity = 59/64 (92.19%), Postives = 60/64 (93.75%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:  546 RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDV 609          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: lms (gene:FBgn0034520 transcript:FBtr0342702)

HSP 1 Score: 83.1889 bits (204), Expect = 1.215e-17
Identity = 48/134 (35.82%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  145 HPFQIDNLLSKTLDDEGSAFEDSYH--YSELVKCRVGEEYSWNSNSKSC--------------SPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            H F I+ +L+K      ++FEDS          C +G   + +  + SC              + +  N     + +R RTAF+  Q+ +LE +F+  +YLSV +R  LA  LQLTE Q+KIWFQNRRTKWK++
Sbjct:   12 HSFSIEQILAKPEMRSSTSFEDSVQDESGRGGNC-LGASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRK 144          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: lms (gene:FBgn0034520 transcript:FBtr0342701)

HSP 1 Score: 83.1889 bits (204), Expect = 1.215e-17
Identity = 48/134 (35.82%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  145 HPFQIDNLLSKTLDDEGSAFEDSYH--YSELVKCRVGEEYSWNSNSKSC--------------SPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            H F I+ +L+K      ++FEDS          C +G   + +  + SC              + +  N     + +R RTAF+  Q+ +LE +F+  +YLSV +R  LA  LQLTE Q+KIWFQNRRTKWK++
Sbjct:   12 HSFSIEQILAKPEMRSSTSFEDSVQDESGRGGNC-LGASRASSPATSSCLDDNMDDGKSDIDLASDDGNGLGDDRKKRPRTAFSAAQIKALETEFERGKYLSVAKRTALAKQLQLTETQIKIWFQNRRTKWKRK 144          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: B-H1 (gene:FBgn0011758 transcript:FBtr0074430)

HSP 1 Score: 83.1889 bits (204), Expect = 2.210e-17
Identity = 38/64 (59.38%), Postives = 46/64 (71.88%), Query Frame = 1
Query:  307 SLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
             L  K R+ARTAFT  QL +LE  F+  +YLSV ER  LAH L L++ QVK W+QNRRTKWK+Q
Sbjct:  294 GLSKKQRKARTAFTDHQLQTLEKSFERQKYLSVQERQELAHKLDLSDCQVKTWYQNRRTKWKRQ 357          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx1.2lb (NK1 transcription factor related 2-like,b [Source:ZFIN;Acc:ZDB-GENE-040615-2])

HSP 1 Score: 127.872 bits (320), Expect = 7.245e-34
Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D 
Sbjct:  199 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADT 264          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx1.2la (NK1 transcription factor related 2-like,a [Source:ZFIN;Acc:ZDB-GENE-040615-1])

HSP 1 Score: 122.865 bits (307), Expect = 1.149e-32
Identity = 56/63 (88.89%), Postives = 59/63 (93.65%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG
Sbjct:  140 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPG 202          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: pnx (posterior neuron-specific homeobox [Source:NCBI gene;Acc:352939])

HSP 1 Score: 87.0409 bits (214), Expect = 3.344e-20
Identity = 45/75 (60.00%), Postives = 56/75 (74.67%), Query Frame = 1
Query:  286 SPNQSNNSL-KLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            +PN +N S  K+KS+R RTAFT +QL  LE  F+S+ YLSV ER  +A +L L+E QVKIWFQNRRTKWKK+  G
Sbjct:   54 APNIANASAAKVKSKRIRTAFTLDQLRILERSFQSSHYLSVFERHCIASALGLSETQVKIWFQNRRTKWKKELDG 128          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: gbx1 (gastrulation brain homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-020117-2])

HSP 1 Score: 88.1965 bits (217), Expect = 1.287e-19
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            KSRR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  213 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG 275          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: gbx2 (gastrulation brain homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-020509-2])

HSP 1 Score: 87.0409 bits (214), Expect = 4.771e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  240 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 302          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: rpgrip1 (RPGR interacting protein 1 [Source:Xenbase;Acc:XB-GENE-1007974])

HSP 1 Score: 129.413 bits (324), Expect = 7.449e-34
Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D 
Sbjct:  256 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADT 321          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: pmp2 (peripheral myelin protein 2 [Source:Xenbase;Acc:XB-GENE-977969])

