Tafazzin family protein

Overview
NameTafazzin family protein
Smed IDSMED30005783
Length (bp)1187
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tafazzin family protein (SMED30005783) t-SNE clustered cells

Violin plots show distribution of expression levels for Tafazzin family protein (SMED30005783) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tafazzin family protein (SMED30005783) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tafazzin family protein (SMED30005783) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005783

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005783SMESG000048217.1 dd_Smed_v4_6026_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tafazzin family protein vs. Ensembl Human
Match: TAZ (tafazzin [Source:HGNC Symbol;Acc:HGNC:11577])

HSP 1 Score: 144.436 bits (363), Expect = 6.109e-40
Identity = 91/260 (35.00%), Postives = 130/260 (50.00%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + +  R    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNREVLY-ELIEKRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHN 256          
BLAST of Tafazzin family protein vs. Ensembl Human
Match: TAZ (tafazzin [Source:HGNC Symbol;Acc:HGNC:11577])

HSP 1 Score: 142.895 bits (359), Expect = 4.160e-39
Identity = 93/277 (33.57%), Postives = 132/277 (47.65%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI-----------------HSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + +  R    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R                   H    G     G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNREVLY-ELIEKRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHN 286          
BLAST of Tafazzin family protein vs. Ensembl Human
Match: TAZ (tafazzin [Source:HGNC Symbol;Acc:HGNC:11577])

HSP 1 Score: 142.124 bits (357), Expect = 7.843e-39
Identity = 82/225 (36.44%), Postives = 117/225 (52.00%), Query Frame = 2
Query:  251 RNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            R    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   75 RGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHN 274          
BLAST of Tafazzin family protein vs. Ensembl Human
Match: TAZ (tafazzin [Source:HGNC Symbol;Acc:HGNC:11577])

HSP 1 Score: 141.354 bits (355), Expect = 8.875e-39
Identity = 84/241 (34.85%), Postives = 119/241 (49.38%), Query Frame = 2
Query:  251 RNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI-----------------HSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAH 910
            R    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R                   H    G     G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H
Sbjct:   30 RGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLH 258          
BLAST of Tafazzin family protein vs. Ensembl Human
Match: TAZ (tafazzin [Source:HGNC Symbol;Acc:HGNC:11577])

HSP 1 Score: 133.265 bits (334), Expect = 2.685e-35
Identity = 93/295 (31.53%), Postives = 134/295 (45.42%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIH----------------------------------SRETGDLLMH--GLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAH 910
            V MG+VG  S F    M H      +    + +  R    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R                                     +R +   L    G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNREVLY-ELIEKRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKASPGFQPARSSQHWLQKEGGDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLH 304          
BLAST of Tafazzin family protein vs. Ensembl Celegans
Match: acl-3 (Tafazzin family protein [Source:UniProtKB/TrEMBL;Acc:Q23598])

HSP 1 Score: 118.242 bits (295), Expect = 2.461e-30
Identity = 80/252 (31.75%), Postives = 125/252 (49.60%), Query Frame = 2
Query:  152 VSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPD----QLYKLSSSKETWAKITQHIQDSFYDLRQQ 895
            ++M +V SV KLM +  +  LI  NK        N N+P+IT+ NH S  DD  +   +          R R+TL A ++CFT    +  F  G+C+P  R             G GV Q  M++ +D+LN   W++++P+GK+     TL+ E LR KWG+GRL+ + K  P+I+P+W   ME++ P   PY+            VT+ IG+   L D     L K  ++++    IT  +Q   Y L ++
Sbjct:   35 MTMSLVTSVSKLMFLGGSNKLICHNKETFVKILENPNQPLITVSNHRSNIDDPLMWCILKFREFWRYKDRNRYTLAAHNICFTKQFHTTMFSLGRCVPCVR-------------GEGVYQKGMDFCVDMLNDNKWVHIFPEGKVC----TLESEPLRFKWGIGRLVMDAKTDPVILPVWCKEMEKVWPTQPPYY------PKFGNTVTVHIGEPFFLSDLKKTVLSKSLTTEQMRKIITDEVQTRMYQLGEK 263          
BLAST of Tafazzin family protein vs. Ensembl Celegans
Match: acl-3 (Tafazzin family protein [Source:UniProtKB/TrEMBL;Acc:Q23598])

HSP 1 Score: 118.242 bits (295), Expect = 2.461e-30
Identity = 80/252 (31.75%), Postives = 125/252 (49.60%), Query Frame = 2
Query:  152 VSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPD----QLYKLSSSKETWAKITQHIQDSFYDLRQQ 895
            ++M +V SV KLM +  +  LI  NK        N N+P+IT+ NH S  DD  +   +          R R+TL A ++CFT    +  F  G+C+P  R             G GV Q  M++ +D+LN   W++++P+GK+     TL+ E LR KWG+GRL+ + K  P+I+P+W   ME++ P   PY+            VT+ IG+   L D     L K  ++++    IT  +Q   Y L ++
Sbjct:   35 MTMSLVTSVSKLMFLGGSNKLICHNKETFVKILENPNQPLITVSNHRSNIDDPLMWCILKFREFWRYKDRNRYTLAAHNICFTKQFHTTMFSLGRCVPCVR-------------GEGVYQKGMDFCVDMLNDNKWVHIFPEGKVC----TLESEPLRFKWGIGRLVMDAKTDPVILPVWCKEMEKVWPTQPPYY------PKFGNTVTVHIGEPFFLSDLKKTVLSKSLTTEQMRKIITDEVQTRMYQLGEK 263          
BLAST of Tafazzin family protein vs. Ensembl Fly
Match: Taz (gene:FBgn0026619 transcript:FBtr0087863)

HSP 1 Score: 149.828 bits (377), Expect = 3.289e-42
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  131 PSKGWRKVSMGIVGSV--FK--LMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK--ETWAK--ITQHIQDSFYDLRQQTIRAHQK 916
            PSK W  VS  +V +V  F   ++   +   + N+ +LI  +  R    P++T+ NH S  DD  + G  LP+ ++ NT ++RW++ A D+CFT+ L S FFM G+CIPV R             G+GV Q ++N  ++    G WI+++P+GK+      + +E LRLKWGVGR+I E  + PII+P+WH GM+ + P V+PY           K+VT+ +G  + L D +  L   +  E  A+  IT  IQ++F DLR +T + H++
Sbjct:   32 PSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWG-CLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVR-------------GIGVYQDAINLCIEKAALGHWIHVFPEGKV-----NMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQR------GKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRE 276          
BLAST of Tafazzin family protein vs. Ensembl Fly
Match: Taz (gene:FBgn0026619 transcript:FBtr0302455)

