Transposon Ty3-G Gag-Pol polyprotein

Overview
NameTransposon Ty3-G Gag-Pol polyprotein
Smed IDSMED30005796
Length (bp)1796
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-G Gag-Pol polyprotein (SMED30005796) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-G Gag-Pol polyprotein (SMED30005796) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005796

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30005796 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005796 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005796 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30005796 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.986e-13
Identity = 34/94 (36.17%), Postives = 56/94 (59.57%), Query Frame = 2
Query:  869 EKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            +K+D  +R C+D+  LN +T +  +P+P++    + L G++ F+ ++L NAY+ V + E  + KTAF T  G F +   PFG+  APA   A V
Sbjct:  557 KKKDGSLRPCIDYRGLNDITVKNRYPLPLMSSAFELLQGAKVFTKLDLRNAYHLVRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQALV 650          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 73.559 bits (179), Expect = 4.940e-13
Identity = 35/99 (35.35%), Postives = 58/99 (58.59%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            G    +K+D  +R C+D+  LN +T +  +P+P++    + L G+ +F+ ++L NAY+ V + E  + KTAF T  G F +   PFG++ APA   A V
Sbjct:  563 GFFFVKKKDGSLRPCIDYRGLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALV 661          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR855320.1 (pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENSDARG00000099359.2 transcript:ENSDART00000159655.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR855320.1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.053e-12
Identity = 33/94 (35.11%), Postives = 57/94 (60.64%), Query Frame = 2
Query:  869 EKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            +K+D  +R C+D+  LN +T +  +P+P++    + L G+ +F+ ++L NAY+ V +    + K+AF T  G F +   PFG++ APA   AFV
Sbjct:  570 KKKDGSLRPCIDYRGLNNITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRAGDEWKSAFNTPRGHFEYCVLPFGLSNAPAVFQAFV 663          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: CR925755.2 (pep chromosome:GRCz11:17:42486740:42492668:-1 gene:ENSDARG00000116402.1 transcript:ENSDART00000183946.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR925755.2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.596e-12
Identity = 33/94 (35.11%), Postives = 56/94 (59.57%), Query Frame = 2
Query:  869 EKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            +K+D  +R C+D+  LN +T +  +P+P++    + L G+ +F+ ++L NAY+ V +    + KTAF T  G F +   PFG++ APA   A V
Sbjct:  541 KKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALV 634          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Match: BX546500.1 (pep chromosome:GRCz11:23:12926092:12931693:-1 gene:ENSDARG00000086495.3 transcript:ENSDART00000122176.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX546500.1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.620e-12
Identity = 34/99 (34.34%), Postives = 57/99 (57.58%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            G    +K+D  +R C+D+  LN +T +  +P+P++    + L G+ +F+ ++L NAY+ V +    + KTAF T  G F +   PFG++ APA   A V
Sbjct:  537 GFFFVKKKDGSLRPCIDYRGLNSITVKNTYPLPLMSSAFERLQGANFFTKLDLRNAYHLVRIRPGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQALV 635          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 81.2629 bits (199), Expect = 3.300e-18
Identity = 36/87 (41.38%), Postives = 53/87 (60.92%), Query Frame = 2
Query:  884 RLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            R C+D+  LN VT    +PMP ++E+LD L  ++Y +T++L   Y+Q+ LA  +Q K+AF T  G + F   PFG+  APAT    V
Sbjct:  388 RFCVDYRRLNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQRLV 474          

HSP 2 Score: 31.5722 bits (70), Expect = 3.300e-18
Identity = 21/91 (23.08%), Postives = 43/91 (47.25%), Query Frame = 3
Query:  606 LKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMT-TEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L + ++ ++  ++      F  N    G+T+  +HK+ T T+ PI     R +  +  ++   I  +    +I   + PW +P+V V KK+
Sbjct:  297 LHLSQQDQLRKILRSYSPMFSANP---GRTHWAEHKVDTGTQLPIRSPAYRVAEAVRPEMKSQIDEMLAFGVITPSHSPWASPVVLVPKKD 384          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000006041.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:6:37317867:37322724:1 gene:ENSXETG00000003070.1 transcript:ENSXETT00000006041.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 3.347e-18
Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            IR+C+D+  LN+ T   ++  P IE+ L+ L GS++FS ++L + YYQ+ +  E + KTAF    G F FNR P G+  APAT
Sbjct:  376 IRMCVDYRTLNQRTIPDQYTTPRIEDALNCLVGSKWFSVLDLRSGYYQLPMHPEDKEKTAFICPLGFFEFNRMPQGLCGAPAT 458          

HSP 2 Score: 35.8094 bits (81), Expect = 3.347e-18
Identity = 28/94 (29.79%), Postives = 48/94 (51.06%), Query Frame = 3
Query:  603 VLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEE---NSIIRKCNFPWNTPMVCV*KKN 875
            V+  + KS +   + ++   F +N  D+G +   KHKI   E   F +  R+ A     ++D  ++LEE     II++   P+ +P+V V KKN
Sbjct:  282 VIPPEWKSRLRKHLNEHSALFSRNDLDMGCSTSTKHKIRLREDKPFRERSRRIA--PGDLEDLRKHLEELKAAGIIKESRSPYASPIVVVRKKN 373          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Match: ENSXETT00000015952.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:63280736:63282565:1 gene:ENSXETG00000009808.1 transcript:ENSXETT00000015952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 1.642e-17
Identity = 43/97 (44.33%), Postives = 62/97 (63.92%), Query Frame = 2
Query:  845 HTNGMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            + + + I  K+D  IRLC+D+  LN+ T   ++ +P IEE L+ LNGS++F+ ++L + YYQV +A E Q KTAF    G + F R P GI  APAT
Sbjct:  460 YASPIVIVRKKDGSIRLCVDYRTLNRRTVPDQYTLPRIEETLEALNGSKWFTVMDLRSGYYQVPMASEDQEKTAFICPLGFYQFTRMPQGICGAPAT 556          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 84.7297 bits (208), Expect = 1.018e-16
Identity = 40/98 (40.82%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  842 EHTNGMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            E ++ + +  K D  IR C DF  LN+V++   +PMP ++E+++ L  +RY +T++L   Y+QV L E ++ KTAF T  GQ+ + R PFG+  APAT
Sbjct:  270 EWSSPIVLVPKPDGSIRFCNDFRKLNEVSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPAT 367          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Match: castor1 (cytosolic arginine sensor for mTORC1 subunit 1 [Source:Xenbase;Acc:XB-GENE-960689])