HSP 1 Score: 111.309 bits (277), Expect = 1.675e-28
Identity = 50/62 (80.65%), Postives = 57/62 (91.94%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNP 504
            K RRARTAFTYEQLV+LE++F+S+RYLSVCERL+LA +L LTE QVKIWFQNRRTKWKKQ P
Sbjct:   99 KPRRARTAFTYEQLVALESRFRSSRYLSVCERLSLALTLHLTETQVKIWFQNRRTKWKKQQP 160          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000053265.1 (gastrulation brain homeobox 2, gene 1 [Source:NCBI gene;Acc:100485559])

HSP 1 Score: 86.6557 bits (213), Expect = 8.672e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  238 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 300          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000050503.1 (NK3 homeobox 1 [Source:NCBI gene;Acc:100038192])

HSP 1 Score: 84.3445 bits (207), Expect = 8.837e-19
Identity = 58/166 (34.94%), Postives = 87/166 (52.41%), Query Frame = 1
Query:  127 DFSMPNHP---FQIDNLLS--------KTLD------DEGSAF------------EDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSS 537
            D S+P  P   F I ++LS        K+LD      D+ S+             + S   +E+   ++ +E      ++  SP +    LKL+ +R+R AF++ Q++ LE KF S +YLS  ER  LA SL+LTE QVKIWFQNRR K K++   +D+   + SS
Sbjct:    8 DLSLPAKPLKSFLIQDILSHIGPGRKEKSLDSPKTDQDQDSSLGGKKENCTPEKQQSSSQPAEMHHSQMEDENVELDQAQPISPVEKK--LKLQQKRSRAAFSHSQVIELERKFSSQKYLSAPERAQLAKSLKLTETQVKIWFQNRRYKTKRKQLATDMEEVEKSS 171          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: gbx2.2 (gastrulation brain homeobox 2, gene 2 [Source:NCBI gene;Acc:496963])

HSP 1 Score: 85.5001 bits (210), Expect = 2.348e-18
Identity = 38/63 (60.32%), Postives = 48/63 (76.19%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  238 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHVLKLSEVQVKIWFQNRRAKWKRVKAG 300          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx1-1 (NK1 homeobox 1 [Source:MGI Symbol;Acc:MGI:109346])

HSP 1 Score: 131.339 bits (329), Expect = 8.662e-35
Identity = 58/65 (89.23%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  249 KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 313          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx1-2 (NK1 homeobox 2 [Source:MGI Symbol;Acc:MGI:104806])

HSP 1 Score: 127.487 bits (319), Expect = 4.799e-34
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  155 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 219          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Gbx1 (gastrulation brain homeobox 1 [Source:MGI Symbol;Acc:MGI:95667])

HSP 1 Score: 88.9669 bits (219), Expect = 1.998e-19
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            KSRR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  315 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG 377          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Gbx2 (gastrulation brain homeobox 2 [Source:MGI Symbol;Acc:MGI:95668])

HSP 1 Score: 87.4261 bits (215), Expect = 3.775e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  246 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 308          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Mnx1 (motor neuron and pancreas homeobox 1 [Source:MGI Symbol;Acc:MGI:109160])

HSP 1 Score: 83.1889 bits (204), Expect = 2.022e-17
Identity = 39/68 (57.35%), Postives = 51/68 (75.00%), Query Frame = 1
Query:  292 NQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKK 495
            +Q+ ++L  K RR RTAFT +QL+ LE++FK  +YLS  +R  +A SL LTE QVKIWFQNRR KWK+
Sbjct:  231 SQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 298          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q15270|NKX11_HUMAN (NK1 transcription factor-related protein 1 OS=Homo sapiens OX=9606 GN=NKX1-1 PE=2 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 3.167e-33
Identity = 58/65 (89.23%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  258 KPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 322          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P42580|NKX12_MOUSE (NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.357e-33
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  155 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 219          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9UD57|NKX12_HUMAN (NK1 transcription factor-related protein 2 OS=Homo sapiens OX=9606 GN=NKX1-2 PE=2 SV=3)