HSP 1 Score: 149.828 bits (377), Expect = 3.289e-42
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  131 PSKGWRKVSMGIVGSV--FK--LMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK--ETWAK--ITQHIQDSFYDLRQQTIRAHQK 916
            PSK W  VS  +V +V  F   ++   +   + N+ +LI  +  R    P++T+ NH S  DD  + G  LP+ ++ NT ++RW++ A D+CFT+ L S FFM G+CIPV R             G+GV Q ++N  ++    G WI+++P+GK+      + +E LRLKWGVGR+I E  + PII+P+WH GM+ + P V+PY           K+VT+ +G  + L D +  L   +  E  A+  IT  IQ++F DLR +T + H++
Sbjct:   32 PSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWG-CLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVR-------------GIGVYQDAINLCIEKAALGHWIHVFPEGKV-----NMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQR------GKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRE 276          
BLAST of Tafazzin family protein vs. Ensembl Fly
Match: Taz (gene:FBgn0026619 transcript:FBtr0087864)

HSP 1 Score: 149.443 bits (376), Expect = 1.979e-41
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  131 PSKGWRKVSMGIVGSV--FK--LMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK--ETWAK--ITQHIQDSFYDLRQQTIRAHQK 916
            PSK W  VS  +V +V  F   ++   +   + N+ +LI  +  R    P++T+ NH S  DD  + G  LP+ ++ NT ++RW++ A D+CFT+ L S FFM G+CIPV R             G+GV Q ++N  ++    G WI+++P+GK+      + +E LRLKWGVGR+I E  + PII+P+WH GM+ + P V+PY           K+VT+ +G  + L D +  L   +  E  A+  IT  IQ++F DLR +T + H++
Sbjct:   92 PSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWG-CLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVR-------------GIGVYQDAINLCIEKAALGHWIHVFPEGKV-----NMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQR------GKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRE 336          
BLAST of Tafazzin family protein vs. Ensembl Fly
Match: Taz (gene:FBgn0026619 transcript:FBtr0087862)

HSP 1 Score: 149.828 bits (377), Expect = 4.301e-41
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  131 PSKGWRKVSMGIVGSV--FK--LMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK--ETWAK--ITQHIQDSFYDLRQQTIRAHQK 916
            PSK W  VS  +V +V  F   ++   +   + N+ +LI  +  R    P++T+ NH S  DD  + G  LP+ ++ NT ++RW++ A D+CFT+ L S FFM G+CIPV R             G+GV Q ++N  ++    G WI+++P+GK+      + +E LRLKWGVGR+I E  + PII+P+WH GM+ + P V+PY           K+VT+ +G  + L D +  L   +  E  A+  IT  IQ++F DLR +T + H++
Sbjct:  132 PSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWG-CLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVR-------------GIGVYQDAINLCIEKAALGHWIHVFPEGKV-----NMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQR------GKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRE 376          
BLAST of Tafazzin family protein vs. Ensembl Zebrafish
Match: taz (tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684])

HSP 1 Score: 152.525 bits (384), Expect = 2.858e-43
Identity = 95/273 (34.80%), Postives = 145/273 (53.11%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMSMK-HXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK----ETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            Q P  GWR   +V MG+VGS   L +   +++ + N++ L++ V  R  + P+IT+ NH S  DD  I G +L    L N ++MRWT TASD+CFT    S FF  G+C+PV R             G GV Q  M++ L+ LN G WI+++P+G++      +  E +R+KWG+GRLI+EC   PII+P+WH GM  + P   PY           +++T+++G    +   +  L +      E    +T +IQD F  L+ Q    H + 
Sbjct:   11 QCPRLGWRISSRVVMGMVGSYSYLWTKYFNSLMVHNQDVLLNLVDERPQDTPLITVCNHQSCMDDPHIWG-VLKFRQLWNLNKMRWTPTASDICFTREFHSSFFSRGKCVPVVR-------------GDGVYQKGMDFLLERLNQGEWIHIFPEGRV-----NMSGEFMRIKWGIGRLIAECSLHPIILPMWHIGMNDVLPNETPY------IPRVGQRITVLVGKPFTVRHLVNALRAENTNPTEMRKTVTDYIQDEFRSLKAQAEALHHRL 258          
BLAST of Tafazzin family protein vs. Ensembl Zebrafish
Match: taz (tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684])

HSP 1 Score: 152.525 bits (384), Expect = 2.858e-43
Identity = 95/273 (34.80%), Postives = 145/273 (53.11%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMSMK-HXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK----ETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            Q P  GWR   +V MG+VGS   L +   +++ + N++ L++ V  R  + P+IT+ NH S  DD  I G +L    L N ++MRWT TASD+CFT    S FF  G+C+PV R             G GV Q  M++ L+ LN G WI+++P+G++      +  E +R+KWG+GRLI+EC   PII+P+WH GM  + P   PY           +++T+++G    +   +  L +      E    +T +IQD F  L+ Q    H + 
Sbjct:   11 QCPRLGWRISSRVVMGMVGSYSYLWTKYFNSLMVHNQDVLLNLVDERPQDTPLITVCNHQSCMDDPHIWG-VLKFRQLWNLNKMRWTPTASDICFTREFHSSFFSRGKCVPVVR-------------GDGVYQKGMDFLLERLNQGEWIHIFPEGRV-----NMSGEFMRIKWGIGRLIAECSLHPIILPMWHIGMNDVLPNETPY------IPRVGQRITVLVGKPFTVRHLVNALRAENTNPTEMRKTVTDYIQDEFRSLKAQAEALHHRL 258          
BLAST of Tafazzin family protein vs. Ensembl Zebrafish
Match: taz (tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684])

HSP 1 Score: 93.9745 bits (232), Expect = 1.383e-22
Identity = 66/193 (34.20%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMSMK-HXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWH 691
            Q P  GWR   +V MG+VGS   L +   +++ + N++ L++ V  R  + P+IT+ NH S  DD  I G +L    L N ++MRWT TASD+CFT    S FF  G+C+PV                                             V G   +  E +R+KWG+GRLI+EC   PII+P+WH
Sbjct:   11 QCPRLGWRISSRVVMGMVGSYSYLWTKYFNSLMVHNQDVLLNLVDERPQDTPLITVCNHQSCMDDPHIWG-VLKFRQLWNLNKMRWTPTASDICFTREFHSSFFSRGKCVPV---------------------------------------------VRGRVNMSGEFMRIKWGIGRLIAECSLHPIILPMWH 157          
BLAST of Tafazzin family protein vs. Ensembl Zebrafish
Match: taz (tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684])