HSP 1 Score: 80.4925 bits (197), Expect = 4.877e-15
Identity = 38/99 (38.38%), Postives = 59/99 (59.60%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIAFV 1144
            G    EK+D  +R C+D+  LNK+T +  +P+P+I E+ D L G++ FS ++L  AY  + + E  + KTAF T+ G + +   PFG+  APA    FV
Sbjct:  559 GFFFVEKKDGGLRPCIDYRGLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQEFV 657          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.789e-18
Identity = 36/86 (41.86%), Postives = 55/86 (63.95%), Query Frame = 2
Query:  872 KQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            KQ  R+ +D+  LN++T     P+P ++E+L  L    YF+TI+L   ++Q+E+  ES +KTAF TK G + + R PFG+  APAT
Sbjct:  259 KQKFRIVIDYRKLNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPAT 344          

HSP 2 Score: 35.039 bits (79), Expect = 1.789e-18
Identity = 22/65 (33.85%), Postives = 35/65 (53.85%), Query Frame = 3
Query:  693 TNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKNKIS 884
            TN  KH I T    P++ K     A+ E++++  I+++    IIR  N P+N+P+  V KK   S
Sbjct:  194 TNQTKHTINTKHNLPLYSKYSYPQAY-EQEVESQIQDMLNQGIIRTSNSPYNSPIWVVPKKQDAS 257          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.974e-18
Identity = 35/82 (42.68%), Postives = 57/82 (69.51%), Query Frame = 2
Query:  884 RLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            R+ +D+  LN++T    +P+P ++E+L  L   +YF+TI+L   ++Q+E+ EES +KTAF TK+G + + R PFG+  APAT
Sbjct:  262 RVVIDYRKLNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPAT 343          

HSP 2 Score: 33.8834 bits (76), Expect = 1.974e-18
Identity = 19/61 (31.15%), Postives = 34/61 (55.74%), Query Frame = 3
Query:  693 TNILKHKIMTTE-GPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KK 872
            TN +KH + TT   PI+ K    +   E ++++ ++ +    +IR+ N P+N+P   V KK
Sbjct:  192 TNTIKHVLNTTHNSPIYSKQYPLAQTHEIEVENQVQEMLNQGLIRESNSPYNSPTWVVPKK 252          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.219e-15
Identity = 33/87 (37.93%), Postives = 57/87 (65.52%), Query Frame = 2
Query:  869 EKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +K+  RL +D+  +NK     +FP+P I+++LD L  ++YFS ++L + ++Q+EL E S++ T+F T  G + F R PFG+  AP +
Sbjct:  366 DKKKWRLVIDYRQINKKLLADKFPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNS 452          

HSP 2 Score: 29.6462 bits (65), Expect = 2.219e-15
Identity = 20/86 (23.26%), Postives = 42/86 (48.84%), Query Frame = 3
Query:  621 KSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            KS++ N+  + I  F      I   N+ K ++ +  + P++ K  R      E+I   ++ L ++ I+      +N+P++ V KK+
Sbjct:  276 KSQLENICSEYIDIFALESEPITVNNLYKQQLRLKDDEPVYTKNYRSPHSQVEEIQAQVQKLIKDKIVEPSVSQYNSPLLLVPKKS 361          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.665e-15
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 2
Query:  869 EKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPA 1126
            EKQ  R+ +DF  LN VT    +P+P I   L +L  ++YF+T++L + ++Q+ + E    KTAF T  G++ F R PFG+  APA
Sbjct:  175 EKQ-YRMVVDFKRLNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPA 259          

HSP 2 Score: 33.4982 bits (75), Expect = 5.665e-15
Identity = 17/52 (32.69%), Postives = 29/52 (55.77%), Query Frame = 3
Query:  723 TEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKNK 878
            T+ PI+ K      ++  +++  I  L ++ IIR  N P+N+P+  V KK K
Sbjct:  120 TQDPIYAKSYPYPVNMRGEVERQIDELLQDGIIRPSNSPYNSPIWIVPKKPK 171          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|P31843|RRPO_OENBE (RNA-directed DNA polymerase homolog OS=Oenothera berteroana OX=3950 PE=4 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.904e-13
Identity = 30/84 (35.71%), Postives = 54/84 (64.29%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            +R+C+D+ AL KVT + ++P+P ++++ D L  + +F+ ++L + Y+QV +A+  + KT   T+ G F F   PFG+  A AT 
Sbjct:    6 LRMCIDYRALTKVTIKNKYPIPRVDDLFDRLAQATWFTKLDLRSGYWQVRIAKGDEPKTTCVTRYGSFEFRVMPFGLTNALATF 89          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Match: A0A3B4EL91 (Uncharacterized protein OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.555e-27
Identity = 39/83 (46.99%), Postives = 59/83 (71.08%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +R C+D+  LN+VT +  +P+P I+E LD+L  +++FST++L + Y+QVE+A + + KTAF TK G F FN  PFG+  AP T
Sbjct:  364 LRFCVDYRKLNEVTRKDVYPLPRIDEALDSLANAQWFSTLDLASGYWQVEVASKDKCKTAFTTKHGLFEFNVLPFGLTNAPGT 446          