HSP 1 Score: 127.487 bits (319), Expect = 3.471e-33
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  162 KPRRARTAFTYEQLVALENKFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 226          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P22807|SLOU_DROME (Homeobox protein slou OS=Drosophila melanogaster OX=7227 GN=slou PE=2 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 4.062e-32
Identity = 59/64 (92.19%), Postives = 60/64 (93.75%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:  546 RRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDV 609          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P53547|HM01_CAEEL (Homeobox protein ceh-1 (Fragment) OS=Caenorhabditis elegans OX=6239 GN=ceh-1 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.548e-31
Identity = 60/86 (69.77%), Postives = 68/86 (79.07%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQN--SSKKTELS--LPQRP 570
            RRARTAFTYEQLV+LENKFK++RYLSV ERLNLA  LQL+E QVKIWFQNRRTKWKK NPG D +  Q   SS +T++   LP  P
Sbjct:    2 RRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQLQLSETQVKIWFQNRRTKWKKHNPGQDANTPQTPPSSDETQIQPILPANP 87          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1I8IRK3 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.000e-34
Identity = 65/79 (82.28%), Postives = 68/79 (86.08%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELS 555
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA  L LTE QVKIWFQNRRTKWKKQNPG DV+ Y  SS +T LS
Sbjct:   69 KQRRARTAFTYEQLVALENKFKSTRYLSVCERLNLAMRLSLTETQVKIWFQNRRTKWKKQNPGLDVNAY--SSAQTLLS 145          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1I8I6F8 (Homeobox domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.032e-34
Identity = 65/79 (82.28%), Postives = 68/79 (86.08%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELS 555
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA  L LTE QVKIWFQNRRTKWKKQNPG DV+ Y  SS +T LS
Sbjct:   69 KQRRARTAFTYEQLVALENKFKSTRYLSVCERLNLAMRLSLTETQVKIWFQNRRTKWKKQNPGLDVNAY--SSAQTLLS 145          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1B0DAB2 (Homeobox domain-containing protein OS=Phlebotomus papatasi OX=29031 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 6.618e-34
Identity = 67/87 (77.01%), Postives = 71/87 (81.61%), Query Frame = 1
Query:  259 SWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVH 519
            S NS   S   +QSN +   K RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV+
Sbjct:   25 SRNSKGNSDGKSQSNGT---KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDVN 108          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A182PQZ1 (Homeobox domain-containing protein OS=Anopheles epiroticus OX=199890 PE=4 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.150e-33
Identity = 73/111 (65.77%), Postives = 78/111 (70.27%), Query Frame = 1
Query:  184 DDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            D  GS  ED  H SE    + G      +N      +Q N+S   K RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:    4 DTMGSDMED--HASETDSKKDG-----TNNRGGDGKSQGNSS---KPRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDV 104          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A182SFV6 (Homeobox domain-containing protein OS=Anopheles maculatus OX=74869 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 2.159e-33
Identity = 73/111 (65.77%), Postives = 78/111 (70.27%), Query Frame = 1
Query:  184 DDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            D  GS  +D  H SE    + G      SN++S       NS K   RRARTAFTYEQLVSLENKFK+TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:    4 DTMGSDMDD--HASETDSKKDG------SNNRSGDGKSQGNSSK--PRRARTAFTYEQLVSLENKFKTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGMDV 104          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx1.2lb (NK1 transcription factor related 2-like,b [Source:ZFIN;Acc:ZDB-GENE-040615-2])

HSP 1 Score: 128.642 bits (322), Expect = 2.509e-34
Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D 
Sbjct:  191 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADT 256          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx1.2la (NK1 transcription factor-related protein 2-like [Source:NCBI gene;Acc:103033039])

HSP 1 Score: 125.946 bits (315), Expect = 5.309e-34
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            + RRARTAFTYEQLV+LENKF+STRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  135 RPRRARTAFTYEQLVALENKFRSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 199          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: pnx (homeobox protein CHOX-7-like [Source:NCBI gene;Acc:107197447])