HSP 1 Score: 92.4337 bits (228), Expect = 5.184e-22
Identity = 61/155 (39.35%), Postives = 88/155 (56.77%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMSMK-HXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQG 577
            Q P  GWR   +V MG+VGS   L +   +++ + N++ L++ V  R  + P+IT+ NH S  DD  I G +L    L N ++MRWT TASD+CFT    S FF  G+C+PV R             G GV Q  M++ L+ LN G WI+++P+G
Sbjct:   11 QCPRLGWRISSRVVMGMVGSYSYLWTKYFNSLMVHNQDVLLNLVDERPQDTPLITVCNHQSCMDDPHIWG-VLKFRQLWNLNKMRWTPTASDICFTREFHSSFFSRGKCVPVVR-------------GDGVYQKGMDFLLERLNQGEWIHIFPEG 151          
BLAST of Tafazzin family protein vs. Ensembl Xenopus
Match: taz (tafazzin [Source:NCBI gene;Acc:549220])

HSP 1 Score: 135.576 bits (340), Expect = 1.021e-36
Identity = 82/225 (36.44%), Postives = 116/225 (51.56%), Query Frame = 2
Query:  251 RNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            R  + P+ITI NH S  DD  + G +L +  L N  RMRWT TA+D+CFT  L S FF  G+C+PV R  +  E                      LN G WI+++P+GK+      + +E +RLKWG+GRLI+E    PII+PLWH GM  + P   PY           ++VT+++G    L   L KL     S++E   ++T +IQ  F+ L+      HQ
Sbjct:   57 RRPDTPLITISNHQSCMDDPHLWG-ILKLKHLWNLHRMRWTPTAADICFTQELHSLFFSLGKCVPVCRGRYCHE------------------KCPRLNCGDWIHVFPEGKV-----NMSQECVRLKWGIGRLIAESSLNPIILPLWHVGMNDVLPNEPPY------VPRWGQRVTVLVGRPFSLESVLKKLRSENRSAEEMRKELTDYIQVEFHKLKSPAETLHQ 251          
BLAST of Tafazzin family protein vs. Ensembl Xenopus
Match: taz (tafazzin [Source:NCBI gene;Acc:549220])

HSP 1 Score: 126.716 bits (317), Expect = 1.971e-33
Identity = 74/197 (37.56%), Postives = 102/197 (51.78%), Query Frame = 2
Query:  251 RNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKET 841
            R  + P+ITI NH S  DD  + G +L +  L N  RMRWT TA+D+CFT  L S FF  G+C+PV R  +  E                      LN G WI+++P+GK+      + +E +RLKWG+GRLI+E    PII+PLWH GM  + P   PY           ++VT+++G    L   L KL S   +
Sbjct:   57 RRPDTPLITISNHQSCMDDPHLWG-ILKLKHLWNLHRMRWTPTAADICFTQELHSLFFSLGKCVPVCRGRYCHE------------------KCPRLNCGDWIHVFPEGKV-----NMSQECVRLKWGIGRLIAESSLNPIILPLWHVGMNDVLPNEPPY------VPRWGQRVTVLVGRPFSLESVLKKLRSENRS 223          
BLAST of Tafazzin family protein vs. Ensembl Mouse
Match: Taz (tafazzin [Source:MGI Symbol;Acc:MGI:109626])

HSP 1 Score: 148.673 bits (374), Expect = 9.159e-42
Identity = 93/262 (35.50%), Postives = 132/262 (50.38%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H  F
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFIQEEFQRLKMQAEQLHNHF 258          
BLAST of Tafazzin family protein vs. Ensembl Mouse
Match: Taz (tafazzin [Source:MGI Symbol;Acc:MGI:109626])

HSP 1 Score: 144.05 bits (362), Expect = 5.536e-40
Identity = 93/263 (35.36%), Postives = 132/263 (50.19%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKW-GVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KW G+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H  F
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWVGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFIQEEFQRLKMQAEQLHNHF 259          
BLAST of Tafazzin family protein vs. Ensembl Mouse
Match: Taz (tafazzin [Source:MGI Symbol;Acc:MGI:109626])

HSP 1 Score: 126.716 bits (317), Expect = 1.104e-33
Identity = 86/262 (32.82%), Postives = 123/262 (46.95%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+G                   +GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H  F
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEG-------------------IGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSTLPVLERLRAENKSAVEMRKALTDFIQEEFQRLKMQAEQLHNHF 244          
BLAST of Tafazzin family protein vs. Ensembl Mouse
Match: Taz (tafazzin [Source:MGI Symbol;Acc:MGI:109626])

HSP 1 Score: 124.405 bits (311), Expect = 2.659e-33
Identity = 72/182 (39.56%), Postives = 99/182 (54.40%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWH 691
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWH 184          
BLAST of Tafazzin family protein vs. Ensembl Mouse
Match: Taz (tafazzin [Source:MGI Symbol;Acc:MGI:109626])

