vault protein inter alpha trypsin-1

Overview
Namevault protein inter alpha trypsin-1 (AFJ24785.1)
Smed IDSMED30005772
Length (bp)2882
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of vault protein inter alpha trypsin-1 (SMED30005772) t-SNE clustered cells

Violin plots show distribution of expression levels for vault protein inter alpha trypsin-1 (SMED30005772) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of vault protein inter alpha trypsin-1 (SMED30005772) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for vault protein inter alpha trypsin-1 (SMED30005772) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005772

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005772SMESG000053638.1 dd_Smed_v4_3060_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005772SMESG000053638.1 dd_Smed_v4_3060_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 Contig42668uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 Contig42668newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 Contig36185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 Contig36185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053657.1 SMESG000053638.1 Contig27090uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053657.1 SMESG000053638.1 Contig27090newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000010333.1 SMESG000000079.1 SMESG000074134.1 SMESG000072420.1 SMESG000069427.1 SMESG000063486.1 SMESG000059936.1 SMESG000056847.1 SMESG000054630.1 SMESG000054168.1 SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 SMESG000052400.1 SMESG000051558.1 SMESG000051017.1 SMESG000043567.1 SMESG000035748.1 SMESG000032351.1 SMESG000030698.1 SMESG000029834.1 SMESG000029267.1 SMESG000023200.1 SMESG000021127.1 SMESG000013659.1 Contig19290newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005772SMESG000010333.1 SMESG000000079.1 SMESG000074134.1 SMESG000072420.1 SMESG000069427.1 SMESG000063486.1 SMESG000059936.1 SMESG000056847.1 SMESG000054630.1 SMESG000054168.1 SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 SMESG000052400.1 SMESG000051558.1 SMESG000051017.1 SMESG000043567.1 SMESG000035748.1 SMESG000032351.1 SMESG000030698.1 SMESG000029834.1 SMESG000029267.1 SMESG000023200.1 SMESG000021127.1 SMESG000013659.1 Contig19290uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 SMESG000053667.1 dd_Smed_v6_1027_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 SMESG000053667.1 dd_Smed_v6_1027_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005772SMESG000053671.1 SMESG000053669.1 SMESG000053667.1 SMESG000053664.1 SMESG000053657.1 SMESG000053638.1 dd_Smed_v4_1027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005772SMESG000053638.1 dd_Smed_v4_3060_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Match: VWA5A (von Willebrand factor A domain containing 5A [Source:HGNC Symbol;Acc:HGNC:6658])

HSP 1 Score: 270.781 bits (691), Expect = 2.536e-77
Identity = 184/605 (30.41%), Postives = 298/605 (49.26%), Query Frame = 2
Query:   59 YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R F+ GIG+G S SL+  +A+A  G S F+     + +  +  L  ++  V   D  L WH P  +S          IF    L ++  + G       +G+V +K TL G    + V+F  + +      D    +HRL AK  +      +     + KKD ++LSL+  +++ +T F+AI+++
Sbjct:   11 HREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFGIGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPV-VEDVSLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKP-----DVNLTIHRLAAKSLLQTKDMGLRETPASDKKDALNLSLESGVISSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Match: VWA5A (von Willebrand factor A domain containing 5A [Source:HGNC Symbol;Acc:HGNC:6658])

HSP 1 Score: 270.781 bits (691), Expect = 2.536e-77
Identity = 184/605 (30.41%), Postives = 298/605 (49.26%), Query Frame = 2
Query:   59 YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R F+ GIG+G S SL+  +A+A  G S F+     + +  +  L  ++  V   D  L WH P  +S          IF    L ++  + G       +G+V +K TL G    + V+F  + +      D    +HRL AK  +      +     + KKD ++LSL+  +++ +T F+AI+++
Sbjct:   11 HREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFGIGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPV-VEDVSLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKP-----DVNLTIHRLAAKSLLQTKDMGLRETPASDKKDALNLSLESGVISSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Match: VWA5A (von Willebrand factor A domain containing 5A [Source:HGNC Symbol;Acc:HGNC:6658])

HSP 1 Score: 202.986 bits (515), Expect = 1.681e-56
Identity = 139/431 (32.25%), Postives = 216/431 (50.12%), Query Frame = 2
Query:   32 TMFGLCPLK--YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTR 1261
            TM   C L   + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R
Sbjct:   16 TMVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR 431          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Match: VWA5A (von Willebrand factor A domain containing 5A [Source:HGNC Symbol;Acc:HGNC:6658])

HSP 1 Score: 202.216 bits (513), Expect = 2.381e-56
Identity = 135/420 (32.14%), Postives = 212/420 (50.48%), Query Frame = 2
Query:   59 YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTR 1261
            + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R
Sbjct:   11 HREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR 415          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Match: VWA5A (von Willebrand factor A domain containing 5A [Source:HGNC Symbol;Acc:HGNC:6658])

HSP 1 Score: 202.216 bits (513), Expect = 2.381e-56
Identity = 135/420 (32.14%), Postives = 212/420 (50.48%), Query Frame = 2
Query:   59 YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTR 1261
            + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R
Sbjct:   11 HREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR 415          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Match: si:ch73-265h17.1 (si:ch73-265h17.1 [Source:ZFIN;Acc:ZDB-GENE-131121-358])

HSP 1 Score: 244.588 bits (623), Expect = 1.195e-69
Identity = 176/602 (29.24%), Postives = 299/602 (49.67%), Query Frame = 2
Query:   62 DQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD-----REVFQVTNHYEYNF--KAVINGTKVIENVSSVNHTLE-IAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQC-KTEIVIVVDRSGSMRG---------SNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMK-SGDVIKCTLSGSANGEPVSFTTE--IRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE--TLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            ++   LKS+SV+  +++ ++S +    Y N+     E LF FP+  +  V +F A +G ++I+   ++ E AK+ Y+ A   G  A ++E++    DVF+  +G       A + + +  EL    V+++   RF   LP +L PRYTP   AG       E+  V     Y+      ++  K I  + S N TL+ + F  ++ T A V+L   +   +D+++ + Y    +PS V E G ++         GS   + V M+   P+F   +M++   + E V V+DRSGSM G           I+ AK+ LL+ LKSLP+ C F IYGFGS+F+  F  S  YS  ++  AL     + A+  GTE+++PL  +Y+     ++ R  F+ TDG V N  EV  LV+ H  S R F+ GIG+G S +L+  +A+ G G + F+   + +    ME L  A+     ++  ++W  P+ V+  T    I  +F       +  + G    G     T+  + N +PVS      I+ T+   +    VHRL A+  I  + ++  S  E  +L+  +++LS+Q  + + +T F+ I++D
Sbjct:   11 NEPVPLKSISVEVRVQDHVASVSSTLQYVNEEQRPLEALFVFPLPADAAVCHFSAKIGEQEIVAELQDKETAKDQYDDAVSSGQQAFLLEESAESPDVFRLSVGCLSPGQNAAVTIIYITELA---VQADQSLRF--CLPAVLNPRYTP---AGSDAGIVSEISSVCGAVPYSLTLSVHVSSPKPISKLES-NCTLDPLVFLCSDHTQATVNLSPGHMFDRDVELFLYYQDTHQPSAVVEAGVAT------APSGSLMRNPVVMITLYPEFPEEVMSSMATQGEFVFVMDRSGSMDGMMHRGKEAQHRIESAKDTLLLLLKSLPMGCYFNIYGFGSEFESFFPKSVEYSQDTMDQALKRVMEMRADMCGTEILQPLTHIYSQPCIPEHPRQLFIFTDGEVGNTKEVLDLVKSHAHSHRCFSFGIGEGASTALITGLAREGSGHAQFITGRERMQPKAMESLRFALQPA-VSNISVDWTLPEGVTAETVSPPIDVLFQGQRTLIYAQLKGKSLGGSEGSVTVKYNLNSQPVSNQLHFCIKPTE---ETGLVVHRLAARTIIRSLEQKERSSAESKSLRSSIVELSVQAGVSSVHTAFIGINKD 593          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Match: si:ch73-265h17.2 (si:ch73-265h17.2 [Source:ZFIN;Acc:ZDB-GENE-131120-39])

HSP 1 Score: 243.047 bits (619), Expect = 4.796e-69
Identity = 177/603 (29.35%), Postives = 302/603 (50.08%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN-----HYEYNFKAVINGTKVIENVSSVNHTLE-IAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQC-KTEIVIVVDRSGSM-----RGS----NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMK-SGDVIKCTLSGSANGEPVSFTTE--IRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEET----------LKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            LKS+SV+  +++ ++S +    Y N+     E LF FP+  +  V +F A +G ++I+   ++ E AK+ Y+ A   G  A ++E++    DVFK  +G       A + + +  EL    V+++   RF   LP +L PRYTP E +    V ++++      Y       ++  K I  + S N TL+ + F  ++ T A V+L   +   +D+++ + Y    +PS V E G ++          S   + V M+   P+F    M++   + E V V+DRSGSM     RG      I+ AK+ LL+ LKSLP+ C F IYGFGS+F+  F  S  Y+   +  AL   K + A+ GGTE+++PL  +Y+     ++ R  F+ TDG V N  EV  LV+ H +S R F+ GIG+G S +L+  +A+ G G + F+  ++ +   VME L  A+  +  ++  ++W  P+ V+  T    I  +F       +  + G    G     T+  + N +PV+      I+ T+   +    VHRL A+  I  + ++  S + T          L+K ++ LS+Q  + + +T F+ I++D
Sbjct:   17 LKSISVEVRVQDHVASVSSTLQYVNEEQRPLEALFVFPLPADAAVCHFSAKIGEQEIVAELQDKETAKDQYDDAVSSGQQAFLLEESAKSPDVFKLSVGCLLPGQNAAVTIIYVTELA---VQADQSLRF--CLPAVLNPRYTP-EGSDAGIVSEISSVCGAAPYSLTLSVHVSSPKPISKLES-NCTLDPLVFLRSDHTQATVNLSPGHMFDRDVELFLYYQDTHQPSAVVEAGVAT------APSDSLMRNPVVMISLYPEFPEEGMSSMANQGEFVFVMDRSGSMDWTMHRGKEAQHRIESAKDTLLLLLKSLPMGCYFNIYGFGSRFESFFPKSVEYNQDKMDQALKKVKEMRADMGGTEILQPLAHIYSQPCIPEHPRQLFIFTDGEVGNTKEVLDLVKSHARSHRCFSFGIGEGASTALITGLAREGSGHAQFITGSERMQPKVMESLRFALQPI-VSNISVDWTLPERVTAETISPPIDVLFQGQRTLIYAQLKGKNLGGSEGSVTVKYNLNSQPVTNQLHFCIKPTE---ETGLVVHRLAARTMIRSLEQKERSPDFTRKKIKRTLAKLRKTIVKLSVQAGVSSVHTAFIGINKD 602          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Match: vwa5a (von Willebrand factor A domain containing 5A [Source:ZFIN;Acc:ZDB-GENE-040912-181])