HSP 1 Score: 89.3521 bits (220), Expect = 5.571e-21
Identity = 48/89 (53.93%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  247 GEEYSWNSNSKSC--SPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            GEE   +++S S   SP   +     K+RR RTAFT EQL  LE  F+S+ YLSV ER  +A +L+L+E QVKIWFQNRRTKWKK   G
Sbjct:   50 GEESPADTDSLSAPDSPAPDSPVPTRKARRIRTAFTLEQLRVLERSFQSSHYLSVLERHVIASALRLSETQVKIWFQNRRTKWKKSREG 138          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: gbx1 (gastrulation brain homeobox 1 [Source:NCBI gene;Acc:103022497])

HSP 1 Score: 88.1965 bits (217), Expect = 1.175e-19
Identity = 40/81 (49.38%), Postives = 56/81 (69.14%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLP 561
            KSRR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G+        ++  ++ +P
Sbjct:  219 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNAGGRSGEPARNPKIVVP 299          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: gbx2 (gastrulation brain homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-020509-2])

HSP 1 Score: 87.0409 bits (214), Expect = 3.615e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  234 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 296          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 74.7146 bits (182), Expect = 3.465e-17
Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQN 501
            K R+ARTAF+  QL  LE  F+  +YLSV +R+ LA SL L++ QVK W+QNRRTKWK+Q 
Sbjct:    4 KPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQT 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: barhl2 (BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050913-153])

HSP 1 Score: 75.0998 bits (183), Expect = 5.161e-17
Identity = 35/61 (57.38%), Postives = 45/61 (73.77%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQN 501
            K R+ARTAF+  QL  LE  F+  +YLSV +R+ LA SL L++ QVK W+QNRRTKWK+Q 
Sbjct:    4 KPRKARTAFSDHQLTQLERSFERQKYLSVQDRMELASSLSLSDTQVKTWYQNRRTKWKRQT 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 73.9442 bits (180), Expect = 1.533e-16
Identity = 36/78 (46.15%), Postives = 52/78 (66.67%), Query Frame = 1
Query:  322 SRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELS 555
            +R+ RT FT  QL++LE+KF+  +YLS+ ER   + SL LTE QVKIWFQNRR K K+    +++   + ++K   LS
Sbjct:   14 TRKPRTPFTTSQLLALEHKFRQKQYLSIAERAEFSTSLSLTETQVKIWFQNRRAKAKRLQ-EAELERLKMAAKPPALS 90          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 2.580e-16
Identity = 36/63 (57.14%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K RR RTAF+ +QL+ LE  F   RYLS  +R  +A +L LTE QVKIWFQNRR KWK+   G
Sbjct:    2 KCRRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKRGKGG 64          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 70.8626 bits (172), Expect = 4.821e-16
Identity = 33/58 (56.90%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  322 SRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKK 495
            S+R+RTA+T +Q++ LE +F   RYL+   R+ +AHSL L+E Q+KIWFQNRR KWKK
Sbjct:    2 SKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKK 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 45.8246 bits (107), Expect = 4.630e-6
Identity = 29/86 (33.72%), Postives = 45/86 (52.33%), Query Frame = 1
Query:  253 EYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGS 510
            ++  ++N  S S N S++      R  RT    E L  L+ KF+     S+ ER  ++  + + E  V+IWFQNRR K +K+  GS
Sbjct:   57 DHDQHTNDMSASSNASDSG---PQRPKRTRAKGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKKQHGS 139          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: NK-1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI80])

HSP 1 Score: 129.798 bits (325), Expect = 9.437e-36
Identity = 64/86 (74.42%), Postives = 69/86 (80.23%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLPQRPSS 576
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV      +  T  ++P  P+S
Sbjct:  156 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLGLTETQVKIWFQNRRTKWKKQNPGMDV------TAPTRPNIPHGPAS 235          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO38891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBL6])

HSP 1 Score: 78.9518 bits (193), Expect = 6.400e-19
Identity = 39/59 (66.10%), Postives = 45/59 (76.27%), Query Frame = 1
Query:  322 SRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            SRR RTAFT  QL SLE KF+  +YL++ ER +LA S+ LT  QVK WFQNRRTKWKKQ
Sbjct:    1 SRRRRTAFTSSQLKSLEEKFQEKKYLTISERNSLAKSMHLTNTQVKTWFQNRRTKWKKQ 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO32495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX2])

