SMED30005802

Overview
NameSMED30005802
Smed IDSMED30005802
Length (bp)1977
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30005802 (SMED30005802) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30005802 (SMED30005802) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30005802 (SMED30005802) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30005802 (SMED30005802) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005802

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005802SMESG000072483.1 SmedASXL_015233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30005802SMESG000072483.1 SmedASXL_015233SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005802SMESG000072483.1 dd_Smed_v4_5611_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005802SMESG000072483.1 SMED30005802smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30005802SMESG000072483.1 SMED30005802smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30005802SMESG000072483.1 dd_Smed_v6_5611_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30005802 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000720:81634..86634 -9383
Homology
BLAST of SMED30005802 vs. Ensembl Human
Match: NCL (nucleolin [Source:HGNC Symbol;Acc:HGNC:7667])

HSP 1 Score: 52.373 bits (124), Expect = 2.345e-6
Identity = 54/209 (25.84%), Postives = 92/209 (44.02%), Query Frame = 1
Query:  820 DVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQS--------RSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLF--------PQAINIHWKVGDQVATIDYSNIEDCQ 1398
            DVR    +   YVD +  E ++K    L G K+  N++      K  D+    +   L+  NLP K T + LK V   A+E+R++     D K   +A+ ++    DA   ++ K G E +G  I++ +          R   N T S      K L +  ++ S T++ L+++F        PQ  N   K     A I++++ ED +
Sbjct:  340 DVRIGMTRKFGYVDFESAEDLEKALE-LTGLKVFGNEIK-LEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLV---SKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNSTWSG---ESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSK---GYAFIEFASFEDAK 537          
BLAST of SMED30005802 vs. UniProt/SwissProt
Match: sp|P20397|NUCL_XENLA (Nucleolin OS=Xenopus laevis OX=8355 GN=ncl PE=2 SV=3)

HSP 1 Score: 59.3066 bits (142), Expect = 9.721e-8
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 1
Query:  820 DVRRHQIKGNAYVDVQKPEQVQKYCSTLN----GFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQS-RSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIH----WKVGDQVATIDYSNIEDCQ 1398
            D+R    K   YVD    E+V+K          G ++K  K   F   K  +N    +   L + N+P  TTVE L+ +   A ++R+   K    K   +A+ ++   ++A    + K G E EG  I V F   +S  +  K     + K L +  ++ S T+D L+++F +A +I            A I++S+ ED +
Sbjct:  266 DIRIGNSKKFGYVDFSSEEEVEKALKLTGKKILGTEVKIEKAMAFDKNKTAENKKERDSRTLFVKNIPYSTTVEELQEIFENAKDIRIPTGKDGSNKG--IAYVEFSNEDEANKALEEKQGAEIEGRSIFVDFTGEKSQNSGNKKGPEGDSKVLVVNNLSYSATEDSLREVFEKATSIRIPQNQGRAKGFAFIEFSSAEDAK 465          