HSP 1 Score: 215.312 bits (547), Expect = 2.513e-60
Identity = 146/476 (30.67%), Postives = 238/476 (50.00%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNH----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNN-QCKTEIVIVVDRSGSM-------RGSN--IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSI 1462
            LKS+SV   +R  +SS      Y N+     E LF FP+     +  F A VGG++I G  ++ + A++ Y+     G    ++E++    DVF+  +G  P    A +   ++ EL +     E        LP +L PRYTP   A    V QV +     Y  +  A +  +  I  + S      + F +   T A+V L + +   KD+++ + Y+   +PS V E G+++         GS     + M+   P+F +++M++     E + +VD+SGSM        G+   I+ A++ LL+ LKSLP+ C F IYGFGS F   F  S LYS+ ++  AL   K + A+ GGTE+++PL+ +Y      ++ R  F+ TDG V N  E+  LVR H+ S R F+ GIG+G S +L+  +AK G G + F+  +  +   VM+ L  A+      +  ++W  P+ VS+
Sbjct:   17 LKSISVQLQVRGHVSSVRATLQYVNEEERPLEALFVFPLPAEAALCSFSATVGGQEIRGELRDKQTARDEYDDGVSAGRQVFLLEESDQSADVFRLSVGCLPAGGAATVSFTYSTELTV-----EEDGGLRYCLPAVLNPRYTP--AAAGAGVPQVCSASVIPYSLSLSADVRSSVPIARLDSSCALEPLQFLDPQHTHAQVSLSAGHRFDKDVELLLYYVDPHQPSAVLEAGAAT------APAGSLMADPLLMLSLYPEFPAAVMSSLTSHGEFIFLVDQSGSMDCPMHHGEGAQMRIESARDTLLLLLKSLPLGCYFNIYGFGSSFQAFFPQSVLYSEQTLQEALQRVKLMRADLGGTEILQPLQHIYRQACIPEHPRQLFIFTDGEVWNTRELLDLVRAHSSSHRCFSFGIGEGASTALITGMAKEGSGHAQFITGSDRMQPKVMQSLRFALQPA-VEELCVDWRLPEGVSV 478          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Match: vwa5a (von Willebrand factor A domain containing 5A [Source:ZFIN;Acc:ZDB-GENE-040912-181])

HSP 1 Score: 216.083 bits (549), Expect = 2.616e-58
Identity = 149/506 (29.45%), Postives = 247/506 (48.81%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNH----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNN-QCKTEIVIVVDRSGSM-------RGSN--IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDV 1552
            LKS+SV   +R  +SS      Y N+     E LF FP+     +  F A VGG++I G  ++ + A++ Y+     G    ++E++    DVF+  +G  P    A +   ++ EL +     E        LP +L PRYTP   A    V QV +     Y  +  A +  +  I  + S      + F +   T A+V L + +   KD+++ + Y+   +PS V E G+++         GS     + M+   P+F +++M++     E + +VD+SGSM        G+   I+ A++ LL+ LKSLP+ C F IYGFGS F   F  S LYS+ ++  AL   K + A+ GGTE+++PL+ +Y      ++ R  F+ TDG V N  E+  LVR H+ S R F+ GIG+G S +L+  +AK G G + F+  +  +   VM+ L  A+      +  ++W  P+ VS+      +  +F       +  + G +  +V
Sbjct:   17 LKSISVQLQVRGHVSSVRATLQYVNEEERPLEALFVFPLPAEAALCSFSATVGGQEIRGELRDKQTARDEYDDGVSAGRQVFLLEESDQSADVFRLSVGCLPAGGAATVSFTYSTELTV-----EEDGGLRYCLPAVLNPRYTP--AAAGAGVPQVCSASVIPYSLSLSADVRSSVPIARLDSSCALEPLQFLDPQHTHAQVSLSAGHRFDKDVELLLYYVDPHQPSAVLEAGAAT------APAGSLMADPLLMLSLYPEFPAAVMSSLTSHGEFIFLVDQSGSMDCPMHHGEGAQMRIESARDTLLLLLKSLPLGCYFNIYGFGSSFQAFFPQSVLYSEQTLQEALQRVKLMRADLGGTEILQPLQHIYRQACIPEHPRQLFIFTDGEVWNTRELLDLVRAHSSSHRCFSFGIGEGASTALITGMAKEGSGHAQFITGSDRMQPKVMQSLRFALQPA-VEELCVDWRLPEGVSVELLSPPVRSLFQGQRALLYGRLRGQQRSEV 508          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Match: vwa5b2 (von Willebrand factor A domain containing 5B2 [Source:ZFIN;Acc:ZDB-GENE-070912-216])

HSP 1 Score: 122.094 bits (305), Expect = 1.275e-27
Identity = 90/365 (24.66%), Postives = 169/365 (46.30%), Query Frame = 2
Query:  554 YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVH--LKSKYDGTKDLDININYLAMKEPSVVYEVGSSS--------------PLYSGKDAQGS--------FYHSD-----VAMVKFLPKFDSSLMN-NQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGI--ALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCM---INGMKS 1543
            Y+ +F+ ++ G  ++  + S  H L    + + K+++  +  L  ++   + ++I I +L    P V+ E G  +                 + K+A+           YH D     V M+ F P   S      Q   E++ ++D S +M   NI++ KE +L+ +KSLP      I G  S    +FN S+  +D S+ +  AL + + L ++ G   L   L  +Y   +     R  F++ DGN+SN   V +LVR++  + R F +G+G      L+  +AK   G + F+   + L   +++ L  A+  V  TD +++W+ P +V  + +P  IP ++    L  +C    ++G+K+
Sbjct:  231 YQLSFQLLVRGACLLAGLESPTHALRADADPSAKSASATYITLAEEHQCDRHVEI-ILHLKSHSPLVILERGRLTFREYEQQIRARRDFIRCARKEAESEKRLEFVRRRYHKDLLLNPVLMLNFCPDLLSEPTELQQASRELIFLIDNSNTMTQHNINKIKEGMLVAIKSLPTRTMLNIAGICSTVRPLFNTSKTCTDVSVTVTQALEFIQKLRSDHGAVNLWSALSWVYRQPVHRSCPRQLFIIMDGNLSNVGRVIELVRRNACNVRCFGLGLGPQACRRLLQGIAKVTGGSTDFLSEEERLQPKLIKCLKKALEPV-LTDVRIDWYVPDNVEALLSPNEIPSLYPGNCLIGYCTLYDVSGLKA 593          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Match: gzma (granzyme A [Source:Xenbase;Acc:XB-GENE-482759])

HSP 1 Score: 254.988 bits (650), Expect = 1.076e-71
Identity = 187/661 (28.29%), Postives = 317/661 (47.96%), Query Frame = 2
Query:   26 ITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVA-MVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMR-GSN--------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITDDGSSTDDVRHVCSTSSTSSNEMFCIWPYVFSACSTSP 1945
            +   FGL  +   Q   L+ +SV+  ++  ++       YKN   +  E +F FP++ +  VY FEA V GK I+   +E E+A   Y  A  KG  A +++++ S  D+F C +GN P   EA++ L F  EL   P+ ++   RF  +LP +L PRYTP ++  +    QV         Y  +  A       I  + S  +   + + +++KT+A+V L   +   +D+++   Y+ + +PSV  E G         DA+     +D A M++F P F ++        E + ++DRSGSM  G N        I+ AKE L++ LKSLP+ C F I GFGS+F+  F ++  Y+  S+  A+     ++AN GGTE+++PL+ +Y + +  D+ R  F+ TDG V N  +V + V+++  + R F  GIG+G S SL+  +++A  G   F+   + +   V++ L  A+      +  L+W  P  +  V   K    IF  +    +  + G     K G+V ++           + F  ++        E   +HRL AK  I+E+     S  E +KK +++ S Q  +++  T FVA++++         I  D  +     H C         MFC+ P    AC+ +P
Sbjct:    1 MAPFFGLIIVCSRQPVPLRGISVEVQVKGFVADVCATLRYKNTEEKPIEAIFVFPLDQDSAVYSFEATVEGKTIVAELQEREQATKTYGEAISKGQQAFLLQEDKSSGDIFSCSVGNLPPGQEAEVKLSFVQEL---PLEADGAVRF--VLPAVLNPRYTPKDHE-ESITAQVPRVPIGQIPYTLDLTAHFQSAYGISKIQSNCNISPVEYTDSDKTAAKVSLAQGHKFERDVELLAYYMDVNKPSVAVEAGLP-------DAKADTLMADPAVMLQFYPSFPTT-QEQSNSGEFLFLMDRSGSMECGMNSEPNAPQRIESAKETLVLLLKSLPLGCYFNIIGFGSRFEFFFPETIEYTQESMDEAVKKVTQMEANMGGTEILQPLKKIYKTAVRPDHPRQLFVFTDGEVGNTKQVIEEVQRNAHNHRCFAFGIGEGASTSLIKGISRAAGGTCEFITGKERMQPKVLKALKNALQPT-VKEISLKWTLPPGMESVLLSKPPSNIFQGHRAIVYAQLKGKVTPGKEGEVSLEYKFKDENFRNSIKFPFKVEKV-----ERPTIHRLGAKALISELENGANSESEEVKKRIVESSTQSGVISSLTAFVAVNKETKAPVQGPPIRRDIPTPGMYLHTCY--------MFCLLPMRPMACNMAP 633          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Match: gzma (granzyme A [Source:Xenbase;Acc:XB-GENE-482759])