HSP 2 Score: 62.7734 bits (151), Expect = 5.555e-27
Identity = 32/109 (29.36%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  573 DSMRLKRTIEVLKIDRKS-------EIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            D   +   +  L++D K         I  L+  N+  F +N+ D+G+T++  H+I T    P+ + P+R   HL++++ D I++++E  II+    PW  P+V V KK+
Sbjct:  253 DGWTIDDLVAQLRLDEKGFTSSQMRAIRGLLGDNLSVFSRNEADLGRTHLTLHEIDTGLAKPVRLAPRRVPLHLQQEVSDHIKDMQEQGIIQPSCSPWAAPVVPVRKKD 361          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Match: A0A5S6QHB1 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.110e-26
Identity = 47/95 (49.47%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            G+    K+D  +RLC+D+  LN+V+ R  +P+P I+E L+ L G+RYFSTI+L + Y+QVEL E ++ KTAF T  G F FN  PFG+  APAT 
Sbjct:  590 GIVPVRKKDGSLRLCVDYRKLNEVSRRDAYPIPRIDETLEALAGARYFSTIDLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPATF 684          

HSP 2 Score: 51.9878 bits (123), Expect = 1.110e-26
Identity = 30/91 (32.97%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  606 LKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEK-IDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L   ++ +++ ++ K   AF  +++DIG+T++LKH I+T        P R+ A +E K +   I+ L +N II   N PW   +V V KK+
Sbjct:  508 LTASQRKKLHGMLSKFRNAFAASEFDIGRTSVLKHDIVTDNIRPVRHPLRRLAPVERKEVSQLIQRLLDNKIIEPSNSPWAAGIVPVRKKD 598          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Match: A0A5S6Q2I3 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.235e-26
Identity = 47/95 (49.47%), Postives = 65/95 (68.42%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            G+    K+D  +RLC+D+  LN+V+ R  +P+P I+E L+ L G+RYFSTI+L + Y+QVEL E ++ KTAF T  G F FN  PFG+  APAT 
Sbjct:  590 GIVPVRKKDGSLRLCVDYRKLNEVSRRDAYPIPRIDETLEALAGARYFSTIDLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPATF 684          

HSP 2 Score: 51.9878 bits (123), Expect = 1.235e-26
Identity = 30/91 (32.97%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  606 LKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEK-IDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L   ++ +++ ++ K   AF  +++DIG+T++LKH I+T        P R+ A +E K +   I+ L +N II   N PW   +V V KK+
Sbjct:  508 LTASQRKKLHGMLSKFRNAFAASEFDIGRTSVLKHDIVTDNIRPVRHPLRRLAPVERKEVSQLIQRLLDNKIIEPSNSPWAAGIVPVRKKD 598          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Match: A0A5S6QD89 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.564e-26
Identity = 47/94 (50.00%), Postives = 65/94 (69.15%), Query Frame = 2
Query:  854 GMCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            G+    K+D  +RLC+D+  LN+V+ R  +P+P I+E L+ L G+RYFSTI+L + Y+QVEL E ++ KTAF T  G F FN  PFG+  APAT
Sbjct:  252 GIVPVRKKDGSLRLCVDYRKLNEVSRRDAYPIPRIDETLEALAGARYFSTIDLLSGYWQVELTEAAKEKTAFITHDGLFQFNVMPFGLTGAPAT 345          

HSP 2 Score: 51.6026 bits (122), Expect = 1.564e-26
Identity = 30/91 (32.97%), Postives = 51/91 (56.04%), Query Frame = 3
Query:  606 LKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEK-IDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L   ++ +++ ++ K   AF  +++DIG+T++LKH I+T        P R+ A +E K +   I+ L +N II   N PW   +V V KK+
Sbjct:  170 LTASQQKKLHGMLSKFRNAFAASEFDIGRTSVLKHDIVTDNIRPVRHPLRRLAPVERKEVSQLIQRLLDNKIIEPSNSPWAAGIVPVRKKD 260          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Match: G7YPA7 (Retrovirus-related Pol polyprotein from transposon 17.6 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_105421 PE=4 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.815e-26
Identity = 34/88 (38.64%), Postives = 61/88 (69.32%), Query Frame = 2
Query:  866 EEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            ++  ++R+C+D+  LN +T R   P+P +++ +D + G+++FST++L + Y+QVE+A + + KTAF   +G + F   PFG+A APAT
Sbjct:  469 KKHGNLRMCIDYRRLNDITTRDSLPLPRVDDTIDAVAGAKWFSTLDLASGYWQVEVAPQDRPKTAFIIPSGLYEFETMPFGLANAPAT 556          

HSP 2 Score: 63.929 bits (154), Expect = 1.815e-26
Identity = 52/220 (23.64%), Postives = 93/220 (42.27%), Query Frame = 3
Query:  234 FLLDTGARINVXXXXXXXXXXXXXXKNQNAGVSCANGSPLQIVGKTTLHVPMNNKSAKIEFIIAEKVYPKILN*FGIYL*IQRKDEEVYDIEVINNQEKV--LCTIDAHFGGEINDSMRLKRTI---EVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            FLLDTGA  +V+              +    +  ANG+PLQ  G  +  V +       +F  A   +  IL        +    +    I+ ++ Q     LC  +  F   +  S    + +        + K  I  L+ +   +F  ++  +G+T++L+H I T    P++  P+R   H   K+D  I+ + ++ IIR  + PW +P+V   KK+
Sbjct:  261 FLLDTGASCSVVGAREFWPRCRQPAASTK--LITANGTPLQTAGTASFSVSIGQLCTHHQFYCAPVTWEAILG-------MDFLKKYKASIDFVSGQITFDNLCPPNPGFLSTVEHSSHWAQPLVECSPAPPEAKYGIMELLNEFTTSFDTHRSKLGRTHVLQHTIDTGHHRPMYQTPRRVPIHYRAKLDAMIQEMLDDGIIRPSSSPWASPIVLAKKKH 471          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 9.693e-24
Identity = 38/83 (45.78%), Postives = 58/83 (69.88%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +R+C+D+  LN  + R  FP+P +EE L+ L  ++YFST++L + Y+QVE+AE  ++KTAF T  G F  NR PFG+  +P+T
Sbjct:  288 LRICMDYRKLNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPST 370          