BLAST of SMED30005802 vs. TrEMBL
Match: A0A074YW95 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12082 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 6.339e-22
Identity = 70/262 (26.72%), Postives = 133/262 (50.76%), Query Frame = 1
Query:  640 FQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMP-LKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQA--INIHWKVGDQVATIDYSNIEDCQVDFKNS 1416
            F+K  E  PK+      +EV  R+ ++ + T  +  LP K N  + ++LIPD+ +  I ++   H+  G  YV+    + V++Y + L+G   ++  L+      + ++ D Y+C  LV+  L  KT V  + +    A+ ++     KK D++   +A+  +P  +DA+  +D +          N+ +  R     T+ +    +K L + G+ KS+T+ DL+ +FPQA  ++I  K G+  A + Y   EDC +D++N+
Sbjct:   70 FEKTIELDPKVA-----EEVVKRIEQKNSRTLCVSGLPPKTNLHLMEQLIPDIHTARIQWNTITHKCTGTVYVEFGSADMVEQYKAKLDGMTFQHKTLTAKTGNFLPESADRYDCKTLVLHGLHYKTHVGEIAKRFPSATSIKFSSDHKKWDRQRPALAYLTFPTPQDALLAFDTRQSCTIRRRRFNITWFLRK----TEEQQHPPRKCLFVRGLKKSVTETDLQSVFPQATSMSIQPKTGE--AYLHYDLEEDCVLDWQNA 320          
BLAST of SMED30005802 vs. TrEMBL
Match: A0A4S2KR80 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010641 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 4.415e-21
Identity = 72/281 (25.62%), Postives = 139/281 (49.47%), Query Frame = 1
Query:  583 NVSVENTKEKTEKTYNVEDFQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMP-LKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQA--INIHWKVGDQVATIDYSNIEDCQVDFKNS 1416
            N +V  ++E  E T+N   ++K  E  PK+      +E+  R+ ++ + T  +  LP K N  + ++LIPD+ +  I ++   H+  G  YV+    + V++Y + L+G   ++  L+      + ++ D Y+C  LV+  L  KT V  + +     + ++     KK D++   +A+  +P  +DA+  +D +          N+ +  R             +K L + G+ KS+T+ DL+ +FPQA  ++I  K G+  A + Y   EDC +D++N+
Sbjct:   42 NSAVRTSRE--ENTFN--PYEKTIELDPKVA-----EEIVKRIEQKNSRTLCVSGLPPKTNLHLMEQLIPDIHTARIQWNTITHKCTGIVYVEFGSADMVEQYKAKLDGMTFQHKTLTAKTGKFLPESADRYDCKTLVLHGLHYKTHVGEIAKRFPSTTSIKFSSDHKKWDRQRPALAYLTFPTPQDALLAFDTRQSCTIRRRRFNMTWFLRKTEQQHSP-----RKCLFVRGLKKSVTETDLQTVFPQAASVSIQPKTGE--AYLHYDLEEDCALDWQNA 306          
BLAST of SMED30005802 vs. TrEMBL
Match: A0A419PFE7 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_3928s PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.923e-18
Identity = 68/258 (26.36%), Postives = 132/258 (51.16%), Query Frame = 1
Query:  652 YEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMP-LKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQA--INIHWKVGDQVATIDYSNIEDCQVDFKNS 1416
            YE T +L+ + + +E+  R+ ++ + T  +  LP K N  + ++LIPD+ +  I ++   H+  G  YV+    + V++Y + L+G   ++  L+      + ++ D Y+C  LV+  L  KT V  + +     + ++     KK D++   +A+  +P  +DA+  +D +          N+ +  R  T    S     +K L + G+ KS+T+ DL+ +FPQA  ++I  K G+  A + Y   EDC +D++N+
Sbjct:   57 YEKTIELDPK-IAEEIVKRIEQKNSRTLCVSGLPPKTNLHLMEQLIPDIHTARIQWNTITHKCTGIVYVEFGSVDMVEQYKAKLDGMTFQHKTLTAKTGKFLPESADRYDCKTLVLHGLHYKTHVGEIAKRFPSTTSIKFSSDHKKWDRQRPALAYLTFPTPQDALLAFDTRQSCTIRRRRFNITWFLR-KTEQQHSP----RKCLFVRGLKKSVTETDLQSVFPQAASMSIQPKTGE--AYLHYDLEEDCVLDWQNA 306          