HSP 1 Score: 248.825 bits (634), Expect = 1.226e-69
Identity = 187/651 (28.73%), Postives = 316/651 (48.54%), Query Frame = 2
Query:   26 ITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVA-MVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMR-GSN--------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD--AP--GEPLVTCITDDGSSTDDVRHVCSTSSTSSNEMF 1903
            +   FGL  +   Q   L+ +SV+  ++  ++       YKN   +  E +F FP++ +  VY FEA V GK I+   +E E+A   Y  A  KG  A +++++ S  D+F C +GN P   EA++ L F  EL   P+ ++   RF  +LP +L PRYTP ++  +    QV         Y  +  A       I  + S  +   + + +++KT+A+V L   +   +D+++   Y+ + +PSV  E G         DA+     +D A M++F P F ++        E + ++DRSGSM  G N        I+ AKE L++ LKSLP+ C F I GFGS+F+  F ++  Y+  S+  A+     ++AN GGTE+++PL+ +Y + +  D+ R  F+ TDG V N  +V + V+++  + R F  GIG+G S SL+  +++A  G   F+   + +   V++ L  A+      +  L+W  P  +  V   K    IF  +    +  + G     K G+V ++           + F  ++        E   +HRL AK  I+E+     S  E +KK +++ S Q  +++  T FVA++++  AP  G P+   I   G         CS+  + S  MF
Sbjct:    1 MAPFFGLIIVCSRQPVPLRGISVEVQVKGFVADVCATLRYKNTEEKPIEAIFVFPLDQDSAVYSFEATVEGKTIVAELQEREQATKTYGEAISKGQQAFLLQEDKSSGDIFSCSVGNLPPGQEAEVKLSFVQEL---PLEADGAVRF--VLPAVLNPRYTPKDHE-ESITAQVPRVPIGQIPYTLDLTAHFQSAYGISKIQSNCNISPVEYTDSDKTAAKVSLAQGHKFERDVELLAYYMDVNKPSVAVEAGLP-------DAKADTLMADPAVMLQFYPSFPTT-QEQSNSGEFLFLMDRSGSMECGMNSEPNAPQRIESAKETLVLLLKSLPLGCYFNIIGFGSRFEFFFPETIEYTQESMDEAVKKVTQMEANMGGTEILQPLKKIYKTAVRPDHPRQLFVFTDGEVGNTKQVIEEVQRNAHNHRCFAFGIGEGASTSLIKGISRAAGGTCEFITGKERMQPKVLKALKNALQPT-VKEISLKWTLPPGMESVLLSKPPSNIFQGHRAIVYAQLKGKIDEGKEGEVSLEYKFKDENFRNSIKFPFKVEKV-----ERPTIHRLGAKALISELENGANSESEEVKKRIVESSTQSGVISSLTAFVAVNKETKAPVQGPPIRRDIPTPGMYLHTSVSKCSSIFSFSGLMF 631          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Match: gzma (granzyme A [Source:Xenbase;Acc:XB-GENE-482759])

HSP 1 Score: 247.669 bits (631), Expect = 2.117e-69
Identity = 183/662 (27.64%), Postives = 315/662 (47.58%), Query Frame = 2
Query:   26 ITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVA-MVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMR-GSN--------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITDDGSSTDDVRHVCSTSSTSSNEMFCIWPYVFSACSTSPI 1948
            +   FGL  +   Q   L+ +SV+  ++  ++       YKN   +  E +F FP++ +  VY FEA V GK I+   +E E+A   Y  A  KG  A +++++ S  D+F C +GN P   EA++ L F  EL   P+ ++   RF  +LP +L PRYTP ++  +    QV         Y  +  A       I  + S  +   + + +++KT+A+V L   +   +D+++   Y+ + +PSV  E G         DA+     +D A M++F P F ++        E + ++DRSGSM  G N        I+ AKE L++ LKSLP+ C F I GFGS+F+  F ++  Y+  S+  A+     ++AN GGTE+++PL+ +Y + +  D+ R  F+ TDG V N  +V + V+++  + R F  GIG+G S SL+  +++A  G   F+   + +   V++ L  A+      +  L+W  P  +  V   K    IF  +    +  + G     K G+V ++           + F  ++        E   +HRL AK  I+E+     S  E +KK +++ S Q  +++  T FVA++++         I  D  +     H C       + +     + F A   +P+
Sbjct:    1 MAPFFGLIIVCSRQPVPLRGISVEVQVKGFVADVCATLRYKNTEEKPIEAIFVFPLDQDSAVYSFEATVEGKTIVAELQEREQATKTYGEAISKGQQAFLLQEDKSSGDIFSCSVGNLPPGQEAEVKLSFVQEL---PLEADGAVRF--VLPAVLNPRYTPKDHE-ESITAQVPRVPIGQIPYTLDLTAHFQSAYGISKIQSNCNISPVEYTDSDKTAAKVSLAQGHKFERDVELLAYYMDVNKPSVAVEAGLP-------DAKADTLMADPAVMLQFYPSFPTT-QEQSNSGEFLFLMDRSGSMECGMNSEPNAPQRIESAKETLVLLLKSLPLGCYFNIIGFGSRFEFFFPETIEYTQESMDEAVKKVTQMEANMGGTEILQPLKKIYKTAVRPDHPRQLFVFTDGEVGNTKQVIEEVQRNAHNHRCFAFGIGEGASTSLIKGISRAAGGTCEFITGKERMQPKVLKALKNALQPT-VKEISLKWTLPPGMESVLLSKPPSNIFQGHRAIVYAQLKGKVTPGKEGEVSLEYKFKDENFRNSIKFPFKVEKV-----ERPTIHRLGAKALISELENGANSESEEVKKRIVESSTQSGVISSLTAFVAVNKETKAPVQGPPIRRDIPTPGMYLHTCYMFFQHLHGLCVYMSFFFPAAKATPV 642          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Match: gzma (granzyme A [Source:Xenbase;Acc:XB-GENE-482759])

HSP 1 Score: 247.669 bits (631), Expect = 4.485e-69
Identity = 182/630 (28.89%), Postives = 309/630 (49.05%), Query Frame = 2
Query:   26 ITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVA-MVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMR-GSN--------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD--AP--GEPLVTCITDDG 1840
            +   FGL  +   Q   L+ +SV+  ++  ++       YKN   +  E +F FP++ +  VY FEA V GK I+   +E E+A   Y  A  KG  A +++++ S  D+F C +GN P   EA++ L F  EL   P+ ++   RF  +LP +L PRYTP ++  +    QV         Y  +  A       I  + S  +   + + +++KT+A+V L   +   +D+++   Y+ + +PSV  E G         DA+     +D A M++F P F ++        E + ++DRSGSM  G N        I+ AKE L++ LKSLP+ C F I GFGS+F+  F ++  Y+  S+  A+     ++AN GGTE+++PL+ +Y + +  D+ R  F+ TDG V N  +V + V+++  + R F  GIG+G S SL+  +++A  G   F+   + +   V++ L  A+      +  L+W  P  +  V   K    IF  +    +  + G     K G+V ++           + F  ++        E   +HRL AK  I+E+     S  E +KK +++ S Q  +++  T FVA++++  AP  G P+   I   G
Sbjct:    1 MAPFFGLIIVCSRQPVPLRGISVEVQVKGFVADVCATLRYKNTEEKPIEAIFVFPLDQDSAVYSFEATVEGKTIVAELQEREQATKTYGEAISKGQQAFLLQEDKSSGDIFSCSVGNLPPGQEAEVKLSFVQEL---PLEADGAVRF--VLPAVLNPRYTPKDHE-ESITAQVPRVPIGQIPYTLDLTAHFQSAYGISKIQSNCNISPVEYTDSDKTAAKVSLAQGHKFERDVELLAYYMDVNKPSVAVEAGLP-------DAKADTLMADPAVMLQFYPSFPTT-QEQSNSGEFLFLMDRSGSMECGMNSEPNAPQRIESAKETLVLLLKSLPLGCYFNIIGFGSRFEFFFPETIEYTQESMDEAVKKVTQMEANMGGTEILQPLKKIYKTAVRPDHPRQLFVFTDGEVGNTKQVIEEVQRNAHNHRCFAFGIGEGASTSLIKGISRAAGGTCEFITGKERMQPKVLKALKNALQPT-VKEISLKWTLPPGMESVLLSKPPSNIFQGHRAIVYAQLKGKIDEGKEGEVSLEYKFKDENFRNSIKFPFKVEKV-----ERPTIHRLGAKALISELENGANSESEEVKKRIVESSTQSGVISSLTAFVAVNKETKAPVQGPPIRRDIPTPG 610          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Match: gzma (granzyme A [Source:Xenbase;Acc:XB-GENE-482759])

HSP 1 Score: 246.514 bits (628), Expect = 5.083e-69
Identity = 183/647 (28.28%), Postives = 315/647 (48.69%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVA-MVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMR-GSN--------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD--AP--GEPLVTCITDDGSSTDDVRHVCSTSSTSSNEMFCIW-PYVFSACSTSPI 1948
            L+ +SV+  ++  ++       YKN   +  E +F FP++ +  VY FEA V GK I+   +E E+A   Y  A  KG  A +++++ S  D+F C +GN P   EA++ L F  EL   P+ ++   RF  +LP +L PRYTP ++  +    QV         Y  +  A       I  + S  +   + + +++KT+A+V L   +   +D+++   Y+ + +PSV  E G         DA+     +D A M++F P F ++        E + ++DRSGSM  G N        I+ AKE L++ LKSLP+ C F I GFGS+F+  F ++  Y+  S+  A+     ++AN GGTE+++PL+ +Y + +  D+ R  F+ TDG V N  +V + V+++  + R F  GIG+G S SL+  +++A  G   F+   + +   V++ L  A+      +  L+W  P  +  V   K    IF  +    +  + G  K G+V ++           + F  ++        E   +HRL AK  I+E+     S  E +KK +++ S Q  +++  T FVA++++  AP  G P+   I   G      +H+            C++  + F A   +P+
Sbjct:   12 LRGISVEVQVKGFVADVCATLRYKNTEEKPIEAIFVFPLDQDSAVYSFEATVEGKTIVAELQEREQATKTYGEAISKGQQAFLLQEDKSSGDIFSCSVGNLPPGQEAEVKLSFVQEL---PLEADGAVRF--VLPAVLNPRYTPKDHE-ESITAQVPRVPIGQIPYTLDLTAHFQSAYGISKIQSNCNISPVEYTDSDKTAAKVSLAQGHKFERDVELLAYYMDVNKPSVAVEAGLP-------DAKADTLMADPAVMLQFYPSFPTT-QEQSNSGEFLFLMDRSGSMECGMNSEPNAPQRIESAKETLVLLLKSLPLGCYFNIIGFGSRFEFFFPETIEYTQESMDEAVKKVTQMEANMGGTEILQPLKKIYKTAVRPDHPRQLFVFTDGEVGNTKQVIEEVQRNAHNHRCFAFGIGEGASTSLIKGISRAAGGTCEFITGKERMQPKVLKALKNALQPT-VKEISLKWTLPPGMESVLLSKPPSNIFQGHRAIVYAQLKGKGKEGEVSLEYKFKDENFRNSIKFPFKVEKV-----ERPTIHRLGAKALISELENGANSESEEVKKRIVESSTQSGVISSLTAFVAVNKETKAPVQGPPIRRDIPTPGMYLHTFQHLHG---------LCVYMSFFFPAAKATPV 629          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Match: Vwa5a (von Willebrand factor A domain containing 5A [Source:MGI Symbol;Acc:MGI:1915026])