HSP 1 Score: 118.242 bits (295), Expect = 2.734e-31
Identity = 63/149 (42.28%), Postives = 86/149 (57.72%), Query Frame = 2
Query:  248 NRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKW-GVGRLISECKEKPIIIPLWH 691
            NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KW G+GRLI+EC   PII+PLWH
Sbjct:   32 NRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWVGIGRLIAECHLNPIILPLWH 161          
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Match: sp|Q9V6G5|TAZ_DROME (Tafazzin homolog OS=Drosophila melanogaster OX=7227 GN=Taz PE=2 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 4.311e-40
Identity = 97/270 (35.93%), Postives = 152/270 (56.30%), Query Frame = 2
Query:  131 PSKGWRKVSMGIVGSV--FK--LMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK--ETWAK--ITQHIQDSFYDLRQQTIRAHQK 916
            PSK W  VS  +V +V  F   ++   +   + N+ +LI  +  R    P++T+ NH S  DD  + G  LP+ ++ NT ++RW++ A D+CFT+ L S FFM G+CIPV R             G+GV Q ++N  ++    G WI+++P+GK+      + +E LRLKWGVGR+I E  + PII+P+WH GM+ + P V+PY           K+VT+ +G  + L D +  L   +  E  A+  IT  IQ++F DLR +T + H++
Sbjct:  132 PSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWG-CLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVR-------------GIGVYQDAINLCIEKAALGHWIHVFPEGKV-----NMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQR------GKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRE 376          
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Match: sp|Q6IV78|TAZ_SAISC (Tafazzin OS=Saimiri sciureus OX=9521 GN=TAZ PE=3 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.924e-40
Identity = 92/260 (35.38%), Postives = 131/260 (50.38%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQRLKTQAEQLHN 256          
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Match: sp|Q6IV76|TAZ_ERYPA (Tafazzin OS=Erythrocebus patas OX=9538 GN=TAZ PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 4.924e-40
Identity = 92/260 (35.38%), Postives = 131/260 (50.38%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQRLKTQAEQLHN 256          
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Match: sp|Q6IV77|TAZ_MACMU (Tafazzin OS=Macaca mulatta OX=9544 GN=TAZ PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 5.586e-40
Identity = 92/260 (35.38%), Postives = 131/260 (50.38%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R             G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCR-------------GDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPILERLRAENKSAVEMRKALTDFIQEEFQRLKTQAEQLHN 256          
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Match: sp|Q6IV84|TAZ_PANTR (Tafazzin OS=Pan troglodytes OX=9598 GN=TAZ PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 2.549e-39
Identity = 94/277 (33.94%), Postives = 133/277 (48.01%), Query Frame = 2
Query:  152 VSMGIVG--SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI-----------------HSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKL----SSSKETWAKITQHIQDSFYDLRQQTIRAHQ 913
            V MG+VG  S F    M H      +    + + NR    P+IT+ NH S  DD  + G +L +  + N   MRWT  A+D+CFT  L S FF  G+C+PV R                   H    G     G GV Q  M++ L+ LN G W++++P+GK+      +  E LR KWG+GRLI+EC   PII+PLWH GM  + P   PY+          +K+T++IG        L +L     S+ E    +T  IQ+ F  L+ Q  + H 
Sbjct:   23 VVMGLVGTYSCFWTKYMNHLTVHNKEVLY-ELIENRGPATPLITVSNHQSCMDDPHLWG-ILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGAEFFQAENEGKGVLDTGRHMPGAGKRREKGDGVYQKGMDFILEKLNHGDWVHIFPEGKV-----NMSSEFLRFKWGIGRLIAECHLNPIILPLWHVGMNDVLPNSPPYF------PRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHN 286          
BLAST of Tafazzin family protein vs. TrEMBL
Match: A0A068WDB5 (Tafazzin family protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000800300 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.981e-61
Identity = 103/279 (36.92%), Postives = 165/279 (59.14%), Query Frame = 2
Query:   86 FYMNHTGCSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKK-KVTIMIGDRIQLPDQLYKLSSSKET-WAKITQHIQDSFYDLRQQTIRAHQK 916
            + + H  C      +  + + K+ + +V S+ KL  ++H   LIN    +D V NR   KP+IT+ NH S  DD  + G  LP  +LL+  R+RWTL A D+CF + L S FF SG+ IPVWR +   ETG++++ GLGV QPSM + LD+LN+G WI+ + QG+++   E   E T+RL+WGVGRL++E    PI++P+WHCG++++ P  +PY   TL      +  VT ++G   ++ + + K   +  + ++++T  +Q + Y L+      H K
Sbjct:   13 YRLYHNACK---RSLGQRVFHKIPIAMVASLVKLAFLRHRFKLINGGAFLDIVKNRPAYKPLITVSNHYSCLDDIILFGQALPYKLLLDADRLRWTLAAVDICFVNKLYSVFFSSGKGIPVWRRVRDPETGNIVLSGLGVYQPSMEFCLDLLNAGHWIHSFSQGRVIMPCERDIETTIRLRWGVGRLLAEASVDPIVLPIWHCGIDEMSPCKEPYARNTLARLFGSRLSVTALVGAPFEVGNLVRKSRDTGTSLYSRLTAFVQRALYQLKPIAEAEHAK 288          
BLAST of Tafazzin family protein vs. TrEMBL
Match: A0A0R3WB09 (Tafazzin family protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7785 PE=3 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 4.957e-61
Identity = 101/250 (40.40%), Postives = 154/250 (61.60%), Query Frame = 2
Query:  173 SVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKK-KVTIMIGDRIQLPDQLYK-LSSSKETWAKITQHIQDSFYDLRQQTIRAHQK 916
            S+ KL  ++H   +IN+   +D V NR   KP+ITI NH S  DD  + G  LP  +LL+  R+RWTL A D+CF + L S FF SG+ IPVWR +   ETG++L+ GLGV QPSM + LD+LN+G WI+L+ QG+++   E   E  +RL+WGVGRL++E    P+++P+WHCG++++ P  +PY   TL      +  VT ++G   ++ D + K L +    ++++T  +Q + Y L+      H K
Sbjct:   50 SLVKLAFLRHRFKMINEITFLDIVKNRPAYKPLITISNHYSCLDDLILFGQALPYKLLLDADRLRWTLAAVDICFVNKLYSVFFASGKGIPVWRRVRDPETGNILLPGLGVCQPSMEFCLDLLNAGHWIHLFSQGRVILPHERNNETNIRLRWGVGRLLAEASVDPVVLPIWHCGIDEMSPCKQPYVRHTLARLFGPRISVTALVGAPFEVGDLVRKSLGTGTNLYSRLTASVQRALYQLKPIAEAEHAK 299          
BLAST of Tafazzin family protein vs. TrEMBL
Match: A0A068Y6L5 (Tafazzin family protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000800300 PE=3 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 4.694e-60
Identity = 101/279 (36.20%), Postives = 164/279 (58.78%), Query Frame = 2
Query:   86 FYMNHTGCSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKK-KVTIMIGDRIQLPDQLYKLSSSKET-WAKITQHIQDSFYDLRQQTIRAHQK 916
            + + H  C      +  + + K+ + +V S+ KL  ++H   LIN    +D   NR   KP+IT+ NH S  DD  + G  LP  +LL+  R+RWTL A D+CF + L + FF SG+ IPVWR +   ETG++++ GLGV QPSM + LD+LN+G WI+ + QG+++   E   E T+RL+WGVGRL++E    PI++P+WHCG++++ P  +PY   TL      +  VT ++G   ++ + + K   +  + ++++T  +Q + Y L+      H K
Sbjct:   13 YRLYHNACK---RSLGQRVFHKIPIAMVASLVKLAFLRHRFKLINGGAFLDITKNRPAYKPLITVSNHYSCLDDIILFGQALPYKLLLDADRLRWTLAAVDICFVNKLYTVFFTSGKGIPVWRRVRDPETGNIVLWGLGVYQPSMEFCLDLLNAGHWIHSFSQGRVIMPCERDIETTIRLRWGVGRLLAEASVDPIVLPIWHCGIDEMSPCKEPYARNTLARLFGSRLSVTALVGAPFEVGNLVRKSRDTGTSLYSRLTAFVQRALYQLKPIAEAEHAK 288          
BLAST of Tafazzin family protein vs. TrEMBL
Match: A0A4E0R0K5 (Tafazzin family protein OS=Fasciola hepatica OX=6192 GN=D915_007717 PE=3 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.327e-59
Identity = 106/288 (36.81%), Postives = 177/288 (61.46%), Query Frame = 2
Query:   95 NHTGCSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKK-VTIMIGDRIQL---------PDQLYKLS--SSKETWAKITQHIQDSFYDLRQQTIRAHQKFL 922
            NH+  S    ++    +++++  I G++ KL   +HN+ +I ++ L+++   R  + P+ITI NH S  DD  + G +L +  L++  R RW+L A DVCFT+     FF  GQ +PVWR +   +T  +L HG G+ QPSM++ L++LN G W+++YPQG+++  +E  +E+T RL+WGVGRLI+EC+E PI++P+WHCG +++ P   P   +TL   + + + +T+ +G+ I+L         P QL + S  S  + +A +TQ +QDS Y L+  T + H + L
Sbjct:    9 NHSSVSAFTRRV----FQRITYPIFGAIVKLAVWRHNLQIIGRDHLMEAYKGRPLHTPLITISNHHSCLDDFILFGTLLSLFDLMHVDRYRWSLAAVDVCFTNARDCFFFTWGQGVPVWRRVRHPKTKLILHHGGGLYQPSMDFCLNLLNRGKWVHMYPQGRVIQPYERHQEDTFRLRWGVGRLIAECREDPIVLPIWHCGFDELNPSDPPNIRSTLSRILGRPRCLTVQVGEAIRLDAIRRQVGSPAQLTQQSEASRSQVYAHVTQVVQDSLYGLKHNTEKTHNQRL 292          
BLAST of Tafazzin family protein vs. TrEMBL
Match: A0A158RDG2 (Tafazzin family protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS562 PE=3 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 9.725e-59
Identity = 102/275 (37.09%), Postives = 158/275 (57.45%), Query Frame = 2
Query:  107 CSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKK-KVTIMIGDRIQLPDQLYKLSSSKETWAK----ITQHIQDSFYDLRQQTIRAHQK 916
            C+     I  + +  + + +  S+ KL  ++H   ++N   L+D V NR   KP+IT+ NH S  DD  + G +LP  VL +  R+RWTL A D+CF + L S FF SG+ IPVWR +   ETGD+L+ GLGV QPSM + L++LN+G WI+ + QG+++   E   E ++RL+WG+GRL++E    PI++P+WHCG++++ P  +PY   TL         VT+++G   ++    Y    S  T A     +T  +Q + Y L+      H K
Sbjct:   16 CNAYKRSICQRIFHVIPIVMAASLAKLAFLRHRFKMVNAGTLLDIVKNRPAYKPLITVSNHYSCLDDIILFGQVLPYEVLFDADRLRWTLAAVDICFVNSLYSAFFASGKGIPVWRRVRDPETGDILLPGLGVCQPSMEFCLELLNAGQWIHSFSQGRVILPHERNNETSIRLRWGIGRLLAEASVDPIVLPIWHCGIDEMSPCEEPYVRRTLTRLFGPPLSVTVLVGSPFEVG---YLARKSGRTGASLYTCLTASVQHALYQLKPTAEAEHAK 287          
BLAST of Tafazzin family protein vs. Ensembl Cavefish
Match: taz (tafazzin [Source:NCBI gene;Acc:103032805])