BLAST of SMED30005802 vs. TrEMBL
Match: A0A068W863 (Nucleolin OS=Echinococcus granulosus OX=6210 GN=EgrG_000805800 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.728e-18
Identity = 77/274 (28.10%), Postives = 133/274 (48.54%), Query Frame = 1
Query:  688 RKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRM---MPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIEDCQVDFKNSLKNK-PSPKMKIFYKFDKSQNPDKKKAA 1497
            R+ +  RL+ R   +  L NLP ++N+S   EL+PDMV+  + YD    + K   YV++   E   K  + +N  + +  +L+      + + VD+Y    L + NL  KTT   + R    +  + +   M     D++ + VA   +  VE+AI   D K G    G  ++V F  +      KSK+      L + G+ K+ T+D+++ LFPQA  +        A + Y+ IEDC++D KN++  +    K+KI +KF    + + +  A
Sbjct:   23 RESLAKRLVLRNMCSVKLSNLPKRYNYSALLELVPDMVACRVFYDPISRKPKNYVYVELSSNEIALKCVNKVNNKEFQGKRLNASVGGGLSECVDDYIPCSLRLYNLHWKTTKGEVARHFPGSISINIPTRMGRSCVDRRQSGVANLMFGTVEEAIAAVDEKQGCVIRGRRVSVHFCPKK----VKSKII----GLVVYGLKKTTTEDEVRALFPQASKVEMYPLGGFAVLHYALIEDCKLDKKNAMGAELKKRKLKIVFKFQSGNHEEMRPEA 288          
BLAST of SMED30005802 vs. TrEMBL
Match: A0A068YB53 (Nucleolin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000805800 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 8.709e-18
Identity = 76/274 (27.74%), Postives = 133/274 (48.54%), Query Frame = 1
Query:  688 RKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRM---MPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIEDCQVDFKNSLKNK-PSPKMKIFYKFDKSQNPDKKKAA 1497
            R+ +  RL+ R   +  L NLP ++N+S   EL+PDMV+  + YD    + K   YV++   E   K  + +N  + +  +L+      + + VD+Y    L + NL  KTT   + R    ++ + +   M     D++   VA   +  VE+AI   D K G    G  ++V F  +      KSK+      L + G+ K+ T+D+++ LFPQA  +        A + Y+ IEDC++D KN++  +    K+K+ +KF    + + +  A
Sbjct:   23 RESLAKRLVLRNMCSVKLANLPKRYNYSALLELVPDMVACRVFYDPISRKPKNYVYVELSSNEIALKCVNKVNNKEFQGKRLNASVGGGLSECVDDYIPCSLRLYNLHWKTTKGEVARHFPGSTSINIPTRMGRSCVDRRRPGVANLMFGTVEEAIAAVDEKQGCVIRGRRVSVHFCPKK----LKSKII----GLVVYGLKKTTTEDEVRALFPQASKVEMYPLGGFAVLHYALIEDCKLDKKNAMGAELKKRKLKVVFKFQSGNHEEMRPEA 288          
BLAST of SMED30005802 vs. Planmine SMEST
Match: SMESG000072483.1 (SMESG000072483.1)

HSP 1 Score: 898.656 bits (2321), Expect = 0.000e+0
Identity = 523/547 (95.61%), Postives = 530/547 (96.89%), Query Frame = 1
Query:   40 MVVKKQIAKSNVKLNKKPQNKQKVMFKKPXXXXXXXXXXXXXXXXMDEEELKKMLGNSSNSDLESDNFSEEEIKSTEAKVNKKRKLDSDDEVEDNTNKKSKTLDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXFINDNDEEVEISSKIDSTKTEKNITKDKIKVQNVKNDIPKPENVKKDNVSVENTKEKTEKTYNVEDFQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIEDCQVDFKNSLKNKPSPKMKIFYKFDKSQNPDKKKAASVNLEIEEKKGNVEXXXXXXXXXXXXXX-XXXXXXEGKNSNGVKKPNFKNSKQRTVKKIET 1677