HSP 1 Score: 246.128 bits (627), Expect = 1.041e-68
Identity = 186/599 (31.05%), Postives = 299/599 (49.92%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD------REVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSI-VTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            LK++SV  +I   +++      Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A + YE A  +GH A ++E++    DVF C +GN    ++  + L++  EL   P+ ++   R+  LLP IL PRY   E + +      +    + +  Y  N  A I     IE V S      I +   +KTSA+V L   +   +D+++ I Y  +  PSV  E+G    L    D   S   +  AMV F P       +  C  E V ++DRSGSM             I+ AKE LL+ LKSLP+ C F IYGFGS ++K F +S  Y+  ++  A+   K L AN GGTE++ PL ++Y +     +    F+ TDG VS+   V + V+ ++K  R F+ GIG G S SL+  +A+   G +VF+     +    +  L  A+      +  L W  P  +S+ + +P+ +  IF    L  +  + G+      +G V +K  L G +    V+F+ + +  D      F +HRL AK  I   +   Q  S EE  K+D++++SLQ  +++ +T F+AI+++
Sbjct:   17 LKNISVTLSINEFVAAVVATLNYENEEKVPLEATFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKAHSEYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPGAKVAVTLRYVQEL---PLETDGALRY--LLPAILNPRYQLSEQSANSCLNIQKPTVPLEDLPYTLNMTATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYNEVHSPSVAVEMGM---LDMKPD---SLMGAPSAMVSFYPDIPEVEASKAC-GEFVFLMDRSGSMDSPMSTENNSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEKFFPESVKYTQDTMEDAVKRVKALKANLGGTEILTPLCNIYKASSIPGHPLQLFVFTDGEVSDTFSVIREVKLNSKKHRCFSFGIGQGASTSLIKNIARVSGGTAVFITGKDRMQTKALGSLKFALQCA-VDNISLSWDLPPGLSVKMLSPEQL-TIFRGQRLIIYAQLTGLMPQVESTGAVCLKHILQGRSLENRVTFSLQPKAND-----NFTIHRLAAKSLIQTKDFGSQEASKEE--KEDVMNISLQSGVLSSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Match: Vwa5a (von Willebrand factor A domain containing 5A [Source:MGI Symbol;Acc:MGI:1915026])

HSP 1 Score: 246.128 bits (627), Expect = 1.041e-68
Identity = 186/599 (31.05%), Postives = 299/599 (49.92%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD------REVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSI-VTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            LK++SV  +I   +++      Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A + YE A  +GH A ++E++    DVF C +GN    ++  + L++  EL   P+ ++   R+  LLP IL PRY   E + +      +    + +  Y  N  A I     IE V S      I +   +KTSA+V L   +   +D+++ I Y  +  PSV  E+G    L    D   S   +  AMV F P       +  C  E V ++DRSGSM             I+ AKE LL+ LKSLP+ C F IYGFGS ++K F +S  Y+  ++  A+   K L AN GGTE++ PL ++Y +     +    F+ TDG VS+   V + V+ ++K  R F+ GIG G S SL+  +A+   G +VF+     +    +  L  A+      +  L W  P  +S+ + +P+ +  IF    L  +  + G+      +G V +K  L G +    V+F+ + +  D      F +HRL AK  I   +   Q  S EE  K+D++++SLQ  +++ +T F+AI+++
Sbjct:   17 LKNISVTLSINEFVAAVVATLNYENEEKVPLEATFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKAHSEYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPGAKVAVTLRYVQEL---PLETDGALRY--LLPAILNPRYQLSEQSANSCLNIQKPTVPLEDLPYTLNMTATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYNEVHSPSVAVEMGM---LDMKPD---SLMGAPSAMVSFYPDIPEVEASKAC-GEFVFLMDRSGSMDSPMSTENNSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEKFFPESVKYTQDTMEDAVKRVKALKANLGGTEILTPLCNIYKASSIPGHPLQLFVFTDGEVSDTFSVIREVKLNSKKHRCFSFGIGQGASTSLIKNIARVSGGTAVFITGKDRMQTKALGSLKFALQCA-VDNISLSWDLPPGLSVKMLSPEQL-TIFRGQRLIIYAQLTGLMPQVESTGAVCLKHILQGRSLENRVTFSLQPKAND-----NFTIHRLAAKSLIQTKDFGSQEASKEE--KEDVMNISLQSGVLSSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Match: AW551984 (expressed sequence AW551984 [Source:MGI Symbol;Acc:MGI:2143322])

HSP 1 Score: 242.662 bits (618), Expect = 1.776e-67
Identity = 175/597 (29.31%), Postives = 285/597 (47.74%), Query Frame = 2
Query:   74 SLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN-------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            +LKS++V  +I + ++  +    Y+N+     E  F FP++ +  VY FEA V GKKI+   ++  +A   YE A   G+ A ++E++    DVF C +GN    S+  + L++  EL   P+  +   R+  +LP IL PRY   +   D  +   T         Y  +  A I+    I  + S      I +   NKTSA+V L   +   +D+++ I Y  +  PSV  E+G      SG+ +  S   +  AMV F P         +C  E V ++DRS SM             ID AKE L++ LKSLP+ C F IYGFG+  ++ F DS +Y+  ++ IA+   K L A+ GGTEL+ PL  ++       +    F+ TDG V     V + V   +K  R F+ GIG+G S SL+  +A+   G + F+     + +  +  L  ++ SV   D  L W+ P  +           IF    L  + ++ G       +G+V +   L G +  E V+F+ + +      D+   +HRL AK  I       +      K+D++D+SL+  +++ +T FVAI+++
Sbjct:   16 ALKSIAVTLSINDFVAGVSATLNYENEEKSPLEAFFVFPMDEDSAVYSFEAFVDGKKIVAELQDKYQAHKRYEEALSGGYQAYLLEEDKCSRDVFCCNVGNLQPGSKVSLTLRYVQEL---PLEDDGALRY--VLPAILNPRYHLSDGREDSNLDMKTPIVPLEELPYTLSMVATISSQLGISTIQSNCPLNPIEYTGDNKTSAQVSLAEGHKFDRDVELLIFYRKVHSPSVAVEMG-----MSGRPSD-SLMGAPSAMVSFYPDIPEVETTTKC-GEFVFLMDRSRSMNSPMSSKDKSQLRIDAAKETLILLLKSLPMGCYFNIYGFGATHEEFFPDSVMYNQETMQIAVKKVKRLLADLGGTELLTPLRKIFRKPPIPGHPLQVFVFTDGEVVETFSVIREVMFQSKKHRCFSFGIGEGASTSLIKNLARVSGGTAEFITGNDRMQSKALRSLRRSLQSV-VEDVSLSWNLPPKMFAPMLSPEQTSIFRGQRLIIYSLLIGKIPKEEATGEVCLSYKLHGKSYEEKVTFSLQPKP-----DDNLTIHRLAAKSMIQSKDFGFKETSLMYKRDVLDISLESGVMSSFTAFVAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Match: AW551984 (expressed sequence AW551984 [Source:MGI Symbol;Acc:MGI:2143322])

HSP 1 Score: 242.662 bits (618), Expect = 1.776e-67
Identity = 175/597 (29.31%), Postives = 285/597 (47.74%), Query Frame = 2
Query:   74 SLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN-------HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            +LKS++V  +I + ++  +    Y+N+     E  F FP++ +  VY FEA V GKKI+   ++  +A   YE A   G+ A ++E++    DVF C +GN    S+  + L++  EL   P+  +   R+  +LP IL PRY   +   D  +   T         Y  +  A I+    I  + S      I +   NKTSA+V L   +   +D+++ I Y  +  PSV  E+G      SG+ +  S   +  AMV F P         +C  E V ++DRS SM             ID AKE L++ LKSLP+ C F IYGFG+  ++ F DS +Y+  ++ IA+   K L A+ GGTEL+ PL  ++       +    F+ TDG V     V + V   +K  R F+ GIG+G S SL+  +A+   G + F+     + +  +  L  ++ SV   D  L W+ P  +           IF    L  + ++ G       +G+V +   L G +  E V+F+ + +      D+   +HRL AK  I       +      K+D++D+SL+  +++ +T FVAI+++
Sbjct:   16 ALKSIAVTLSINDFVAGVSATLNYENEEKSPLEAFFVFPMDEDSAVYSFEAFVDGKKIVAELQDKYQAHKRYEEALSGGYQAYLLEEDKCSRDVFCCNVGNLQPGSKVSLTLRYVQEL---PLEDDGALRY--VLPAILNPRYHLSDGREDSNLDMKTPIVPLEELPYTLSMVATISSQLGISTIQSNCPLNPIEYTGDNKTSAQVSLAEGHKFDRDVELLIFYRKVHSPSVAVEMG-----MSGRPSD-SLMGAPSAMVSFYPDIPEVETTTKC-GEFVFLMDRSRSMNSPMSSKDKSQLRIDAAKETLILLLKSLPMGCYFNIYGFGATHEEFFPDSVMYNQETMQIAVKKVKRLLADLGGTELLTPLRKIFRKPPIPGHPLQVFVFTDGEVVETFSVIREVMFQSKKHRCFSFGIGEGASTSLIKNLARVSGGTAEFITGNDRMQSKALRSLRRSLQSV-VEDVSLSWNLPPKMFAPMLSPEQTSIFRGQRLIIYSLLIGKIPKEEATGEVCLSYKLHGKSYEEKVTFSLQPKP-----DDNLTIHRLAAKSMIQSKDFGFKETSLMYKRDVLDISLESGVMSSFTAFVAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Match: Vwa5b1 (von Willebrand factor A domain containing 5B1 [Source:MGI Symbol;Acc:MGI:1922968])

HSP 1 Score: 142.895 bits (359), Expect = 4.890e-34
Identity = 81/240 (33.75%), Postives = 128/240 (53.33%), Query Frame = 2
Query:  812 HSDVAMVKFLPKFDSSLMN-NQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMI 1528
            H  V M+ F P   S   N  +   E + ++DRS SM  +NI   KE +L+ LKSL   C F I GFGS F  VF  S++Y++ ++ +A +  + + A+ GGT ++ PL+ +    L   + RL FL+TDG+V+N  +V +LVR H  STR ++ GIG  V   LV  +A    G + F+   + L   +++ L  AM  V  +D  +EW  P+    + +P S   +F    L  + ++
Sbjct:  328 HHSVIMLNFCPDLQSVQPNPRKAHGEFIFLIDRSNSMSKTNIQCIKEAMLVALKSLMPACFFNIIGFGSTFKAVFASSRIYNEENLTMACDCIQRMQADMGGTNMLSPLKWVLRQPLRRGHPRLLFLITDGSVNNTGKVLELVRNHASSTRCYSFGIGPTVCYRLVKGLASVSKGSAEFLMEGERLQPKMVKSLKKAMAPV-LSDVTVEWVFPETTEALISPVSTSSLFPGERLMGYGIV 566          
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Match: sp|O00534|VMA5A_HUMAN (von Willebrand factor A domain-containing protein 5A OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=2)