HSP 1 Score: 78.1814 bits (191), Expect = 9.363e-19
Identity = 36/58 (62.07%), Postives = 47/58 (81.03%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            +R RTAFT EQ+  LE +F+ ++YLSV  R+ LA+SL LTE Q+KIWFQNRRTKWK++
Sbjct:    2 KRPRTAFTNEQIKDLEAEFQKSKYLSVSRRMELANSLSLTETQIKIWFQNRRTKWKRK 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO43402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYQ0])

HSP 1 Score: 77.7962 bits (190), Expect = 1.717e-18
Identity = 38/60 (63.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            KSRR RTAFT  QL  LE KF+  +YL++ ER  LA S+ L++ QVK WFQNRRTKWKKQ
Sbjct:   10 KSRRKRTAFTSSQLKYLEEKFQEKKYLTISERNELAKSMYLSDTQVKTWFQNRRTKWKKQ 69          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO47164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV1])

HSP 1 Score: 72.4034 bits (176), Expect = 1.475e-16
Identity = 38/61 (62.30%), Postives = 47/61 (77.05%), Query Frame = 1
Query:  325 RRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            RR RTAFT  QL  LE+KFK ++YL++ ER  +A SLQLT  Q+K WFQNRRTKWK++N G
Sbjct:    1 RRKRTAFTSFQLKCLEDKFKFSKYLTIAERDMMARSLQLTNRQIKTWFQNRRTKWKRENVG 61          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx1.2lb (NK1 homeobox 1 [Source:NCBI gene;Acc:101166641])

HSP 1 Score: 129.413 bits (324), Expect = 3.908e-34
Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D 
Sbjct:  252 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADT 317          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx1.2lb (NK1 homeobox 1 [Source:NCBI gene;Acc:101166641])

HSP 1 Score: 128.642 bits (322), Expect = 6.275e-34
Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            K RRARTAFTYEQLV+LENKFKSTRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D 
Sbjct:  235 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADT 300          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx1.2la (NK1 homeobox 2 [Source:NCBI gene;Acc:101168069])

HSP 1 Score: 124.79 bits (312), Expect = 1.381e-33
Identity = 57/65 (87.69%), Postives = 61/65 (93.85%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSD 513
            K RRARTAFTYEQLV+LENKF++TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG+D
Sbjct:  129 KPRRARTAFTYEQLVALENKFRTTRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGAD 193          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: gbx1 (gastrulation brain homeobox 1 [Source:NCBI gene;Acc:101173976])

HSP 1 Score: 88.1965 bits (217), Expect = 1.450e-19
Identity = 39/63 (61.90%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            KSRR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  219 KSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAG 281          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: gbx2 (gastrulation brain homeobox 2 [Source:NCBI gene;Acc:101166199])

HSP 1 Score: 87.0409 bits (214), Expect = 4.707e-19
Identity = 38/63 (60.32%), Postives = 49/63 (77.78%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPG 507
            K+RR RTAFT EQL+ LE +F   +YLS+ ER  +AH+L+L+E+QVKIWFQNRR KWK+   G
Sbjct:  248 KNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 310          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000041571.1 (SMESG000041571.1)

HSP 1 Score: 501.901 bits (1291), Expect = 0.000e+0
Identity = 244/244 (100.00%), Postives = 244/244 (100.00%), Query Frame = 1
Query:  136 MPNHPFQIDNLLSKTLDDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLPQRPSSKNEKNCSFGFVNERNNKSKPRTNSTTSNPASLHESSPTPLHQGIYQYPFYKNTYDSTHWLNSATTNPYNWVSSGISNFQNCPGVSYSDLLLNYSNIM 867
            MPNHPFQIDNLLSKTLDDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLPQRPSSKNEKNCSFGFVNERNNKSKPRTNSTTSNPASLHESSPTPLHQGIYQYPFYKNTYDSTHWLNSATTNPYNWVSSGISNFQNCPGVSYSDLLLNYSNIM
Sbjct:    1 MPNHPFQIDNLLSKTLDDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLPQRPSSKNEKNCSFGFVNERNNKSKPRTNSTTSNPASLHESSPTPLHQGIYQYPFYKNTYDSTHWLNSATTNPYNWVSSGISNFQNCPGVSYSDLLLNYSNIM 244          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000051002.1 (SMESG000051002.1)