HSP 2 Score: 41.9726 bits (97), Expect = 9.693e-24
Identity = 25/79 (31.65%), Postives = 39/79 (49.37%), Query Frame = 3
Query:  642 IEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQ-SAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            I KN   F K+  D G T ++KH+I   +   F  P R+      + +   I  +EE  +IR    P+ +P+V V KK+
Sbjct:  207 ILKNSDVFSKHHLDYGHTTVVKHEIPLVDPRPFRLPYRKIPPSQYQAVRKAITEMEEAGVIRPSKSPYASPIVVVTKKD 285          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000037150.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:22265216:22268869:1 gene:ENSAMXG00000033912.1 transcript:ENSAMXT00000037150.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 9.865e-24
Identity = 42/91 (46.15%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  857 MCIEEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +  ++   +RLC+D+  LN  T R  +P+P IEE LD L G+++FST++L + Y QV ++E+ + KTAF T  G F FNR PFG+  APAT
Sbjct:  365 LVTKKDGSLRLCVDYRQLNAKTRRDAYPLPRIEESLDALAGAKWFSTLDLASGYNQVPVSEKDRYKTAFCTPFGLFEFNRMPFGLCNAPAT 455          

HSP 2 Score: 39.2762 bits (90), Expect = 9.865e-24
Identity = 25/94 (26.60%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  597 IEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            IE L  ++ + +  L ++    F + + D+G T +L H+I +  E P+    +R      E +   I+ L ++ +IR    P+++P+V V KK+
Sbjct:  277 IEGLSEEQMAAVSLLFDQYQDIFAQTEGDLGCTTLLTHEIPLLDEVPVRQPYRRIPPSQYEAVKLHIQQLLDSKVIRNSASPYSSPIVLVTKKD 370          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.1225 bits (222), Expect = 4.472e-23
Identity = 41/91 (45.05%), Postives = 60/91 (65.93%), Query Frame = 2
Query:  857 MCIEEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +  ++   +RLC+D+  LN  T R  +P+P IEE LD L G+++FST++L + Y QV + E+ ++KTAF T  G F FNR PFG+  AP T
Sbjct:  349 LVTKKDGSLRLCVDYRQLNAKTRRDSYPLPRIEESLDALCGAKWFSTLDLASGYNQVPVEEKDKSKTAFCTPFGLFEFNRMPFGLCNAPGT 439          

HSP 2 Score: 38.1206 bits (87), Expect = 4.472e-23
Identity = 22/80 (27.50%), Postives = 45/80 (56.25%), Query Frame = 3
Query:  639 LIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L +K    F K++ D+G T+++ H+I +  E P+    +R        +   I+ L ++ +IR+ + P+++P+V V KK+
Sbjct:  275 LFQKYSNIFAKSEGDLGCTSLISHEIPLLDEVPVRQPYRRIPPSQYSTVKAHIQQLLDSRVIRESSSPFSSPIVLVTKKD 354          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000048272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000106.1:219951:223307:1 gene:ENSAMXG00000032559.1 transcript:ENSAMXT00000048272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 2.560e-22
Identity = 35/88 (39.77%), Postives = 59/88 (67.05%), Query Frame = 2
Query:  866 EEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            ++ Q  RLC+D+ ALN  T +  +P+P I++ L+TL+ +++FST++L + Y+QV L   ++   AF ++ G F +N  PFG+  APAT
Sbjct:  123 KKDQTYRLCVDYRALNARTVKDAYPLPRIQDTLETLSTAKWFSTLDLASGYWQVALTPRARKAVAFCSRKGLFTWNVMPFGLCNAPAT 210          

HSP 2 Score: 43.8986 bits (102), Expect = 2.560e-22
Identity = 24/96 (25.00%), Postives = 48/96 (50.00%), Query Frame = 3
Query:  594 TIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKNK 878
            +  VL  + + E+  L+      F     D+G+T++++H I    G P+  +P+R +   + + D  I+   E+ +    N  W +P+V V KK++
Sbjct:   31 SAAVLSANDRLELAQLLSTYGDVFSTGPTDLGRTSLVQHDIQLLPGPPVKQQPRRMAFEKQIESDAQIQQSLESGLASPSNSSWASPIVLVRKKDQ 126          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Match: ENSAMXT00000052546.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:13031363:13036570:1 gene:ENSAMXG00000033629.1 transcript:ENSAMXT00000052546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.8777 bits (198), Expect = 3.948e-21
Identity = 36/92 (39.13%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  857 MCIEEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            + I++   +R C D+  LN+VT +  +P+P +EE LD L  +++FST++L   Y+QV + +  + KTA  T  G F ++R PFG+  APAT 
Sbjct:  764 IVIKKDGTVRFCCDYRRLNQVTCKDAYPLPRVEESLDALGNAQWFSTLDLTAGYFQVAVKDSDREKTAVTTPFGLFQWSRMPFGLCNAPATF 855          