HSP 1 Score: 270.781 bits (691), Expect = 1.218e-76
Identity = 184/605 (30.41%), Postives = 298/605 (49.26%), Query Frame = 2
Query:   59 YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDRE---------VFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            + +   LKS+SV  NI   ++  +    Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A+  YE A  +GH A ++E ++S  DVF C +GN    S+A + LK+  EL   P+ ++   RF  +LP +L PRY   +++G  +         +  V +  Y  +  A I+    IE V S        +   +KTSA+V L + +   +D+++ I Y  +  PSVV E+G  +         G       AMV F P       +N C  E + ++DRSGSM+            I  AKE L++ LKSLP+ C F IYGFGS ++  F +S  Y+  ++  AL   K + A+ GGTE++ PL+++Y       +    F+ TDG V++   V K VR + +  R F+ GIG+G S SL+  +A+A  G S F+     + +  +  L  ++  V   D  L WH P  +S          IF    L ++  + G       +G+V +K TL G    + V+F  + +      D    +HRL AK  +      +     + KKD ++LSL+  +++ +T F+AI+++
Sbjct:   11 HREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQEL---PLEADGALRF--VLPAVLNPRY---QFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGEDKTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPN------MKPGHLMGDPSAMVSFYPNIPEDQPSNTCG-EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTMEEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFGIGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPV-VEDVSLSWHLPPGLSAKMLSPEQTVIFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKP-----DVNLTIHRLAAKSLLQTKDMGLRETPASDKKDALNLSLESGVISSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Match: sp|Q75WE7|VWA5A_RAT (von Willebrand factor A domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Vwa5a PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 9.818e-74
Identity = 185/602 (30.73%), Postives = 298/602 (49.50%), Query Frame = 2
Query:   65 QKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAG------DREVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMING------MKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            +K  LKS+SV  +I + +++      Y+N+     E +F FP++ +  VY FEALV GKKI+   ++  +A + YE A  +GH A ++E++    DVF C +GN    ++  + L++  EL   P+ S+   R+  LLP +L PRY   E +        + +  +    Y  +  A I     IE V S      I +   +KTSA+V L   +   +D+++ I Y  +  PSV  E G           + S   +  AMV F P       +  C  E V ++DRSGSM+            I+ AKE LL+ LKSLP+ C F IYGFGS +++ F +S  Y+  +I  A+   K LDA+ GGTE++ PL ++Y +     +    F+ TDG VS+   V + V+ ++K  R F+ GIG G S SL+  +A+   G + F+     + A  +  L +A+      D  L W  P  +S+       P IF    L  +  + G       +    +K TL G +    V+F+ + +      +  F +HRL AK+ I   ++     S EE  KKD++++SLQ  +++ +T FVAI+++
Sbjct:   13 EKVPLKSISVTLSINDFVAAVAATLHYENEEKVPIEAMFVFPMDEDSAVYSFEALVDGKKIVAELQDKTKAHSKYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPGTKVAVTLRYVQEL---PLESDGALRY--LLPAVLNPRYQLSEQSASSCLNVQKPIVPLEALPYTLSMVATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYREVHSPSVAVEKGMQD------KKRDSLMGAPCAMVSFYPDIPEVNASKVCG-EFVFLMDRSGSMQTPMRTEENSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEQFFPESVKYTQETIEEAVERVKRLDADLGGTEILTPLRNIYKTSSIPGHPLQLFVFTDGEVSDTYSVIREVKLNSKKHRCFSFGIGQGASTSLIKNIARVSGGTAEFITGKDRMQAKALGSLKLALQCA-LDDISLSWELPPGLSVNMLSPEQPTIFRGQRLIIYAQLTGPMPQAESRGAVCLKHTLQGKSLENKVAFSLQPKE-----NANFTIHRLAAKFLIQTKDLGSHEVSKEE--KKDVMNISLQSGVLSSFTAFVAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Match: sp|Q99KC8|VMA5A_MOUSE (von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=Vwa5a PE=1 SV=2)

HSP 1 Score: 246.128 bits (627), Expect = 7.282e-68
Identity = 186/599 (31.05%), Postives = 299/599 (49.92%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD------REVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSI-VTAPKSIPPIFSDYFLTAFCMINGM-----KSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            LK++SV  +I   +++      Y+N+     E  F FP++ +  VY FEALV GKKI+   ++  +A + YE A  +GH A ++E++    DVF C +GN    ++  + L++  EL   P+ ++   R+  LLP IL PRY   E + +      +    + +  Y  N  A I     IE V S      I +   +KTSA+V L   +   +D+++ I Y  +  PSV  E+G    L    D   S   +  AMV F P       +  C  E V ++DRSGSM             I+ AKE LL+ LKSLP+ C F IYGFGS ++K F +S  Y+  ++  A+   K L AN GGTE++ PL ++Y +     +    F+ TDG VS+   V + V+ ++K  R F+ GIG G S SL+  +A+   G +VF+     +    +  L  A+      +  L W  P  +S+ + +P+ +  IF    L  +  + G+      +G V +K  L G +    V+F+ + +  D      F +HRL AK  I   +   Q  S EE  K+D++++SLQ  +++ +T F+AI+++
Sbjct:   17 LKNISVTLSINEFVAAVVATLNYENEEKVPLEATFVFPMDEDSAVYSFEALVDGKKIVAELQDKMKAHSEYEEALSQGHQAYLLEEDDYSRDVFSCNVGNLQPGAKVAVTLRYVQEL---PLETDGALRY--LLPAILNPRYQLSEQSANSCLNIQKPTVPLEDLPYTLNMTATITSQHGIERVQSNCSLSPIQYLTDDKTSAQVSLTEGHKFDRDVELLIYYNEVHSPSVAVEMGM---LDMKPD---SLMGAPSAMVSFYPDIPEVEASKAC-GEFVFLMDRSGSMDSPMSTENNSQLRIEAAKETLLLLLKSLPMGCYFNIYGFGSSYEKFFPESVKYTQDTMEDAVKRVKALKANLGGTEILTPLCNIYKASSIPGHPLQLFVFTDGEVSDTFSVIREVKLNSKKHRCFSFGIGQGASTSLIKNIARVSGGTAVFITGKDRMQTKALGSLKFALQCA-VDNISLSWDLPPGLSVKMLSPEQL-TIFRGQRLIIYAQLTGLMPQVESTGAVCLKHILQGRSLENRVTFSLQPKAND-----NFTIHRLAAKSLIQTKDFGSQEASKEE--KEDVMNISLQSGVLSSFTAFIAINKE 594          
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Match: sp|Q54CQ8|Y2740_DICDI (von Willebrand factor A domain-containing protein DDB_G0292740 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292740 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.715e-52
Identity = 173/647 (26.74%), Postives = 310/647 (47.91%), Query Frame = 2
Query:   41 GLCPLKY---------DQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENV---SSVNHTLEIAFNNTNKTSAEVHLKSK--YDGTKDL-------DININYLAMKEPSVVYEVGSSSPLY----------SGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQ---CKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFND-SQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIA----MNSVPFTDAK-LEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMI--------NGMKSGDVIKCTLSGSAN-GEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAE-QIESGEETLKKDLIDLSLQVNIVTKYTTFVAI-DQDAPGEPLVTCI 1828
            GL P+ Y         + +F +   S+D  + +   +C     YKN+     E ++  P+     V  F     GK + G  K+  +A+  Y+ A   G  A + EK+    + F  ++GN P  +E+ I +   M        SE+    + L             Y   R  F  +++Y ++    +N +  I+++      +H+L+  + N  KT   +  K    ++   ++       D+N     +++ S+  E   ++P            + K+ + S Y      + F PKF+S  +N +    K E + ++D SGSM G+ ID A+  L I ++SL   CKF IY FGS F+K F + S+ Y D S+ +   Y  N+ AN GGTEL++P++D+ +  +  +Y R  F+LTDG VS++ ++ + V K +K+TR+FT GIG  V + LV  ++KA  G    +RN+ ++   VM+LL IA    +++V F  ++ L+    +  +I+ +P  I PIF++  +  +  I        N    G  +  T++     G+ +S+  E+   +    +   +H L A  +I ++ E + +S +ET K ++I L  + N+V+K+T+ V   D D+P E  +  I
Sbjct:   58 GLAPIAYQYYNVSSFDNNQFKIVDFSIDSKLNDTCLTCVWTQTYKNESKTPVEAVYRIPLSPLSTVSAFSVQFNGKTLHGKIKDSTKAQEKYDDAIASGGQAFLAEKSKDDDNYFNFKLGNIPP-TESSITIHITM-------ISEIGSHLNSL------------HYLLHRYCFPQSSNYNFSLSLSVNLSNSIKSIFFDGDKSHSLQ--YENKEKTKCIIQYKKSLGFNTQPNILIVFELDDLNKPQSFIEKLSINKEDIKNNPHSDSDSDSDDEENKKENEKSSY---AIALNFFPKFES--INKEDIYQKGEFIFLIDCSGSMSGNPIDSARRALEIIIRSLNEQCKFNIYCFGSGFNKAFQEGSRKYDDDSLAVVNRYVSNISANLGGTELLQPIKDILSKEIDPEYPRQIFILTDGAVSDRSKLIEFVSKESKTTRIFTYGIGSSVDVELVVGLSKACKGYYTLIRNSSDMETEVMKLLSIAFEPTLSNVSFDWSQLLDLSNGKSTTIIQSPTQIRPIFNNERMMVYATIELDNDISNNIENHGQPVIVTMNADGPLGDRLSYHVELDFKN--YSQSNSIHTLAAFKRIQDLEEIERKSSKETEKLEIIKLGKKYNLVSKHTSLVVTSDSDSPTEDTMKVI 675          
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Match: sp|Q54DV3|Y2016_DICDI (von Willebrand factor A domain-containing protein DDB_G0292016 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0292016 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 5.622e-50
Identity = 161/598 (26.92%), Postives = 281/598 (46.99%), Query Frame = 2
Query:   41 GLCPLK-YDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFN-NTNKTSAEVHLKSKYDG--TKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNN-QCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMI-NGMKSGDVIKC----------TLSGSA-NGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFV 1783
            GL  LK ++  F LK  S++  I +  S+      Y ND N   E  +  P+    +V  F+    GK I G  KE E+A   Y  A   G  A +  K+      F   +GN P     K+ +          + SE+    D  L   L  RY  P YA           + +N+  V+  +  I+++      + + +  N++K  A++  KS++     K++ + I  + + EP  + E       Y G     S+       + F P F +   +    K+E + ++D SGSM G +I++A+  + I ++SL    K  IY FGS F+KVF+ S++Y+D ++ IA ++ + + AN GGTEL+ P+ D+ +S    +Y R  F+LTDG +S +D++   V K   +TR+FT GIG  V   LV  ++KA  G    ++    +   VM+LL++A   +  ++ KL+W     V ++ AP  I P+F+   +  + MI +   + D+I            TL+G    G  +SF   +   +       ++H L A   I ++ E     ++  K  +++L  +  +V+K+T+++
Sbjct:   47 GLYSLKNHNNVFVLKEFSIETEINDCSSTSIWTQSYSNDSNTPVEAKYQLPLHPTSVVSNFQIEYQGKVIQGKIKEKEKALEKYNDAIASGGQAFMATKSDD--GYFNLTLGNLPPKENVKVRVV---------ISSELGTHTDGQLHYCLH-RYMFPSYA-----------FNFNYNVVLKFSIPIKSIDCDGFDVNVNYKENSSKKEAKITSKSQHTSGVKKNIILIIQPVELNEPKSMIE-------YIGGGDDKSY----ATAINFYPSFKNVNPDEVYQKSEFIFLIDCSGSMSGQSINKARRAMEIIIRSLNEQHKVNIYCFGSSFNKVFDKSRVYNDETLEIAGSFVEKISANLGGTELLPPMVDILSSPNDPEYPRQVFILTDGEISERDKLIDYVAKEANTTRIFTYGIGASVDQELVIGLSKACKGYYEMIKETTNMEKQVMKLLNVAFEPM-LSNIKLDWSSCGLVDVIQAPSHIRPLFNQERMMIYSMIPSNQTNQDIINASIETSKPLIITLTGDGPKGNVLSFPITLDFKNDLSTNSNQIHTLAAFKHIQDLEESERKEKKDNKDKIVELGKKYGLVSKHTSYI 609          
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Match: I1ZID1 (Vault protein inter alpha trypsin-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 6.082e-171
Identity = 268/279 (96.06%), Postives = 273/279 (97.85%), Query Frame = 2
Query:   26 ITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMV-KFLPKFDSS 859
            ++TMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVF+CRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDR DLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMV K + K + S
Sbjct:    3 LSTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFRCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRLDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVTKLVRKHNKS 281          