HSP 1 Score: 156.377 bits (394), Expect = 9.286e-45
Identity = 103/272 (37.87%), Postives = 145/272 (53.31%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMS-MKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRI---QLPDQLYKLSSSK-ETWAKITQHIQDSFYDLRQQTIRAHQK 916
            Q P  GWR    V MG+VGS   L +   +++++ N++ L+D V  R  N P+IT+ NH S  DD  I G +L    L N  +MRWT TA+D+CFT  L S+FF  G+C+PV R             G GV Q  M++ ++ LN G W++++P+GK+      + EE +R KWGVGRLI+EC   PII+PLWH G+  + P   PY   T       KK+T+++G       L D L     S  E    +T  IQ  F  L+ Q    H +
Sbjct:   11 QCPRLGWRISSSVVMGMVGSYSYLWTKYANSLSVHNQDVLLDLVDERPQNTPLITVSNHQSCMDDPHIWG-VLKFRQLWNWKKMRWTPTAADICFTKELHSRFFSRGKCVPVVR-------------GDGVYQRGMDFLVERLNQGDWVHVFPEGKV-----NMTEEFIRFKWGVGRLIAECSLHPIILPLWHVGLNDVLPNETPYIPRT------GKKITVLVGKPFMVKHLVDSLRAEDRSPMEMRKAVTDFIQAEFRTLKSQAEALHHR 257          
BLAST of Tafazzin family protein vs. Ensembl Cavefish
Match: taz (tafazzin [Source:NCBI gene;Acc:103032805])

HSP 1 Score: 110.538 bits (275), Expect = 1.860e-27
Identity = 88/272 (32.35%), Postives = 128/272 (47.06%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSVFKLMS-MKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRI---QLPDQLYKLSSSK-ETWAKITQHIQDSFYDLRQQTIRAHQK 916
            Q P  GWR    V MG+VGS   L +   +++++ N++ L+D V  R  N P+IT+ NH S  DD  I G +L    L N  +MRWT TA+D+CFT  L S+FF  G+C+PV R             G GV Q  M++ ++ LN G W++++P+GK+      + EE +R KW                     G+  + P   PY   T       KK+T+++G       L D L     S  E    +T  IQ  F  L+ Q    H +
Sbjct:   47 QCPRLGWRISSSVVMGMVGSYSYLWTKYANSLSVHNQDVLLDLVDERPQNTPLITVSNHQSCMDDPHIWG-VLKFRQLWNWKKMRWTPTAADICFTKELHSRFFSRGKCVPVVR-------------GDGVYQRGMDFLVERLNQGDWVHVFPEGKV-----NMTEEFIRFKW---------------------GLNDVLPNETPYIPRT------GKKITVLVGKPFMVKHLVDSLRAEDRSPMEMRKAVTDFIQAEFRTLKSQAEALHHR 272          
BLAST of Tafazzin family protein vs. Ensembl Sea Lamprey
Match: taz (tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684])

HSP 1 Score: 63.929 bits (154), Expect = 4.811e-13
Identity = 29/91 (31.87%), Postives = 50/91 (54.95%), Query Frame = 2
Query:  602 LKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDS 874
            + ++ +R+KWGVGRLI+EC+  PII+PLWH GM  + P   PY           ++VT+++G    L +    L     +  ++ + + D+
Sbjct:    5 MSQDMIRIKWGVGRLIAECRLTPIILPLWHVGMNDVLPNKPPY------VPRRGQRVTVLVGKPFTLRNLHETLRRDNHSTVEVRKALTDA 89          
BLAST of Tafazzin family protein vs. Ensembl Yeast
Match: TAZ1 (Lyso-phosphatidylcholine acyltransferase; required for normal phospholipid content of mitochondrial membranes; major determinant of the final acyl chain composition of the mitochondrial-specific phospholipid cardiolipin; mutations in human ortholog tafazzin (TAZ) cause Barth syndrome, a rare X-linked disease characterized by skeletal and cardiomyopathy and bouts of cyclic neutropenia; a specific splice variant of human TAZ can complement yeast null mutant [Source:SGD;Acc:S000006344])