HSP 1 Score: 124.79 bits (312), Expect = 6.098e-33
Identity = 57/67 (85.07%), Postives = 61/67 (91.04%), Query Frame = 1
Query:  316 LKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDV 516
            +K RRART+FTY+QLV+LENKFK TRYLSVCERLNLA SL LTE QVKIWFQNRRTKWKKQNPG DV
Sbjct:  161 MKPRRARTSFTYDQLVALENKFKITRYLSVCERLNLAFSLNLTETQVKIWFQNRRTKWKKQNPGLDV 227          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000077917.1 (SMESG000077917.1)

HSP 1 Score: 113.62 bits (283), Expect = 1.282e-29
Identity = 69/119 (57.98%), Postives = 81/119 (68.07%), Query Frame = 1
Query:  181 LDDEGSAFEDSYHYSELVKCRVGEEYSWNS------NSKSCSPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQNPGSDVH 519
            +D E + FE     S ++ C   ++Y ++       N    +   S N L  K RRARTAFTYEQLV+LENKFK TRYLSVCERLNLA +L LTE QVKIWFQNRRTKWKKQNPG DV+
Sbjct:   45 IDSEKNFFEFLNDKSNILNCTNLQKYKYSDVHGPGVNKNIATKEGSMNFLNNKPRRARTAFTYEQLVALENKFKVTRYLSVCERLNLALTLNLTETQVKIWFQNRRTKWKKQNPGQDVN 163          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000019482.1 (SMESG000019482.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.497e-17
Identity = 55/126 (43.65%), Postives = 71/126 (56.35%), Query Frame = 1
Query:  139 PNHPFQIDN---LLSKTLDDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSCSPNQSNNSLKLKSRR---ARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ 498
            P + F ID+   +  K LDD    F +    +E+         S++  S+S   N S N+ KL  RR    RT F+  Q+  LE+ F   RYLS  ER +LAH+LQLTE QVKIWFQNRR KWK+Q
Sbjct:  153 PENRFLIDSSSQVDQKDLDDICRDFTEDVIDNEV--------DSFSQASESEDGNLSANNTKLSLRRKKKTRTVFSRNQVFQLESTFDLKRYLSSSERASLAHALQLTETQVKIWFQNRRNKWKRQ 270          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000022963.1 (SMESG000022963.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.221e-16
Identity = 38/67 (56.72%), Postives = 50/67 (74.63%), Query Frame = 1
Query:  319 KSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSLQLTEIQVKIWFQNRRTKWKKQ-NPGSDV 516
            + R+ARTAFT +QL  LE  F   +YLSV +RL LA+ L+LT+ QVK W+QNRRTKWK+Q + G D+
Sbjct:   65 RPRKARTAFTEKQLCELEKSFDKHKYLSVQDRLELANYLELTDTQVKTWYQNRRTKWKRQTSTGVDL 131          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX1-16.596e-3489.23NK1 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:24975][more]
NKX1-27.229e-3487.69NK1 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:31652][more]
GBX12.827e-1961.90gastrulation brain homeobox 1 [Source:HGNC Symbol;... [more]
GBX25.186e-1960.32gastrulation brain homeobox 2 [Source:HGNC Symbol;... [more]
MNX16.155e-1858.21motor neuron and pancreas homeobox 1 [Source:HGNC ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-11.644e-3453.60Homeobox protein ceh-1 [Source:UniProtKB/Swiss-Pr... [more]
ceh-317.035e-1956.52Homeobox protein ceh-31 [Source:UniProtKB/Swiss-P... [more]
ceh-309.129e-1961.67Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
ceh-309.129e-1961.67Homeobox protein ceh-30 [Source:UniProtKB/Swiss-P... [more]
vab-152.510e-1661.40Homeobox protein vab-15 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slou4.052e-3392.19gene:FBgn0002941 transcript:FBtr0084123[more]
slou5.569e-3392.19gene:FBgn0002941 transcript:FBtr0330389[more]
lms1.215e-1735.82gene:FBgn0034520 transcript:FBtr0342702[more]
lms1.215e-1735.82gene:FBgn0034520 transcript:FBtr0342701[more]
B-H12.210e-1759.38gene:FBgn0011758 transcript:FBtr0074430[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx1.2lb7.245e-3489.39NK1 transcription factor related 2-like,b [Source:... [more]
nkx1.2la1.149e-3288.89NK1 transcription factor related 2-like,a [Source:... [more]
pnx3.344e-2060.00posterior neuron-specific homeobox [Source:NCBI ge... [more]
gbx11.287e-1961.90gastrulation brain homeobox 1 [Source:ZFIN;Acc:ZDB... [more]
gbx24.771e-1960.32gastrulation brain homeobox 2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrip17.449e-3489.39RPGR interacting protein 1 [Source:Xenbase;Acc:XB-... [more]
pmp21.675e-2880.65peripheral myelin protein 2 [Source:Xenbase;Acc:XB... [more]
ENSXETT00000053265.18.672e-1960.32gastrulation brain homeobox 2, gene 1 [Source:NCBI... [more]
ENSXETT00000050503.18.837e-1934.94NK3 homeobox 1 [Source:NCBI gene;Acc:100038192][more]
gbx2.22.348e-1860.32gastrulation brain homeobox 2, gene 2 [Source:NCBI... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx1-18.662e-3589.23NK1 homeobox 1 [Source:MGI Symbol;Acc:MGI:109346][more]