HSP 2 Score: 411.764 bits (1057), Expect = 1.067e-127
Identity = 199/205 (97.07%), Postives = 203/205 (99.02%), Query Frame = 2
Query: 1223 VTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITDD 1837
            VTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQ+APGEPLVT I ++
Sbjct:  271 VTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQNAPGEPLVTNIEEE 475          

HSP 3 Score: 107.457 bits (267), Expect = 4.852e-20
Identity = 45/99 (45.45%), Postives = 72/99 (72.73%), Query Frame = 3
Query: 2100 DIIMFLVDLQNINGSWNYDEKIFAYIGIDVNRIKEIQPDKISDIIWSTAVIYQHLMIKEQAREKEWRLFARKAKEWIEQNLNDSAIFNDILNKSAELFH 2396
            D+I++LVD QNINGSWN++E I   IG+++   +   P +IS+ +W T  IYQ+L++KE +REKEWRL A+KAK WIE+++ +S + +    ++++L H
Sbjct:  588 DVIIYLVDKQNINGSWNFNESILLKIGVNITEFRNKMPGRISEEVWITVAIYQYLVLKESSREKEWRLVAKKAKNWIEKSIAESDLQDLAFREASDLLH 686          
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Match: K1Q7V6 (von Willebrand factor A domain-containing protein 5A OS=Crassostrea gigas OX=29159 GN=CGI_10024419 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 2.305e-96
Identity = 205/589 (34.80%), Postives = 318/589 (53.99%), Query Frame = 2
Query:   86 LSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEY------NFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSK-YDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVI---KCTLSGSANGEPVSFTTEI-----RNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPG 1807
            + V  +I  L++S   E  Y +D +E+ E +F FP++ +  VY FEA + GK I+   +E  +AK  Y+ A   G+ A  + +  +  D F+ ++GN P  + A++ L++  E+ +S   S+ +  F  +LP  L PRY P        +  + +   Y      N  AVI G         V+ T +  F+   +   E+   SK  D   D  I ++Y   ++P VV E GS+       D    F  +DV MV F P F++  + NQ   E VI++D SGSM GS +++AKE LL+ LKSLPV CKF I  FGS+F  +F +S  Y ++S+ +A+  QKNL A+ GGTE+++PLE+++ + L   +SR  FLLTDG V N  E+ +LVRK  K+TR+FT G+GDG S  L+  VAKAG GK+ FV+++  L + VM +L  ++ S   TD  L W  P   + +  P+++P IF       +C+I+G     +       L+G A  + + +         + TDA  D  + +HRL AK  + EM  +I + +E+L   ++ LS   NI  KYT FV +D+ + G
Sbjct:   36 IDVQVSINGLIASVKSELHYVSDKDENTETVFVFPLDSDAAVYEFEAEIDGKTIVAEVQEKSQAKETYQDAVASGYTAVYMSEADNAGDTFRLKLGNLPAKAAARLTLRYVQEVDVS---SDKIGTF--MLPRALNPRYVPNPSDASFRIHTIQSGVTYCPDFTMNLNAVIAG-----GTRMVDLTTKWEFDVLAEKMDEMISSSKQLDNGIDFSIVLHYKGFEQPGVVLETGSA-------DKNNPFLSTDVLMVNFSPNFEN--LENQVPCEFVIIIDCSGSMMGSRMEKAKETLLLILKSLPVNCKFTIIRFGSRFSSLFLESSKYDENSLKVAMQLQKNLQADMGGTEILKPLENVFKNRLSGCHSRQIFLLTDGAVYNVPELVQLVRKQ-KNTRVFTFGMGDGCSTELIRDVAKAGNGKATFVKDSDRLQSKVMSVLKASIQS-EITDVTLTWSLPTGCTAINVPENVPAIFDGEMFILYCIISGNVEESLFGKSSVVLTGHAGDKTLDYKMNFVLGSKKQTDA--DNLYPIHRLAAKASLTEM--EISNVKESL---MVSLSTTTNITCKYTAFVGVDKHSKG 596          
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Match: A0A0R3TAC8 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS4016 PE=4 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 6.730e-91
Identity = 204/614 (33.22%), Postives = 327/614 (53.26%), Query Frame = 2
Query:   65 QKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLL-PLILRPRYTPPEYAGDREVFQVTNH---YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPS-DYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCP---QHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIK----------CTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGE----------ETLKKDLIDLSLQVNIVTKYTTFVAIDQD----APGE 1810
            +  +L    V   I N  +  TC F+Y+N  +E  E  F FP+E    VY+ EA++G K+++  C+E  EA+  Y  A EKGH A +++++  M D FK ++GN P   + +I  K+ + L L  V + + +RF  L  P++    ++ P   G R    V       + NF A I G   I +V+S +HTL++ + N  K+ A+V L        D ++ I   AM +P ++     +SP   G   +G F         FLP    S  ++  K EI+ V+DRSGSMRGS I ++KE LL+FLKSLP  C+FQI  FGS+F  +F     Y++ ++  AL++Q  L+AN GGTEL   L+ +Y++ +    + R   +LTDG + NQD+V  LVRK+  + R+F +G+G+ VS SL+  +A+AG G + F+R++  L    + +L   +  +   D  L+W      + V I+T P  +PP+FS +FLTAF    G+ +  V             TLS   N E  + T+++ +      E   +HRL AK ++ E+ +   S E          E +++ ++D+S+  N++ ++TTFV +D D    APG+
Sbjct:   21 ESVALDKYDVSALIINNNADVTCNFLYENTSSELIEAEFIFPLESTAAVYHLEAVIGKKRLVAKCRERVEAEATYNEAVEKGHTAFMMQEDFHMGDTFKMKLGNIPAGDKIEITFKYVVPLYLREVDTSL-ERFKSLKEPVVCV--FSMPGKIGARYGANVPASKLAAKMNFVAEIYGAGGILSVTSPHHTLQVNYLNEEKSRAKVSLSDGVVVENDFEMEI---AMDKPHIL-----ASPCEIGSVEKGGFLGMHCIAASFLPNIAQSRASDGDKCEIIFVLDRSGSMRGSRIQKSKEALLLFLKSLPKKCRFQIVSFGSRFSSLFPQPVDYTEENVKQALDHQSQLEANMGGTELYPALKSIYDTPITGVGWYRQIIVLTDGEIFNQDDVIGLVRKNQVNARVFAIGLGNEVSTSLIWGIARAGRGTASFIRDSDNLRTGALSVLKATLQPM-LKDVSLKWDVKVDGKAVEILTVPSQLPPLFSGHFLTAF----GLTAASVKSNSGSPEVEGTLTLSYKLNEEVHTQTSKVESLGVEY-ENLGLHRLAAKAQLLELVDMYSSLEGRGEEGKKEAEEVRQQIVDISVNANVIARFTTFVGVDPDKIDSAPGK 617          
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Match: A0A068WQX3 (von Willebrand factor A domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_001168700 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.832e-90
Identity = 197/602 (32.72%), Postives = 320/602 (53.16%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLL---------LPLILRPRYTP-PEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLP-SDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCP---QHVSIVTAPKSIPPIFSDYFLTAFCMINGMKS-GDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEE-FRVHRLLAKYKINEMAEQI------------ESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            L+   V   I N  +  +CEF YKN  +E  E  F+FP+E    VY+ EA++G K ++  C+E  EA+  Y  A E GH A +++++ +M D F+ ++GN P     K+  ++ + L +  V  + ++RF  L         +PL++  RY P P   G      ++   + +F A I  T  + +V+S +   +++F +  K  A++ +    D + D ++    LA++ P  +      +P   G  ++G F         FLP    S  ++  K EI+ V+DRSGSM GS I   KE LL+FLKSLP  C+FQI GFGS F+ +F     Y+  ++  AL YQK L AN GGTE++  L+ +Y++ +  + + R    LTDG +SNQDEV  LV ++ +S RLF +G+GD VS SL+  VA+AG G +VF+R+   L A+ M +L  A+  +  TD +L+W      +   I+T P  +PP+FS  F+TAF +     S    I+ TL  S        + E       V++E   +HRL AK ++ E+ ++             ES +  +++ ++D+S   N+++ +T+FV +D D
Sbjct:   17 LEKFDVHAVIVNNNADVSCEFAYKNSTSEIIETEFAFPLESTAAVYHLEAIIGKKHLVAHCRERIEAEETYSEAVESGHTAFMMQEDYTMGDTFRMKLGNIPAGETIKLTFRYVVPLYVREV-DKTIERFSGLQEPYVLIFSMPLLIGERYDPNPGAHGCTAAPHLS--AKMSFVADICATGGVLSVTSAHQKFQVSFVDEAKEHAKITVPGNLDLSHDFELE---LALQNPHAL-----CAPCELGCASKGGFLGMHCITAAFLPNISQSPASDGDKREIIFVIDRSGSMSGSKIQNTKESLLLFLKSLPKKCRFQIVGFGSSFNPLFPQPVDYNKENVEQALGYQKTLSANMGGTEVLSVLKFVYDTPVTGAGWYRCIIFLTDGEISNQDEVIGLVTRNQQSARLFAIGLGDEVSTSLIWGVARAGRGTAVFIRSGDNLRAATMSVLGSALQPM-LTDVELKWDVKVDGKAPEILTVPTRLPPLFSGVFMTAFGLFQADDSKSPRIEGTLKLSYKLNDTVHSQETAVQILPVEQENLGLHRLAAKAQLLELVDKHSALHANDGDKVDESAKSEIRQQIVDISTNTNVISPFTSFVGVDPD 606          
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Match: W6ULK4 (von Willebrand factor A domain-containing protein 5A OS=Echinococcus granulosus OX=6210 GN=EGR_06108 PE=4 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.313e-89