HSP 1 Score: 84.7297 bits (208), Expect = 1.241e-18
Identity = 58/231 (25.11%), Postives = 107/231 (46.32%), Query Frame = 2
Query:  248 NRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRN---------------IHSRETGDL--LMHGLGVNQPSMNYSLDILNSG-GWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQIC-PVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYD 883
            ++  N+ ++T+MNH S+ DD  +    LP  +  +   +RW+L A ++CF +  ++ FF  GQ +   R                +   +T DL    H    +     YS  I+ S   W+++YP+G ++  +   +      KWG+ R+I E  + PI++P++  G E+I    V    F  +L +    ++ + IGD   L D L  +   ++ W     H+ + +YD
Sbjct:   64 SKRENRGLMTVMNHMSMVDDPLVWA-TLPYKLFTSLDNIRWSLGAHNICFQNKFLANFFSLGQVLSTERFGVGPFQGSIDASIRLLSPDDTLDLEWTPHSEVSSSLKKAYSPPIIRSKPSWVHVYPEGFVLQLYPPFENSMRYFKWGITRMILEATKPPIVVPIFATGFEKIASEAVTDSMFRQILPRNFGSEINVTIGD--PLNDDL--IDRYRKEWT----HLVEKYYD 285          
BLAST of Tafazzin family protein vs. Ensembl Nematostella
Match: EDO40279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7Q8])

HSP 1 Score: 142.124 bits (357), Expect = 5.220e-40
Identity = 76/222 (34.23%), Postives = 123/222 (55.41%), Query Frame = 2
Query:  266 PMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSK----ETWAKITQHIQDSFYDLRQQTIRAHQKF 919
            P++T+ NH S  DD  + G M+ + +LL+  ++RWTL A ++ F+ P  S FF  G+ IP+             M G GV Q  M+++++ LNSG W++++P+  I+          +RLKWGVGRLI+E    P+++P WH GM+ I P   PY  T +      K+VT++IG+ +   D L      +    ET   IT  IQ+ F +L+++  + H+K+
Sbjct:   51 PLVTVSNHHSCLDDPMLWG-MMKMRILLDNRKIRWTLGAKELLFSKPFHSFFFSRGKIIPI-------------MRGEGVYQKGMDFAIEELNSGQWVHVFPEAGIIE-----DHSLVRLKWGVGRLIAESSVTPVVLPFWHVGMDDILPNKTPYIPTIM------KRVTVLIGEPMYFDDILKDFKRRRLNAMETRKNITDCIQERFKELKEEAEKLHEKW 247          
BLAST of Tafazzin family protein vs. Ensembl Nematostella
Match: EDO28938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T523])

HSP 1 Score: 82.8037 bits (203), Expect = 1.677e-19
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 2
Query:  500 GVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETL-RLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFY 880
            GV Q  M+++++ LN G W++++P+GK       L + +L RLKWGVGRLI+E    P+++P WH GM+ I P   PY  T +      K+VT++IG+ +   D L      +     ++  IQ  +Y
Sbjct:    2 GVYQKGMDFAIEELNRGQWVHVFPEGK------GLSDHSLVRLKWGVGRLIAESSVTPVVLPFWHVGMDDILPNKTPYIPTIM------KRVTVLIGEPMYFDDILKDFKRRRLN--AVSGCIQAEYY 115          
BLAST of Tafazzin family protein vs. Ensembl Nematostella
Match: EDO29049 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4R4])

HSP 1 Score: 51.2174 bits (121), Expect = 3.867e-7
Identity = 26/79 (32.91%), Postives = 42/79 (53.16%), Query Frame = 2
Query:  266 PMITIMNHASVCDDT--------------FILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI 460
            P++T+ NH S  DD               F +G M+ + +LL+  ++RWTL A ++ F+ P  S FF  G+ IP+ R +
Sbjct:  200 PLVTVSNHHSCLDDPMLWVDDIRVDDILPFFVG-MMKMRILLDNRKIRWTLGAKELLFSKPFHSFFFSRGKIIPIMRGM 277          
BLAST of Tafazzin family protein vs. Ensembl Medaka
Match: taz (tafazzin [Source:NCBI gene;Acc:101157519])

HSP 1 Score: 160.999 bits (406), Expect = 1.356e-46
Identity = 98/270 (36.30%), Postives = 153/270 (56.67%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSV-FKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFL 922
            Q P   WR    + MG+VGS  +      + + + N++ L++ + +R  N P+IT+ NH S  DD  I G +L +  L N ++MRWT TASD+CFT  L S+FF  G+C+PV R             G GV Q  M++ LD LN G W++++P+GK+      + EE +RLKWGVGRLI+EC   P+I+PLWH G+  + P V PY   T       K++T+++G    L + +  L + K++  ++ + + D F  +  Q ++AH + L
Sbjct:   11 QPPPLAWRISGSLVMGMVGSYSYFWTKYMNYLTVHNRDVLLNLIDHRPPNTPLITLANHQSCMDDPHIWG-VLKLRQLWNYNKMRWTPTASDICFTKELHSRFFSRGKCVPVCR-------------GDGVYQKGMDFILDKLNRGEWVHIFPEGKV-----NMTEEFIRLKWGVGRLIAECSLNPVILPLWHVGLSDVLPNVTPYIPRT------GKRITVLVGRPFSLKELVESLRAEKKSQMEMRKTLTD-FIQVELQELKAHAETL 254          
BLAST of Tafazzin family protein vs. Ensembl Medaka
Match: taz (tafazzin [Source:NCBI gene;Acc:101157519])

HSP 1 Score: 160.999 bits (406), Expect = 1.356e-46
Identity = 98/270 (36.30%), Postives = 153/270 (56.67%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSV-FKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFL 922
            Q P   WR    + MG+VGS  +      + + + N++ L++ + +R  N P+IT+ NH S  DD  I G +L +  L N ++MRWT TASD+CFT  L S+FF  G+C+PV R             G GV Q  M++ LD LN G W++++P+GK+      + EE +RLKWGVGRLI+EC   P+I+PLWH G+  + P V PY   T       K++T+++G    L + +  L + K++  ++ + + D F  +  Q ++AH + L
Sbjct:   11 QPPPLAWRISGSLVMGMVGSYSYFWTKYMNYLTVHNRDVLLNLIDHRPPNTPLITLANHQSCMDDPHIWG-VLKLRQLWNYNKMRWTPTASDICFTKELHSRFFSRGKCVPVCR-------------GDGVYQKGMDFILDKLNRGEWVHIFPEGKV-----NMTEEFIRLKWGVGRLIAECSLNPVILPLWHVGLSDVLPNVTPYIPRT------GKRITVLVGRPFSLKELVESLRAEKKSQMEMRKTLTD-FIQVELQELKAHAETL 254          
BLAST of Tafazzin family protein vs. Ensembl Medaka
Match: taz (tafazzin [Source:NCBI gene;Acc:101157519])