HSP 2 Score: 40.817 bits (94), Expect = 3.948e-21
Identity = 23/84 (27.38%), Postives = 44/84 (52.38%), Query Frame = 3
Query:  627 EIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            E+ +L+EK+   F K+  D G T  + H I T +  P+  + +R    + ++    +++L +  I+ +   PW +P V V KK+
Sbjct:  686 ELMDLLEKHKDIFSKSDSDFGYTTAVTHSIPTGDAPPVKQRHRRVPPQVFQEFKKHVQSLVDRGILEESCSPWASPAVIVIKKD 769          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 40.4318 bits (93), Expect = 6.214e-8
Identity = 19/44 (43.18%), Postives = 28/44 (63.64%), Query Frame = 3
Query: 1206 YVLQWKTFQLYLSVVLQVTEIFRAVKFHQSSIFKN*IDTNTQLR 1337
            YV+  +T +LY S+ L+VT++ R + F +S   K  ID NT LR
Sbjct: 1302 YVVHHETLKLYESLGLKVTKVHRGITFEESGWLKTYIDLNTSLR 1345          

HSP 2 Score: 30.8018 bits (68), Expect = 6.214e-8
Identity = 11/26 (42.31%), Postives = 22/26 (84.62%), Query Frame = 1
Query: 1342 SKNNLDKNYFTLLNNSLKGKTVKNLK 1419
            + N+ +K++F L+NNS+ GKT++N++
Sbjct: 1348 ATNDFEKDFFKLMNNSVFGKTMENIR 1373          

HSP 3 Score: 22.7126 bits (47), Expect = 6.214e-8
Identity = 11/37 (29.73%), Postives = 18/37 (48.65%), Query Frame = 2
Query: 1499 NLISILLGKESQCLDRPSYIDQTVPNLSKLCTYPLQY 1609
            NL +I + K     ++P Y+   + +LSK   Y   Y
Sbjct: 1405 NLAAIHMRKTRLVFNKPVYLGMCILDLSKNLMYDFHY 1441          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.3445 bits (207), Expect = 1.169e-24
Identity = 38/92 (41.30%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  857 MCIEEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            M  ++ Q  RLC+D+  LN  T +  +P+P I++ LDTL+ ++YFST++L + Y+QVE+   ++   AF T+ G F +N  PFG+  APAT 
Sbjct:  874 MVKKKDQSPRLCVDYRPLNDRTIKDAYPLPRIQDTLDTLSTAKYFSTLDLTSGYWQVEMTPRARKAAAFCTRKGLFEWNVMPFGLCNAPATF 965          

HSP 2 Score: 49.2914 bits (116), Expect = 1.169e-24
Identity = 25/89 (28.09%), Postives = 45/89 (50.56%), Query Frame = 3
Query:  615 DRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEG-PIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKNK 878
            + +  +  L+      F     D+G+TN+++H I+TT G  +  +P+R S   +E  D  ++   E  + R  N  W  P+V V KK++
Sbjct:  792 ESRYRLAGLLRSYSDVFSAGSTDLGRTNVVQHDILTTPGSAVKQQPRRMSREKQEAADQQVQQSLEAGLARHSNSSWAAPIVMVKKKDQ 880          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000039099.1 (pep primary_assembly:ASM223467v1:16:31928608:31932747:-1 gene:ENSORLG00000023909.1 transcript:ENSORLT00000039099.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 2.607e-24
Identity = 42/83 (50.60%), Postives = 59/83 (71.08%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +RLC+D+  LN  T +  FP+P IEE LD L+G+R+FST++L + Y+QV +AE  + KTAF T  G F +NR PFG+  AP+T
Sbjct:  397 LRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPST 479          

HSP 2 Score: 39.2762 bits (90), Expect = 2.607e-24
Identity = 21/94 (22.34%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  597 IEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            +  L    + ++  L+ K +  F  ++ D+G T+++ H+I +  + P+  + +R          + I NL ++ +IR+ + P+ +P+V + KK+
Sbjct:  301 LSALSAGEQEKVRTLLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKD 394          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000029819.1 (pep primary_assembly:ASM223467v1:24:6358775:6362914:-1 gene:ENSORLG00000022361.1 transcript:ENSORLT00000029819.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 3.337e-24
Identity = 42/83 (50.60%), Postives = 59/83 (71.08%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +RLC+D+  LN  T +  FP+P IEE LD L+G+R+FST++L + Y+QV +AE  + KTAF T  G F +NR PFG+  AP+T
Sbjct:  397 LRLCVDYRQLNSRTRKDAFPLPRIEESLDALSGARWFSTLDLASGYHQVAVAEADRPKTAFCTPFGLFEWNRMPFGLCNAPST 479          

HSP 2 Score: 38.891 bits (89), Expect = 3.337e-24
Identity = 21/94 (22.34%), Postives = 50/94 (53.19%), Query Frame = 3
Query:  597 IEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            +  L    + ++  L+ K +  F  ++ D+G T+++ H+I +  + P+  + +R          + I NL ++ +IR+ + P+ +P+V + KK+
Sbjct:  301 LSALSAGEQEKVRALLGKYLTVFSLHEGDLGCTSLITHEIPLVDDAPVRQRYRRIPPSDYVAAKEHINNLLQSQVIRESSSPFASPIVLIRKKD 394          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000037906.1 (pep primary_assembly:ASM223467v1:16:28643737:28647831:-1 gene:ENSORLG00000027277.1 transcript:ENSORLT00000037906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 1.135e-22
Identity = 43/93 (46.24%), Postives = 63/93 (67.74%), Query Frame = 2
Query:  857 MCIEEKQD--IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            + I  K+D  +RLC+D+  LN  T +  FP+P I+E LD L+G+++FST++L + Y+QV +AE+ + KTAF T  G F F R PFG+  AP T
Sbjct:  392 LVIVHKKDGSLRLCVDYRQLNANTRKDAFPLPRIDESLDALHGAKWFSTLDLASGYHQVGMAEKDRCKTAFCTPFGLFEFTRMPFGLCNAPGT 484          