            MVVKKQIAKSNVKLNKKPQNKQKVMFKKPVVVEESESEDNVSFDDMDEEELKKMLGNSSNSDLESD+FSEEEIKSTEAKVNKKRKL S    EDNTNKKSKTLD P EEDEVNSED DDSDEDD+EDEDMEDDSFINDNDEEVEISSKIDSTKTEK ITKDKIKVQNVKNDIPKPENVKKDNVSVENTKEKTEKTYNVEDFQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCF FTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIEDC+VDFKNSLKNKPSPKMKIFYKFDKSQNPDKKKAASVNLEIEEKKGNVENK ++D + N K   QKNSKFEGKNSNGVKKPNFKNSKQRTVKKIE+
Sbjct:    1 MVVKKQIAKSNVKLNKKPQNKQKVMFKKPVVVEESESEDNVSFDDMDEEELKKMLGNSSNSDLESDDFSEEEIKSTEAKVNKKRKLGS----EDNTNKKSKTLDEP-EEDEVNSEDTDDSDEDDNEDEDMEDDSFINDNDEEVEISSKIDSTKTEKIITKDKIKVQNVKNDIPKPENVKKDNVSVENTKEKTEKTYNVEDFQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELIPDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSCFAFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKSDKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKSKVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIEDCEVDFKNSLKNKPSPKMKIFYKFDKSQNPDKKKAASVNLEIEEKKGNVENKKSNDDKRNNKKNFQKNSKFEGKNSNGVKKPNFKNSKQRTVKKIES 542          
The following BLAST results are available for this feature:
BLAST of SMED30005802 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NCL2.345e-625.84nucleolin [Source:HGNC Symbol;Acc:HGNC:7667][more]
back to top
BLAST of SMED30005802 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P20397|NUCL_XENLA9.721e-826.24Nucleolin OS=Xenopus laevis OX=8355 GN=ncl PE=2 SV... [more]
back to top
BLAST of SMED30005802 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074YW956.339e-2226.72Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2KR804.415e-2125.62RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A419PFE71.923e-1826.36Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A068W8636.728e-1828.10Nucleolin OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
A0A068YB538.709e-1827.74Nucleolin OS=Echinococcus multilocularis OX=6211 G... [more]
back to top
BLAST of SMED30005802 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30005802 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072483.10.000e+095.61SMESG000072483.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005802 ID=SMED30005802|Name=SMED30005802|organism=Schmidtea mediterranea sexual|type=transcript|length=1977bp
TGATTATTTATCTTATATTTTTAAAAAACTCGTGTGAAAATGGTTGTTAA
AAAGCAAATTGCTAAAAGTAATGTAAAATTAAATAAAAAGCCACAAAACA
AGCAAAAGGTAATGTTTAAAAAACCTGTTGTAGTCGAAGAATCTGAATCT
GAGGATAATGTTTCTTTTGATGATATGGATGAAGAAGAATTAAAGAAGAT
GCTCGGTAATTCTAGTAATAGTGATTTGGAATCAGATAACTTTTCGGAAG
AAGAAATTAAATCAACCGAAGCCAAGGTTAACAAAAAACGAAAATTGGAC
AGTGACGATGAAGTTGAAGACAATACTAATAAAAAATCTAAAACATTAGA
CGTACCTGAAGAAGAAGATGAAGTTAATAGCGAGGATATCGATGATAGTG
ATGAAGATGATGACGAAGATGAAGACATGGAAGATGACAGCTTTATAAAT
GACAACGATGAAGAAGTTGAAATTTCATCGAAAATTGATTCAACTAAAAC
CGAAAAAAATATAACAAAGGATAAAATTAAAGTCCAAAATGTTAAGAATG
ATATTCCTAAACCTGAAAATGTTAAGAAAGATAATGTAAGTGTAGAAAAT
ACCAAGGAGAAAACTGAAAAAACATATAATGTGGAGGATTTTCAAAAAAT
CTACGAAGATACTCCAAAATTGGAAAGTGAAAGTTTAAGAAAAGAAGTTT
GCGACAGACTTCTTGAAAGAAAGAACAATACATTTATTCTTTTAAACCTA
CCATATAAATTCAACTTTTCAATGGCAAAGGAATTGATTCCAGATATGGT
TTCAATTATTATTCCATACGATGTTCGTAGGCATCAAATCAAAGGTAACG