Identity = 196/602 (32.56%), Postives = 319/602 (52.99%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLL---------LPLILRPRYTP-PEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLP-SDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCP---QHVSIVTAPKSIPPIFSDYFLTAFCMINGMKS-GDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEE-FRVHRLLAKYKINEMAEQI------------ESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            L+   V   I N  +  +CEF YKN  +E  E  F+FP+E    VY+ EA++G K ++  C+E  EA+  Y  A E GH A +++++ +M D F+ ++GN P     K+  ++ + L +  V  + ++RF  L         +PL++  RY P P   G      ++   + +F A I  T  + +V+S +   +++F +  K  A++ +    D + D ++    LA++ P  +      +P   G  ++G F         FLP    S  ++  K EI+ V+DRSGSM GS I   KE LL+FLKSLP  C+FQI GFGS F+ +F     Y+  ++  AL YQK L AN GGTE++  L+ +Y++ +  + + R    LTDG +SNQDEV  LV ++ +S RLF +G+GD VS SL+  VA+AG G +VF+R+   L A+ M +L  A+  +  TD +L+W      +   I+  P  +PP+FS  F+TAF +     S    I+ TL  S        + E       V++E   +HRL AK ++ E+ ++             ES +  +++ ++D+S   N+++ +T+FV +D D
Sbjct:   17 LEKFDVHAVIVNNNADVSCEFAYKNSTSEIIETEFAFPLESTAAVYHLEAIIGKKHLVAHCRERIEAEETYSEAVESGHTAFMMQEDYTMGDTFRMKLGNIPAGETIKLTFRYVVPLYVREV-DKTIERFSGLQEPYVLIFSMPLLIGERYDPNPGAHGCTAAPHLSA--KMSFVADICATGGVLSVTSAHQKFQVSFVDEAKEHAKITVPGNLDLSHDFELE---LALQNPHAL-----CAPCELGCASKGGFLGMHCITAAFLPNISQSPASDGDKREIIFVIDRSGSMSGSKIQNTKESLLLFLKSLPKKCRFQIVGFGSSFNPLFPQPVDYNKENVEQALGYQKTLSANMGGTEVLSVLKFVYDTPVTGAGWYRCIIFLTDGEISNQDEVIGLVTRNQQSARLFAIGLGDEVSTSLIWGVARAGRGTAVFIRSGDNLRAATMSVLGSALQPM-LTDVELKWDVKVDGKAPEILIVPTRLPPLFSGVFMTAFGLFQADDSKSPRIEGTLKLSYKLNDTVHSQETAVQILPVEQENLGLHRLAAKAQLLELVDKHSALHANDGDKVDESAKSEIRQQIVDISTNTNVISPFTSFVGVDPD 606          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000016124.2 (pep primary_assembly:Astyanax_mexicanus-2.0:8:24927342:24950812:1 gene:ENSAMXG00000015665.2 transcript:ENSAMXT00000016124.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.662 bits (618), Expect = 4.306e-68
Identity = 167/605 (27.60%), Postives = 293/605 (48.43%), Query Frame = 2
Query:   41 GLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNH-----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGE-ETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            GL  +K ++   LKS+ V+  ++  +++ +    Y N+     E LF FP+     + +F A +G ++ +   +E E+AK+ Y+ A   G  A ++E++    DVFK  +G+ P    A +   +  EL    V+++   RF   LP +L PRY+PP      ++ Q+T       Y  +F A ++    I  V S    LE    NT++T+A+V L + +   +D+++ + Y    +P+ + E G  +         G+     V M+   P+F  ++M++     E V V+DRSGSM  +          I+ A++ L++ LKSLP+ C F IY FGS +  +F  S  Y++ ++  A+   K + ++ GGTE++ PL ++Y+     ++ R  F+ TDG V N  +V +LVR +    R F+ GIG+G S +L+  +A+ G G + F+  +  +   VM+ L  A+      D    W  P  +S       + P  +  F     +I     G+V      G+   +      E+ NT         +HRL A+  I   E  EQ E  E E LK  +++LS++  +   +T F+A+ + +
Sbjct:    6 GLLTVK-NEPVPLKSIEVELQVQGHVATVSSTLQYTNEEQSPLEALFVFPLPAESALCHFSAKIGDQETVAKVQEKEKAKDEYDDAIASGQQAFLLEESDESEDVFKLSVGSLPPGQSAAVTFIYVTELS---VQADHSLRF--CLPAVLNPRYSPP----GTKLPQITERQMLIPYSLSFTATVSSPNPIAKVES-KCALEPLVFNTDRTNAKVSLSAGHKFDRDVELYLYYENAHQPTAIVEAGVPT------AKPGTLMGDPVVMLSLYPEFPEAIMSSMSTCGEFVFVMDRSGSMGCAMHNGPGAKMRIESARDTLVLLLKSLPMGCYFNIYSFGSHYKSLFPKSVEYTEETMDQAVKRVKEMQSDMGGTEILEPLRNIYSQQCIPNHPRQVFIFTDGEVGNTKDVLQLVRNNADHHRCFSFGIGEGASTALIKGMAQEGRGHNQFITGSDRMQPKVMQSLRYALQPA-VIDITEVWSVPAGMSTT----HLSPPLNVLFHGQRALIYAQLKGEVRTPDSQGTITVKYQLAGQEVTNT-------LSIHRLAARSLIRSLERQEQTEGAEKEALKARVVELSVEAGVSCSHTAFIAVHKGS 581          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000043227.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:24927342:24946352:1 gene:ENSAMXG00000015665.2 transcript:ENSAMXT00000043227.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.047 bits (619), Expect = 7.197e-68
Identity = 164/605 (27.11%), Postives = 295/605 (48.76%), Query Frame = 2
Query:   41 GLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNH----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDV-IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGE-ETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            GL  +K ++   LKS+ V+  ++  +++ +    Y N+     E LF FP+     + +F A +G ++ +   +E E+AK+ Y+ A   G  A ++E++    DVFK  +G+ P    A +   +  EL    V+++   RF   LP +L PRY+PP      ++ Q+T      Y  +F A ++    I  V S    LE    NT++T+A+V L + +   +D+++ + Y    +P+ + E G  +         G+     V M+   P+F  ++M++     E V V+DRSGSM  +          I+ A++ L++ LKSLP+ C F IY FGS +  +F  S  Y++ ++  A+   K + ++ GGTE++ PL ++Y+     ++ R  F+ TDG V N  +V +LVR +    R F+ GIG+G S +L+  +A+ G G + F+  +  +   VM+ L  A+      D    W  P  +S       +  +F       +  + G   G + +K  L+G      ++++ +             +HRL A+  I   E  EQ E  E E LK  +++LS++  +   +T F+A+ + +
Sbjct:    6 GLLTVK-NEPVPLKSIEVELQVQGHVATVSSTLQYTNEEQSPLEALFVFPLPAESALCHFSAKIGDQETVAKVQEKEKAKDEYDDAIASGQQAFLLEESDESEDVFKLSVGSLPPGQSAAVTFIYVTELS---VQADHSLRF--CLPAVLNPRYSPP----GTKLPQITERQIIPYSLSFTATVSSPNPIAKVES-KCALEPLVFNTDRTNAKVSLSAGHKFDRDVELYLYYENAHQPTAIVEAGVPT------AKPGTLMGDPVVMLSLYPEFPEAIMSSMSTCGEFVFVMDRSGSMGCAMHNGPGAKMRIESARDTLVLLLKSLPMGCYFNIYSFGSHYKSLFPKSVEYTEETMDQAVKRVKEMQSDMGGTEILEPLRNIYSQQCIPNHPRQVFIFTDGEVGNTKDVLQLVRNNADHHRCFSFGIGEGASTALIKGMAQEGRGHNQFITGSDRMQPKVMQSLRYALQPA-VIDITEVWSVPAGMSTTHLSPPLNVLFHGQRALIYAQLKGEVRGTITVKYQLAGQEVTNTLNYSLKPAENSG-----LSIHRLAARSLIRSLERQEQTEGAEKEALKARVVELSVEAGVSCSHTAFIAVHKGS 587          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Match: si:ch73-265h17.1 (von Willebrand factor A domain-containing protein 5A-like [Source:NCBI gene;Acc:103024697])

HSP 1 Score: 240.35 bits (612), Expect = 1.139e-66
Identity = 175/596 (29.36%), Postives = 293/596 (49.16%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEY-AGDREVFQVTNH--YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNN-QCKTEIVIVVDRSGSMR-----GSN----IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-KSGD-----VIKCTLSGSANGEPVSFTTE-IRNTDAFVDEEFRVHRLLAKYKINEMAEQIES-GEETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            LKS+ V+  ++  +++ +    YKN+     E LF FPI  +  + +F A +G ++I+   +E E+A+  Y+ A   G  A ++E++    DVFK  +G+ P    A +   +  EL    V+++   RF   LP +L PRY PP   +G      V+    Y  +F A ++    +  V S      + F N  +TSA+V L   +   KD+++ + Y    +P+ + E    +        QG+     V M+   P F  ++M++   + E V V+DRSGSM      GS     I+ A++ LL+ LKSLP+ C F IYGFGS ++  F  S  Y+  ++  A+N  K++ A+ GGTE++ PL+ +Y      ++ R  F+ TDG V N  +V  LV+K  KS R FT GIG+G S +L+  +A+ G G + F+  +  +   VM+ L  A++     D    W  P  +S       +  IF       +  + G  KS D      +K  L+G      +SF+ +   NT         +HRL A+  I  +  Q ++ G E LK  +++LS++  +   +T F+A+ + +
Sbjct:   16 LKSIEVELQVQGHVATVSSTLQYKNEEQSPLEALFVFPIPADAALCHFSAKIGDQEIVSKLQEKEQARYEYDDAIASGQQAFLLEESDESEDVFKLSVGSLPPGQSAAVTFIYVTELS---VQADHSLRF--CLPAVLNPRYLPPGSDSGIVSEITVSESIPYSLSFTATVSSPNPVAKVESKCALDPLVFLNAERTSAKVSLSVGHKFDKDVELYLYYENAHQPTAIVEAAVPT------AKQGTLMGDPVVMLSLYPDFPEAVMSSMSSRGEFVFVMDRSGSMACPMHFGSGAQERIESARDTLLLLLKSLPLGCYFNIYGFGSSYESYFPTSVEYTQKTMDEAVNRVKDMHADLGGTEILEPLKHIYKQKCIPNHPRQVFIFTDGEVGNTKQVISLVKKEAKSHRCFTFGIGEGASTALITGMAQNGRGHAQFITGSDRMQPKVMQSLHYALHPA-VDDITDVWTVPAGMSTTRLSPPLSVIFQGQRALIYAQLKGQCKSSDSEGTVTVKYRLAGQEVSNTLSFSLKPAENTG------LSIHRLAARSLIRSLERQEQTEGPEALKARVVELSVEAGVSCSHTAFIAVHKSS 593          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Match: si:ch73-265h17.1 (von Willebrand factor A domain-containing protein 5A-like [Source:NCBI gene;Acc:103024697])