Nkx1-24.799e-3487.69NK1 homeobox 2 [Source:MGI Symbol;Acc:MGI:104806][more]
Gbx11.998e-1961.90gastrulation brain homeobox 1 [Source:MGI Symbol;A... [more]
Gbx23.775e-1960.32gastrulation brain homeobox 2 [Source:MGI Symbol;A... [more]
Mnx12.022e-1757.35motor neuron and pancreas homeobox 1 [Source:MGI S... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15270|NKX11_HUMAN3.167e-3389.23NK1 transcription factor-related protein 1 OS=Homo... [more]
sp|P42580|NKX12_MOUSE3.357e-3387.69NK1 transcription factor-related protein 2 OS=Mus ... [more]
sp|Q9UD57|NKX12_HUMAN3.471e-3387.69NK1 transcription factor-related protein 2 OS=Homo... [more]
sp|P22807|SLOU_DROME4.062e-3292.19Homeobox protein slou OS=Drosophila melanogaster O... [more]
sp|P53547|HM01_CAEEL1.548e-3169.77Homeobox protein ceh-1 (Fragment) OS=Caenorhabditi... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IRK33.000e-3482.28Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A1I8I6F83.032e-3482.28Homeobox domain-containing protein OS=Macrostomum ... [more]
A0A1B0DAB26.618e-3477.01Homeobox domain-containing protein OS=Phlebotomus ... [more]
A0A182PQZ11.150e-3365.77Homeobox domain-containing protein OS=Anopheles ep... [more]
A0A182SFV62.159e-3365.77Homeobox domain-containing protein OS=Anopheles ma... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx1.2lb2.509e-3489.39NK1 transcription factor related 2-like,b [Source:... [more]
nkx1.2la5.309e-3487.69NK1 transcription factor-related protein 2-like [S... [more]
pnx5.571e-2153.93homeobox protein CHOX-7-like [Source:NCBI gene;Acc... [more]
gbx11.175e-1949.38gastrulation brain homeobox 1 [Source:NCBI gene;Ac... [more]
gbx23.615e-1960.32gastrulation brain homeobox 2 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
barhl23.465e-1757.38BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
barhl25.161e-1757.38BarH-like homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-050... [more]
MSX11.533e-1646.15msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
ENSPMAT00000001141.12.580e-1657.14pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
hoxd4a4.821e-1656.90homeobox D4a [Source:NCBI gene;Acc:30329][more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO24.630e-633.72Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
NK-19.437e-3674.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388916.400e-1966.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324959.363e-1962.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434021.717e-1863.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471641.475e-1662.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx1.2lb3.908e-3489.39NK1 homeobox 1 [Source:NCBI gene;Acc:101166641][more]
nkx1.2lb6.275e-3489.39NK1 homeobox 1 [Source:NCBI gene;Acc:101166641][more]
nkx1.2la1.381e-3387.69NK1 homeobox 2 [Source:NCBI gene;Acc:101168069][more]
gbx11.450e-1961.90gastrulation brain homeobox 1 [Source:NCBI gene;Ac... [more]
gbx24.707e-1960.32gastrulation brain homeobox 2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041571.10.000e+0100.00SMESG000041571.1[more]
SMESG000051002.16.098e-3385.07SMESG000051002.1[more]
SMESG000077917.11.282e-2957.98SMESG000077917.1[more]
SMESG000019482.11.497e-1743.65SMESG000019482.1[more]
SMESG000022963.11.221e-1656.72SMESG000022963.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005805 ID=SMED30005805|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=939bp
ACCCATTTGTAATAATCGTTGCGAAGTGAATATAGATAATTATTAAACCC
AACCTATCAGCATTCAGTTTGATCGTTTGCGATTATAAGTGAGACTTTTA
AAATCACTGCATCTACTTTCAGTTGAGATTTTTCTATGCCTAATCATCCG
TTTCAAATAGACAATTTACTTTCAAAAACATTAGATGATGAAGGTTCAGC
ATTCGAAGATTCATATCATTATTCAGAACTAGTGAAATGTAGAGTCGGTG
AAGAATACTCCTGGAACTCAAATTCCAAAAGCTGCTCACCAAATCAAAGC
AATAATTCACTGAAACTGAAGTCAAGGAGGGCCAGGACGGCATTCACATA
TGAACAACTTGTTTCGTTGGAAAACAAATTTAAATCAACAAGATATTTAT
CAGTATGTGAAAGATTAAATTTAGCTCATTCATTGCAGCTCACAGAAATT
CAAGTGAAAATTTGGTTTCAAAATCGACGAACGAAATGGAAAAAACAAAA
TCCCGGCTCAGATGTCCATCATTATCAGAACTCATCTAAAAAAACCGAAC
TCTCATTGCCTCAAAGGCCCTCTTCAAAAAATGAGAAAAATTGTTCATTT
GGATTCGTGAATGAAAGAAACAATAAAAGCAAACCACGGACGAATTCCAC
GACGAGCAATCCAGCATCACTCCATGAATCCTCACCGACACCTCTCCATC
AGGGAATCTACCAATATCCATTTTATAAAAATACATATGATTCTACTCAC
TGGTTAAATTCTGCAACTACTAATCCCTATAATTGGGTGTCATCAGGAAT
ATCAAATTTTCAGAACTGTCCAGGTGTATCATACTCAGATCTTTTGTTGA
ATTACTCAAACATTATGTAACATTTGCAAATGTTTTCGCTTTCTTTATTG
AAAATCTGTAATAATTTGATTTTGTTAATTAAAATATTG
back to top