HSP 1 Score: 160.999 bits (406), Expect = 1.356e-46
Identity = 98/270 (36.30%), Postives = 153/270 (56.67%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSV-FKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFL 922
            Q P   WR    + MG+VGS  +      + + + N++ L++ + +R  N P+IT+ NH S  DD  I G +L +  L N ++MRWT TASD+CFT  L S+FF  G+C+PV R             G GV Q  M++ LD LN G W++++P+GK+      + EE +RLKWGVGRLI+EC   P+I+PLWH G+  + P V PY   T       K++T+++G    L + +  L + K++  ++ + + D F  +  Q ++AH + L
Sbjct:   11 QPPPLAWRISGSLVMGMVGSYSYFWTKYMNYLTVHNRDVLLNLIDHRPPNTPLITLANHQSCMDDPHIWG-VLKLRQLWNYNKMRWTPTASDICFTKELHSRFFSRGKCVPVCR-------------GDGVYQKGMDFILDKLNRGEWVHIFPEGKV-----NMTEEFIRLKWGVGRLIAECSLNPVILPLWHVGLSDVLPNVTPYIPRT------GKRITVLVGRPFSLKELVESLRAEKKSQMEMRKTLTD-FIQVELQELKAHAETL 254          
BLAST of Tafazzin family protein vs. Ensembl Medaka
Match: taz (tafazzin [Source:NCBI gene;Acc:101157519])

HSP 1 Score: 137.502 bits (345), Expect = 8.815e-38
Identity = 90/270 (33.33%), Postives = 142/270 (52.59%), Query Frame = 2
Query:  125 QIPSKGWR---KVSMGIVGSV-FKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFL 922
            Q P   WR    + MG+VGS  +      + + + N++ L++ + +R  N P+IT+ NH S  DD  I G +L +  L N ++MRWT TASD+CFT  L S+FF  G+C+PV R             G GV Q  M++ LD LN G W++++P+                   GVGRLI+EC   P+I+PLWH G+  + P V PY   T       K++T+++G    L + +  L + K++  ++ + + D F  +  Q ++AH + L
Sbjct:   11 QPPPLAWRISGSLVMGMVGSYSYFWTKYMNYLTVHNRDVLLNLIDHRPPNTPLITLANHQSCMDDPHIWG-VLKLRQLWNYNKMRWTPTASDICFTKELHSRFFSRGKCVPVCR-------------GDGVYQKGMDFILDKLNRGEWVHIFPE-------------------GVGRLIAECSLNPVILPLWHVGLSDVLPNVTPYIPRT------GKRITVLVGRPFSLKELVESLRAEKKSQMEMRKTLTD-FIQVELQELKAHAETL 240          
BLAST of Tafazzin family protein vs. Planmine SMEST
Match: SMESG000048217.1 (SMESG000048217.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 273/279 (97.85%), Postives = 277/279 (99.28%), Query Frame = 2
Query:   92 MNHTGCSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHXXXXXXXXXXXDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN 928
            MN TGCSFLPSQIPSKGWRKVSMGIVGSVFKL+SMKHNINLINKNKLIDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNT+RMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI+SRETGDL+MHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTT LSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN
Sbjct:    1 MNDTGCSFLPSQIPSKGWRKVSMGIVGSVFKLISMKHNINLINKNKLIDSVFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTNRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIYSRETGDLMMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTFLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN 279          
BLAST of Tafazzin family protein vs. Planmine SMEST
Match: SMESG000048217.1 (SMESG000048217.1)