HSP 2 Score: 35.039 bits (79), Expect = 1.135e-22
Identity = 26/91 (28.57%), Postives = 54/91 (59.34%), Query Frame = 3
Query:  606 LKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKI-MTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
            L +++  ++  L++K+   F K++ D+G TN+++H+I +  E PI  + +R      E++   I  L +  II + + P+++P+V V KK+
Sbjct:  309 LTVEQTRKVRELLKKHEDVFAKSELDLGFTNLIEHEIPVLNEAPIKQRYRRIPPSQYEEVKAHITQLLQQGIISESSSPYSSPLVIVHKKD 399          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Match: ENSORLT00000034814.1 (uncharacterized LOC111946697 [Source:NCBI gene;Acc:111946697])

HSP 1 Score: 87.8113 bits (216), Expect = 1.739e-21
Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            IR+C+D+  LN  T   ++  P IEE LD+L+GS++FS ++L + YYQ+ +AEE + KTAF    G F F R P GI  APAT 
Sbjct:  900 IRMCIDYRLLNSRTVPDQYTTPCIEEALDSLSGSKWFSVLDLRSGYYQIAMAEEDKEKTAFICPLGFFQFERMPQGITGAPATF 983          

HSP 2 Score: 35.039 bits (79), Expect = 1.739e-21
Identity = 22/76 (28.95%), Postives = 41/76 (53.95%), Query Frame = 3
Query:  657 KAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEE---NSIIRKCNFPWNTPMVCV*KKN 875
            + F   +WD+G    ++H I  ++   F +  R+ A  +  I+D  ++L+E     II++   P+ +P+V V KKN
Sbjct:  824 QVFSVQEWDVGLAKDVEHTIRLSDPSPFRQRSRRLAPAD--IEDVRKHLQELLGAGIIKESRSPYASPIVIVRKKN 897          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.094e-77
Identity = 102/241 (42.32%), Postives = 143/241 (59.34%), Query Frame = 3
Query:  174 YNEMCVRPSMIIKIGKIWRSFLLDTGARINVXXXXXXXXXXXXXXKNQNAGVSCANGSPLQIVGKTTLHVPMNNKSAKIEFIIAEKVYPKILN*FGIYL*IQRKDEEVYDIE---VINNQEK---VLCTIDAHFGGEINDSMRLKRTIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKNK 878
            YN M  RPS  + I       LLDTGARINV+ + +I+ L   EI      + CAN S L+ +GK  ++V M +    + FII + + P+I+   G+ L      + ++ IE   ++   EK    +C I+A FG  I D  RL+  I+VLK+     +  + + N   FM +KWDIG TN++KHKI+T   PI IKP+RQ  +LE+KI++ I+NLE N IIRKCN PWNTP+VCV KK K
Sbjct: 2543 YNIMQGRPSTTLDIQGRKVDCLLDTGARINVMAKSVIDRLENIEILETRESLRCANNSRLETMGKLNINVKMGSMERNVTFIIVKNLIPEIIG--GVEL------QRLFGIELKCILEEHEKRSDFICEIEARFGRIITDEERLRHAIDVLKVTGNKRLLEIFQANKNVFMADKWDIGCTNLIKHKIITKGEPIMIKPRRQPINLEDKIEEAIKNLENNGIIRKCNSPWNTPLVCVWKKEK 2775          

HSP 2 Score: 145.206 bits (365), Expect = 1.094e-77
Identity = 66/89 (74.16%), Postives = 77/89 (86.52%), Query Frame = 2
Query:  866 EEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATL 1132
            +EK+DIRLCLDF  LNK+TERQ FPMP ++E+LD L+GSRYFS+I+LGNAYYQV+L +ESQ KTAF TK GQFCFNR PFGIAAAP T 
Sbjct: 2773 KEKKDIRLCLDFRQLNKITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTF 2861          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000001439.1 (SMESG000001439.1)

HSP 1 Score: 231.491 bits (589), Expect = 3.229e-73
Identity = 119/149 (79.87%), Postives = 130/149 (87.25%), Query Frame = 3
Query:  387 MNNKSAKIEFIIAEKVYPKI------LN*FGIYL*IQRKDEEVYDIEVINNQEKVLCTIDAHFGGEINDSMRLKRTIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENS 815
            MNNKSAKIEFIIAEKVY KI      LN FGIYL I+RK EEVY+IEVINNQEKV+CTIDAHFG EINDSM+LK+T+EVLKIDRKSE+YNLIEKNIKAFM+NKWDIGKTNILKHKI  TEGPI +KP+RQ AHLEEKID  I+N EEN 
Sbjct:    1 MNNKSAKIEFIIAEKVYQKIIAGICLLNEFGIYLSIRRKYEEVYNIEVINNQEKVICTIDAHFGDEINDSMKLKKTMEVLKIDRKSEVYNLIEKNIKAFMENKWDIGKTNILKHKITKTEGPILVKPRRQPAHLEEKIDYAIKNFEENE 149          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000081257.1 (SMESG000081257.1)

HSP 1 Score: 109.768 bits (273), Expect = 4.213e-42
Identity = 51/83 (61.45%), Postives = 62/83 (74.70%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            +R+CLDF  LN VTE+  FPMP ++ +LD L  S+ F +I+LG AYY VEL E SQ KTAF TK GQFCFNR PFG++ APAT
Sbjct:  502 VRICLDFRLLNSVTEKFSFPMPDMQLLLDCLGKSKIFYSIDLGQAYYLVELNENSQIKTAFSTKEGQFCFNRLPFGLSTAPAT 584          