CTTACGTCGATGTTCAGAAACCTGAACAGGTTCAAAAATACTGCTCTACA
TTAAATGGGTTTAAAATTAAAAACAACAAATTATCCTGCTTCCCATTCAC
AAAAGTTGATGATAACGTTGATAATTATAACTGCACCCGATTGGTTATTT
CAAATTTACCAGTTAAGACAACCGTCGAAGCTTTGAAAAGAGTCATGACA
AAAGCATCGGAGGTCAGAATGATGCCACTAAAAAAATCGGACAAAAAAAT
GACATTGGTAGCATTTGCTGATTACCCATGTGTCGAAGATGCCATTTTTG
ATTACGACAATAAGCACGGACTTGAGTTTGAAGGCTTCCCAATAAATGTC
AAATTTCAAAGTAGATCAAATACTAATGTTACAAAGTCAAAAGTCGCATT
CAACAAGAAAGCACTTCATATTTTGGGAATTAATAAATCAATAACCCAAG
ACGATTTGAAGAAATTATTTCCCCAGGCAATTAATATCCACTGGAAAGTC
GGAGATCAAGTGGCAACCATTGACTATTCAAACATTGAAGATTGTCAAGT
CGATTTCAAGAACTCATTGAAAAATAAACCTTCTCCTAAAATGAAAATAT
TTTATAAATTTGATAAGTCACAAAATCCCGACAAAAAGAAAGCCGCAAGT
GTCAACCTTGAAATTGAGGAGAAAAAGGGAAATGTTGAAAATAAATCAAA
TGATGATAAAAGGAATAATAAAAAGAATTTTCAAAAAAACTCGAAATTTG
AAGGTAAAAATTCAAATGGCGTAAAAAAACCAAATTTTAAAAATTCCAAA
CAAAGAACCGTAAAAAAGATAGAAACTGGAAAAGAATTGGCTGCAACAAT
AAATATACAAGAAAAACAAACCATTGATAAAACAAAAAAAGAAACTCAAA
AGGTTCTTAATGAGAAAGTTATGAAAAAAAATTTAAACAAAGATTTTAAA
AGTGATGAGAATAAAAAGAATAATGACAATACGATTAAAGGCGATCTTAT
TATCAAAAAGAGGGAAAAAAGAAAAATGAAAAAGCTTTTAAAGAAAAAGC
TTAAAAAAGCTAAAAATGAATAAATGAAAAAATTAACAAAGGATTTTATT
GTTTAATAAAATTAATCGTTTCTTTTG
back to top

protein sequence of SMED30005802-orf-1

>SMED30005802-orf-1 ID=SMED30005802-orf-1|Name=SMED30005802-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=628bp
MVVKKQIAKSNVKLNKKPQNKQKVMFKKPVVVEESESEDNVSFDDMDEEE
LKKMLGNSSNSDLESDNFSEEEIKSTEAKVNKKRKLDSDDEVEDNTNKKS
KTLDVPEEEDEVNSEDIDDSDEDDDEDEDMEDDSFINDNDEEVEISSKID
STKTEKNITKDKIKVQNVKNDIPKPENVKKDNVSVENTKEKTEKTYNVED
FQKIYEDTPKLESESLRKEVCDRLLERKNNTFILLNLPYKFNFSMAKELI
PDMVSIIIPYDVRRHQIKGNAYVDVQKPEQVQKYCSTLNGFKIKNNKLSC
FPFTKVDDNVDNYNCTRLVISNLPVKTTVEALKRVMTKASEVRMMPLKKS
DKKMTLVAFADYPCVEDAIFDYDNKHGLEFEGFPINVKFQSRSNTNVTKS
KVAFNKKALHILGINKSITQDDLKKLFPQAINIHWKVGDQVATIDYSNIE
DCQVDFKNSLKNKPSPKMKIFYKFDKSQNPDKKKAASVNLEIEEKKGNVE
NKSNDDKRNNKKNFQKNSKFEGKNSNGVKKPNFKNSKQRTVKKIETGKEL
AATINIQEKQTIDKTKKETQKVLNEKVMKKNLNKDFKSDENKKNNDNTIK
GDLIIKKREKRKMKKLLKKKLKKAKNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 479..499
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..406
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 366..410
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 450..478
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 366..390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 479..499
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 450..499
NoneNo IPR availableCDDcd00590RRM_SFcoord: 189..259
e-value: 6.7815E-5
score: 39.2105
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 279..344
e-value: 2.2
score: 3.5
coord: 188..259
e-value: 0.006
score: 25.8
coord: 102..172
e-value: 1.4
score: 5.2
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 187..263
score: 8.825
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 181..263
e-value: 2.9E-8
score: 35.8
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 107..264