HSP 1 Score: 454.907 bits (1169), Expect = 2.192e-162
Identity = 216/220 (98.18%), Postives = 219/220 (99.55%), Query Frame = 2
Query:  269 MITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN 928
            MITIMNHASVCDDTFILGHMLPVSVLLNT+RMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNI+SRETGDL+MHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTT LSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN
Sbjct:    1 MITIMNHASVCDDTFILGHMLPVSVLLNTNRMRWTLTASDVCFTSPLMSKFFMSGQCIPVWRNIYSRETGDLMMHGLGVNQPSMNYSLDILNSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWHCGMEQICPVVKPYWFTTFLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKETWAKITQHIQDSFYDLRQQTIRAHQKFLLN 220          
The following BLAST results are available for this feature:
BLAST of Tafazzin family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAZ6.109e-4035.00tafazzin [Source:HGNC Symbol;Acc:HGNC:11577][more]
TAZ4.160e-3933.57tafazzin [Source:HGNC Symbol;Acc:HGNC:11577][more]
TAZ7.843e-3936.44tafazzin [Source:HGNC Symbol;Acc:HGNC:11577][more]
TAZ8.875e-3934.85tafazzin [Source:HGNC Symbol;Acc:HGNC:11577][more]
TAZ2.685e-3531.53tafazzin [Source:HGNC Symbol;Acc:HGNC:11577][more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
acl-32.461e-3031.75Tafazzin family protein [Source:UniProtKB/TrEMBL;... [more]
acl-32.461e-3031.75Tafazzin family protein [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taz3.289e-4235.93gene:FBgn0026619 transcript:FBtr0087863[more]
Taz3.289e-4235.93gene:FBgn0026619 transcript:FBtr0302455[more]
Taz1.979e-4135.93gene:FBgn0026619 transcript:FBtr0087864[more]
Taz4.301e-4135.93gene:FBgn0026619 transcript:FBtr0087862[more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
taz2.858e-4334.80tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684][more]
taz2.858e-4334.80tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684][more]
taz1.383e-2234.20tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684][more]
taz5.184e-2239.35tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684][more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taz1.021e-3636.44tafazzin [Source:NCBI gene;Acc:549220][more]
taz1.971e-3337.56tafazzin [Source:NCBI gene;Acc:549220][more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Taz9.159e-4235.50tafazzin [Source:MGI Symbol;Acc:MGI:109626][more]
Taz5.536e-4035.36tafazzin [Source:MGI Symbol;Acc:MGI:109626][more]
Taz1.104e-3332.82tafazzin [Source:MGI Symbol;Acc:MGI:109626][more]
Taz2.659e-3339.56tafazzin [Source:MGI Symbol;Acc:MGI:109626][more]
Taz2.734e-3142.28tafazzin [Source:MGI Symbol;Acc:MGI:109626][more]
back to top
BLAST of Tafazzin family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9V6G5|TAZ_DROME4.311e-4035.93Tafazzin homolog OS=Drosophila melanogaster OX=722... [more]
sp|Q6IV78|TAZ_SAISC4.924e-4035.38Tafazzin OS=Saimiri sciureus OX=9521 GN=TAZ PE=3 S... [more]
sp|Q6IV76|TAZ_ERYPA4.924e-4035.38Tafazzin OS=Erythrocebus patas OX=9538 GN=TAZ PE=2... [more]
sp|Q6IV77|TAZ_MACMU5.586e-4035.38Tafazzin OS=Macaca mulatta OX=9544 GN=TAZ PE=2 SV=... [more]
sp|Q6IV84|TAZ_PANTR2.549e-3933.94Tafazzin OS=Pan troglodytes OX=9598 GN=TAZ PE=3 SV... [more]
back to top
BLAST of Tafazzin family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068WDB51.981e-6136.92Tafazzin family protein OS=Echinococcus granulosus... [more]
A0A0R3WB094.957e-6140.40Tafazzin family protein OS=Taenia asiatica OX=6051... [more]
A0A068Y6L54.694e-6036.20Tafazzin family protein OS=Echinococcus multilocul... [more]
A0A4E0R0K51.327e-5936.81Tafazzin family protein OS=Fasciola hepatica OX=61... [more]
A0A158RDG29.725e-5937.09Tafazzin family protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taz9.286e-4537.87tafazzin [Source:NCBI gene;Acc:103032805][more]
taz1.860e-2732.35tafazzin [Source:NCBI gene;Acc:103032805][more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taz4.811e-1331.87tafazzin [Source:ZFIN;Acc:ZDB-GENE-030131-684][more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAZ11.241e-1825.11Lyso-phosphatidylcholine acyltransferase; required... [more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO402795.220e-4034.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289381.677e-1935.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290493.867e-732.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tafazzin family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
taz1.356e-4636.30tafazzin [Source:NCBI gene;Acc:101157519][more]
taz1.356e-4636.30tafazzin [Source:NCBI gene;Acc:101157519][more]
taz1.356e-4636.30tafazzin [Source:NCBI gene;Acc:101157519][more]
taz8.815e-3833.33tafazzin [Source:NCBI gene;Acc:101157519][more]
back to top
BLAST of Tafazzin family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048217.10.000e+097.85SMESG000048217.1[more]
SMESG000048217.12.192e-16298.18SMESG000048217.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005783 ID=SMED30005783|Name=Tafazzin family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1187bp
GAATTAAAACCTCACAAATTTATTCCTTTGAGGATATGCACATTTCTTTT
ATTAAAATTAATTTCTGATTAATTGTCTCATATAATTTTATATGAATCAT
ACAGGTTGTAGTTTTTTGCCAAGTCAAATTCCTTCTAAAGGATGGCGTAA
AGTTTCAATGGGTATCGTAGGTTCAGTTTTTAAACTAATGTCGATGAAGC
ATAATATAAATTTAATAAATAAAAATAAATTAATTGATAGTGTATTTAAT
CGAAATGGAAATAAGCCTATGATAACTATAATGAATCATGCTTCTGTCTG
TGATGATACTTTTATTTTGGGACACATGCTTCCTGTTTCAGTACTCTTAA
ATACTAGTCGAATGCGTTGGACTTTAACAGCTTCAGATGTTTGTTTCACA
AGTCCTTTGATGTCTAAATTCTTCATGTCTGGACAGTGCATTCCTGTGTG
GCGAAATATTCATTCTAGAGAAACTGGAGATTTATTGATGCATGGATTAG
GAGTGAACCAACCGTCAATGAACTATTCTCTAGACATTCTAAATTCCGGC
GGATGGATTAATTTATATCCACAAGGGAAAATTGTTTACGGATTTGAAAC
GTTGAAGGAGGAAACGCTCAGACTGAAATGGGGCGTTGGGCGATTAATTA
GTGAATGCAAGGAGAAGCCAATTATCATCCCTTTATGGCACTGTGGAATG
GAGCAGATTTGTCCAGTCGTAAAGCCGTACTGGTTCACCACCTTACTCAG
TCAAATGGCTAAGAAAAAAGTCACAATAATGATCGGCGATCGGATTCAAT
TACCAGATCAATTATATAAATTATCTAGTTCCAAAGAAACATGGGCCAAA
ATTACTCAGCATATCCAAGACAGTTTCTATGACTTACGGCAGCAGACGAT
TCGAGCACATCAGAAATTTTTATTGAATTGAAATACATTTAGTTTTTCTT
TGTGATTTTATGAAATGAAGTGCAAAATAGAATTTTAGAATATTAAGGAT
TTTTTAATCCAATTTGTCACAATAATTGAGAAAAATATTTATTAATTATG
ACTGATTTGATATTGAATGTTGAATACGGCTGATTTGGAATTAATTGCTA
TTGATCCTTGTTGATTTGAACTTGGTCATGCTTGATCTGTTATTGATTAG
GCCAGCACTTCACAAACATTTTGAATTTCAAGCGTGG
back to top

protein sequence of SMED30005783-orf-1

>SMED30005783-orf-1 ID=SMED30005783-orf-1|Name=SMED30005783-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=280bp
MNHTGCSFLPSQIPSKGWRKVSMGIVGSVFKLMSMKHNINLINKNKLIDS
VFNRNGNKPMITIMNHASVCDDTFILGHMLPVSVLLNTSRMRWTLTASDV
CFTSPLMSKFFMSGQCIPVWRNIHSRETGDLLMHGLGVNQPSMNYSLDIL
NSGGWINLYPQGKIVYGFETLKEETLRLKWGVGRLISECKEKPIIIPLWH
CGMEQICPVVKPYWFTTLLSQMAKKKVTIMIGDRIQLPDQLYKLSSSKET
WAKITQHIQDSFYDLRQQTIRAHQKFLLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR000872Tafazzin
IPR002123Plipid/glycerol_acylTrfase
Vocabulary: biological process
TermDefinition
GO:0006644phospholipid metabolic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000872TafazzinPRINTSPR00979TAFAZZINcoord: 60..79
score: 36.67
coord: 151..165
score: 33.33
coord: 178..199
score: 53.03
coord: 92..103
score: 58.33
coord: 222..235
score: 26.19
coord: 106..121
score: 39.58
IPR000872TafazzinPANTHERPTHR12497TAZ PROTEIN TAFAZZINcoord: 18..273
IPR002123Phospholipid/glycerol acyltransferaseSMARTSM00563plsc_2coord: 60..203
e-value: 1.4E-11
score: 54.5
IPR002123Phospholipid/glycerol acyltransferasePFAMPF01553Acyltransferasecoord: 49..200
e-value: 5.0E-21
score: 74.7
NoneNo IPR availableCDDcd07989LPLAT_AGPAT-likecoord: 53..259
e-value: 1.84349E-18
score: 78.852
NoneNo IPR availableSUPERFAMILYSSF69593Glycerol-3-phosphate (1)-acyltransferasecoord: 38..268