HSP 2 Score: 82.0333 bits (201), Expect = 4.213e-42
Identity = 55/170 (32.35%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  360 VGKTTLHVPMNNKSAKIEFIIAEKVYPKILN*FGIYL*IQRKDEEVYDIEV--INNQEKVLCTIDAHFGGEINDSMRLKRTIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV 863
            +G   +    N K  ++  II  K++P  +   G+         +++ +E+  +NN E  L  ++  F     DS RLK T+  LK+D+ SE+  LI +    FM +++D+G T ++ H++ T+  PI   P+ Q  HLE K+++ ++NL E  ++RKC  PWNTP+V V
Sbjct:  340 LGSVKIVAKWNKKFRELNVIIVRKIHPNFIG--GV------DTMKIFGMELKEVNNIESSL--VNKRF----TDSDRLKNTLLTLKLDKNSELGTLISQFSNIFMASRFDLGHTKVITHELKTSGPPILQNPRGQPMHLEAKVEELVQNLLEAGVVRKCQSPWNTPLVIV 495          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000062996.1 (SMESG000062996.1)

HSP 1 Score: 105.916 bits (263), Expect = 1.519e-41
Identity = 50/83 (60.24%), Postives = 60/83 (72.29%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            IR+CLDF  LN VTE+  FP+P ++ +LD L  S  FS+I+L  AYYQVEL E SQ K  F TK GQFCFNR PFG++ APAT
Sbjct:  146 IRMCLDFRLLNSVTEKFSFPIPEMQLLLDCLGKSMIFSSIDLRQAYYQVELNENSQIKAEFSTKEGQFCFNRLPFGLSTAPAT 228          

HSP 2 Score: 83.5741 bits (205), Expect = 1.519e-41
Identity = 43/103 (41.75%), Postives = 67/103 (65.05%), Query Frame = 3
Query:  567 INDSMRLKRTIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
              DS RLK T+  LK+D+ S++  LI +    FM +++D+G T ++ H+I T+  PI   P+RQ  HLE K+++ ++NL E  ++RKC  PWNTP+V V K +
Sbjct:   41 FTDSDRLKNTLLTLKLDKISKLGTLISQFTSIFMASRFDLGHTKVITHEIKTSGPPILQNPRRQPMHLEGKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPD 143          
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000062996.1 (SMESG000062996.1)

HSP 1 Score: 105.531 bits (262), Expect = 2.598e-41
Identity = 50/83 (60.24%), Postives = 60/83 (72.29%), Query Frame = 2
Query:  881 IRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRYFSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPAT 1129
            IR+CLDF  LN VTE+  FP+P ++ +LD L  S  FS+I+L  AYYQVEL E SQ K  F TK GQFCFNR PFG++ APAT
Sbjct:  160 IRMCLDFRLLNSVTEKFSFPIPEMQLLLDCLGKSMIFSSIDLRQAYYQVELNENSQIKAEFSTKEGQFCFNRLPFGLSTAPAT 242          