protein sequence of SMED30005805-orf-1

>SMED30005805-orf-1 ID=SMED30005805-orf-1|Name=SMED30005805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=245bp
MPNHPFQIDNLLSKTLDDEGSAFEDSYHYSELVKCRVGEEYSWNSNSKSC
SPNQSNNSLKLKSRRARTAFTYEQLVSLENKFKSTRYLSVCERLNLAHSL
QLTEIQVKIWFQNRRTKWKKQNPGSDVHHYQNSSKKTELSLPQRPSSKNE
KNCSFGFVNERNNKSKPRTNSTTSNPASLHESSPTPLHQGIYQYPFYKNT
YDSTHWLNSATTNPYNWVSSGISNFQNCPGVSYSDLLLNYSNIM*
back to top
Aliases
The feature 'Homeobox domain-containing protein' has the following synonyms
Synonym
nkx1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000136whole organism
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 100..110
score: 66.04
coord: 85..96
score: 37.37
coord: 110..119
score: 79.45
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 63..125
e-value: 1.7E-23
score: 94.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 64..120
e-value: 3.3E-21
score: 74.9
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 61..121
score: 20.342
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 64..122
e-value: 8.36226E-20
score: 78.054
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 35..122
e-value: 2.8E-25
score: 90.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 125..184
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 121..184
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 45..162
NoneNo IPR availablePANTHERPTHR24340:SF37NK1 HOMEOBOX 1coord: 45..162
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 96..119
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 47..122