HSP 2 Score: 83.1889 bits (204), Expect = 2.598e-41
Identity = 43/103 (41.75%), Postives = 67/103 (65.05%), Query Frame = 3
Query:  567 INDSMRLKRTIEVLKIDRKSEIYNLIEKNIKAFMKNKWDIGKTNILKHKIMTTEGPIFIKPKRQSAHLEEKIDDTIRNLEENSIIRKCNFPWNTPMVCV*KKN 875
              DS RLK T+  LK+D+ S++  LI +    FM +++D+G T ++ H+I T+  PI   P+RQ  HLE K+++ ++NL E  ++RKC  PWNTP+V V K +
Sbjct:   55 FTDSDRLKNTLLTLKLDKISKLGTLISQFTSIFMASRFDLGHTKVITHEIKTSGPPILQNPRRQPMHLEGKVEELVQNLLEAGVVRKCQSPWNTPLVIVGKPD 157          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX890543.11.986e-1336.17pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
BX511082.14.940e-1335.35pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
CR855320.11.053e-1235.11pep chromosome:GRCz11:1:7956030:7961696:1 gene:ENS... [more]
CR925755.21.596e-1235.11pep chromosome:GRCz11:17:42486740:42492668:-1 gene... [more]
BX546500.11.620e-1234.34pep chromosome:GRCz11:23:12926092:12931693:-1 gene... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa63.300e-1841.38annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000006041.13.347e-1843.37pep primary_assembly:Xenopus_tropicalis_v9.1:6:373... [more]
ENSXETT00000015952.11.642e-1744.33pep primary_assembly:Xenopus_tropicalis_v9.1:8:632... [more]
alkbh51.018e-1640.82alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
castor14.877e-1538.38cytosolic arginine sensor for mTORC1 subunit 1 [So... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04323|POL3_DROME1.789e-1841.86Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME1.974e-1842.68Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME2.219e-1537.93Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME5.665e-1540.70Retrovirus-related Pol polyprotein from transposon... [more]
sp|P31843|RRPO_OENBE5.904e-1335.71RNA-directed DNA polymerase homolog OS=Oenothera b... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4EL915.555e-2746.99Uncharacterized protein OS=Pygocentrus nattereri O... [more]
A0A5S6QHB11.110e-2649.47Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q2I31.235e-2649.47Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6QD891.564e-2650.00Uncharacterized protein OS=Trichuris muris OX=7041... [more]
G7YPA71.815e-2638.64Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034038.19.693e-2445.78pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000037150.19.865e-2446.15pep primary_assembly:Astyanax_mexicanus-2.0:10:222... [more]
ENSAMXT00000041754.14.472e-2345.05pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048272.12.560e-2239.77pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052546.13.948e-2139.13pep primary_assembly:Astyanax_mexicanus-2.0:2:1303... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO461096.214e-843.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040305.11.169e-2441.30pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000039099.12.607e-2450.60pep primary_assembly:ASM223467v1:16:31928608:31932... [more]
ENSORLT00000029819.13.337e-2450.60pep primary_assembly:ASM223467v1:24:6358775:636291... [more]
ENSORLT00000037906.11.135e-2246.24pep primary_assembly:ASM223467v1:16:28643737:28647... [more]
ENSORLT00000034814.11.739e-2147.62uncharacterized LOC111946697 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Transposon Ty3-G Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.11.094e-7742.32SMESG000029259.1[more]
SMESG000001439.13.229e-7379.87SMESG000001439.1[more]
SMESG000081257.14.213e-4261.45SMESG000081257.1[more]
SMESG000062996.11.519e-4160.24SMESG000062996.1[more]
SMESG000062996.12.598e-4160.24SMESG000062996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005796 ID=SMED30005796|Name=Transposon Ty3-G Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=1796bp
ATAATGTTATTAGTAGAAATAAAAGTATTAATAATTTAAGTGATAATAAT
AGAATTGTATTAAATAATAGTAATTATGAGTGCATTTATAATTTTGAGAA
CGGATATGAGAAAATACTAAACGAAAAACTAGTCAATTAAAAAAATGTAA
AGTTTAATAATAGTAAAATAGAATATAATGAAATGTGTGTTAGACCGAGT
ATGATTATTAAAATTGGAAAAATATGGAGAAGTTTCCTTTTAGATACAGG
AGCCAGAATAAATGTCATTGATGAAGAGATAATTGAAGAATTAAGAGAAG
CAGAGATTAAAAACCAAAATGCGGGAGTGAGTTGTGCAAATGGCAGTCCA
TTGCAAATTGTAGGAAAAACTACCCTTCATGTTCCTATGAACAACAAAAG
CGCTAAAATAGAATTTATTATAGCAGAAAAGGTATACCCAAAAATTTTAA
ATTAATTTGGCATTTATCTATAAATTCAAAGGAAAGATGAGGAAGTGTAT
GACATAGAAGTTATAAATAATCAGGAAAAAGTTCTTTGTACAATAGATGC
ACATTTTGGTGGGGAAATAAATGATAGCATGAGACTAAAGAGAACCATTG
AAGTTCTAAAAATTGATAGGAAATCAGAAATATATAATTTAATTGAAAAG
AATATCAAAGCGTTTATGAAAAATAAATGGGACATTGGAAAAACAAATAT
TTTAAAGCATAAAATTATGACAACAGAAGGTCCGATTTTTATAAAACCAA
AGAGACAGTCAGCGCATTTAGAAGAAAAAATTGACGACACAATAAGAAAT
TTGGAAGAAAATAGCATAATTAGAAAATGTAATTTTCCATGGAACACACC
AATGGTATGTGTATAGAAGAAAAACAAGATATCAGATTATGTTTAGATTT
TTGGGCGTTAAACAAAGTGACAGAAAGGCAGGAATTTCCAATGCCTATTA
TTGAAGAAATGTTAGATACATTAAATGGATCACGATATTTTAGCACAATT
GAATTAGGAAATGCGTATTATCAGGTAGAGCTAGCAGAAGAGTCACAGAA
TAAGACAGCATTTTACACAAAAGCAGGTCAGTTTTGTTTCAATCGAACGC
CTTTTGGTATAGCGGCAGCCCCAGCAACATTAATAGCCTTTGTGAAAGTA
TCATGATATATCTTAAACTCGAGAAGTTGATGGTCAAACATCTGTAGAAA
AAAACTATGTTCTTCAATGGAAAACTTTCCAACTTTATCTTTCTGTTGTG
CTACAGGTAACTGAAATTTTTAGAGCCGTAAAGTTTCACCAGTCTTCAAT
ATTTAAGAATTAAATTGATACAAATACTCAACTTCGAGTTGTCAAAAAAT
AATCTCGATAAAAACTATTTTACACTTCTAAACAATTCTTTAAAGGGTAA
GACAGTTAAGAACTTGAAATTTGAGATTGTGTATTCGGCTTCAAAATAAA
TTTCTATTTCCTTTAAACCTACATTTAACAAGACATAAAATTGATTACAA
TTTAATTTCTATTTTATTAGGTAAGGAATCACAGTGTTTGGATAGACCTA
GTTACATTGACCAAACTGTACCAAATCTTTCCAAATTATGTACGTATCCG
TTGCAATATATTAATTTACAAAAATATTGAGATGAATTTAATTGCTAATA
ATTTTTGAAGATAACTATTAAAAATAAGTTGTTTAATTTTATCTTTGTCA
TAATGATCCATTCTGACTGTATCGAAAAGTATTTCTTCATCATCCGCTAA
CGAAGTTGTGTTTGCTACAGCAATATATTTAGATTGAACAAAGACA
back to top

protein sequence of SMED30005796-orf-1

>SMED30005796-orf-1 ID=SMED30005796-orf-1|Name=SMED30005796-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=106bp
MEHTNGMCIEEKQDIRLCLDFWALNKVTERQEFPMPIIEEMLDTLNGSRY
FSTIELGNAYYQVELAEESQNKTAFYTKAGQFCFNRTPFGIAAAPATLIA
FVKVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0008270zinc ion binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043128Rev_trsase/Diguanyl_cyclase
IPR021109Peptidase_aspartic_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR043128Reverse transcriptase/Diguanylate cyclase domainGENE3DG3DSA:3.30.70.270coord: 30..101
e-value: 1.5E-29
score: 104.9
NoneNo IPR availableGENE3DG3DSA:3.10.10.10coord: 10..92
e-value: 1.5E-29
score: 104.9
NoneNo IPR availablePANTHERPTHR24559:SF313coord: 15..97
NoneNo IPR availablePANTHERPTHR24559FAMILY NOT NAMEDcoord: 15..97
NoneNo IPR availableCDDcd01647RT_LTRcoord: 7..97
e-value: 1.16889E-35
score: 117.696
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 12..100