HSP 1 Score: 239.965 bits (611), Expect = 2.369e-66
Identity = 175/596 (29.36%), Postives = 293/596 (49.16%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEY-AGDREVFQVTNH--YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNN-QCKTEIVIVVDRSGSMR-----GSN----IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM-KSGD-----VIKCTLSGSANGEPVSFTTE-IRNTDAFVDEEFRVHRLLAKYKINEMAEQIES-GEETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            LKS+ V+  ++  +++ +    YKN+     E LF FPI  +  + +F A +G ++I+   +E E+A+  Y+ A   G  A ++E++    DVFK  +G+ P    A +   +  EL    V+++   RF   LP +L PRY PP   +G      V+    Y  +F A ++    +  V S      + F N  +TSA+V L   +   KD+++ + Y    +P+ + E    +        QG+     V M+   P F  ++M++   + E V V+DRSGSM      GS     I+ A++ LL+ LKSLP+ C F IYGFGS ++  F  S  Y+  ++  A+N  K++ A+ GGTE++ PL+ +Y      ++ R  F+ TDG V N  +V  LV+K  KS R FT GIG+G S +L+  +A+ G G + F+  +  +   VM+ L  A++     D    W  P  +S       +  IF       +  + G  KS D      +K  L+G      +SF+ +   NT         +HRL A+  I  +  Q ++ G E LK  +++LS++  +   +T F+A+ + +
Sbjct:   16 LKSIEVELQVQGHVATVSSTLQYKNEEQSPLEALFVFPIPADAALCHFSAKIGDQEIVSKLQEKEQARYEYDDAIASGQQAFLLEESDESEDVFKLSVGSLPPGQSAAVTFIYVTELS---VQADHSLRF--CLPAVLNPRYLPPGSDSGIVSEITVSESIPYSLSFTATVSSPNPVAKVESKCALDPLVFLNAERTSAKVSLSVGHKFDKDVELYLYYENAHQPTAIVEAAVPT------AKQGTLMGDPVVMLSLYPDFPEAVMSSMSSRGEFVFVMDRSGSMACPMHFGSGAQERIESARDTLLLLLKSLPLGCYFNIYGFGSSYESYFPTSVEYTQKTMDEAVNRVKDMHADLGGTEILEPLKHIYKQKCIPNHPRQVFIFTDGEVGNTKQVISLVKKEAKSHRCFTFGIGEGASTALITGMAQNGRGHAQFITGSDRMQPKVMQSLHYALHPA-VDDITDVWTVPAGMSTTRLSPPLSVIFQGQRALIYAQLKGQCKSSDSEGTVTVKYRLAGQEVSNTLSFSLKPAENTG------LSIHRLAARSLIRSLERQEQTEGPEALKARVVELSVEAGVSCSHTAFIAVHKSS 593          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000052541.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:24927282:24943774:1 gene:ENSAMXG00000015665.2 transcript:ENSAMXT00000052541.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.113 bits (601), Expect = 6.163e-66
Identity = 163/610 (26.72%), Postives = 293/610 (48.03%), Query Frame = 2
Query:   41 GLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNH----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMRGS---------NIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMING------MKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGE-ETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            GL  +K ++   LKS+ V+  ++  +++ +    Y N+     E LF FP+     + +F A +G ++ +   +E E+AK+ Y+ A   G  A ++E++    DVFK  +G+ P    A +   +  EL    V+++   RF   LP +L PRY+PP       V ++T      Y  +F A ++    I  V S    LE    NT++T+A+V L + +   +D+++ + Y    +P+ + E G  +         G+     V M+   P+F  ++M++     E V V+DRSGSM  +          I+ A++ L++ LKSLP+ C F IY FGS +  +F  S  Y++ ++  A+   K + ++ GGTE++ PL ++Y+     ++ R  F+ TDG V N  +V +LVR +    R F+ GIG+G S +L+  +A+ G G + F+  +  +   VM+ L  A+      D    W  P  +S       +  +F       +  + G       +    +K  L+G      ++++ +             +HRL A+  I   E  EQ E  E E LK  +++LS++  +   +T F+A+ + +
Sbjct:    5 GLLTVK-NEPVPLKSIEVELQVQGHVATVSSTLQYTNEEQSPLEALFVFPLPAESALCHFSAKIGDQETVAKVQEKEKAKDEYDDAIASGQQAFLLEESDESEDVFKLSVGSLPPGQSAAVTFIYVTELS---VQADHSLRF--CLPAVLNPRYSPPGTQAGV-VSEITTSASIPYSLSFTATVSSPNPIAKVES-KCALEPLVFNTDRTNAKVSLSAGHKFDRDVELYLYYENAHQPTAIVEAGVPT------AKPGTLMGDPVVMLSLYPEFPEAIMSSMSTCGEFVFVMDRSGSMGCAMHNGPGAKMRIESARDTLVLLLKSLPMGCYFNIYSFGSHYKSLFPKSVEYTEETMDQAVKRVKEMQSDMGGTEILEPLRNIYSQQCIPNHPRQVFIFTDGEVGNTKDVLQLVRNNADHHRCFSFGIGEGASTALIKGMAQEGRGHNQFITGSDRMQPKVMQSLRYALQPA-VIDITEVWSVPAGMSTTHLSPPLNVLFHGQRALIYAQLKGENQTPDSQGTITVKYQLAGQEVTNTLNYSLKPAENSG-----LSIHRLAARSLIRSLERQEQTEGAEKEALKARVVELSVEAGVSCSHTAFIAVHKGS 594          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000973.1 (pep scaffold:Pmarinus_7.0:GL479898:11183:30237:-1 gene:ENSPMAG00000000879.1 transcript:ENSPMAT00000000973.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 5.553e-63
Identity = 156/509 (30.65%), Postives = 245/509 (48.13%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGK-KIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEY-----NFKAVINGTKVIEN------VSSVNHTL-EIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLP-KFDSSLMNNQCKTEIVIVVDRSGSMR---------GSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMING 1534
            L+S++V   ++  ++      +Y N      E  + FP+  N  V+ F A VG + + +   +    A   Y+ A  KGHMAA + +     DVF C +GN     EA++ L+F  EL + P   +   RF   LP +L PRY+P +  G     +    +EY     N    ++ T   EN      VSS +  L  +AF    KTSA+V L+  +    D+++ I+Y    +P  + E G          A+ SF    VAM+ F P   + + +      E + ++D SGSMR          +    +KE L++ +KSLP+ C F IY FG+++  +F +S  Y+  +I  AL + K  DA+ GGT ++ PL D+Y      ++ R  FLLTD  V N + V + V+ H+   R F  GIG GVS  L+ +VA+ G G S FV ++ +L A V+ +L  AM  +   + +LEW  P  V++   P     IF    +  +    G
Sbjct:    3 LRSVAVKALVQGFVADVVASMIYHNKEAFPVEPSYFFPLNDNSAVHAFRARVGDRARYVVTTRLTTPAVEEYDDAIAKGHMAAQLSQQCG--DVFHCVLGNLGAGEEAEVTLEFVSELDVGP---DGAVRF--CLPTVLNPRYSP-QGTGFPLCSRSMIPWEYLAPSQNVPYTLSFTLTAENPGGILDVSSPSDLLGPVAFTEPGKTSAQVSLEGDFRFDHDIEVLISYEQKHQPFALVEPGLPV-------AEVSFLADTVAMLNFFPGDMEQTAVPTSEHGEFIFIIDCSGSMREPLSTTAPYDARWRTSKETLILLIKSLPMGCLFNIYRFGTRYISLFGESTPYNQQTIEAALAHVKRADADMGGTNILEPLADIYRQPCKPEHPRKLFLLTDEMVMNTEGVIQKVKNHSMDHRCFAFGIGQGVSTQLIKEVARVGNGLSEFVTSSDQLQAKVLRMLKCAMQPL-LGNPQLEWSLPPGVTVTVVPTLPRSIFMGQKMIVYAQFTG 495          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001499.1 (pep scaffold:Pmarinus_7.0:GL486103:7907:24271:-1 gene:ENSPMAG00000001355.1 transcript:ENSPMAT00000001499.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 3.795e-38
Identity = 103/325 (31.69%), Postives = 157/325 (48.31%), Query Frame = 2
Query:  554 YEYNFKAVINGTKVIENVSSVNHTLEIA-FNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLP-KFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAK--ECLLIFLKSLPVYCK-------FQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIF 1495
            Y  +F         I++VSS +  L  A F  +++ SA+V L+  +   +D+++ I Y    +P  + E G  +       A+ SF    VAM+ F P + +   +      E + ++D SGSM  + I  AK    LLI +++L +  K       F IY FGS+F  ++ +S  Y   ++  AL +  ++DAN GGT +M PL D+Y       + R  FLLTDG V N   V   V+ H+   R F  GIG GVS  L+ +VA  G G S FV ++  L   V+ +L  AM      + +LEW  P  +     P+    IF
Sbjct:    7 YTLSFTLTAENPGGIDDVSSPSGLLGPATFAESDRASAQVSLEGNFKFDQDIEVLIYYKQKHQPFALIEPGLPA------TAEVSFLADTVAMLNFFPGEMEEMEVPTAEHGEFIFIIDCSGSMNNNPIMSAKVPRTLLINMETLILLLKSLSLGCLFNIYSFGSRFKSLYTESMPYDQQTMDTALKHVCSMDANMGGTNIMGPLVDIYKQPCKPQHPRKLFLLTDGMVDNTQGVIHTVKHHSMDHRCFAFGIGQGVSTELIKEVAHVGKGLSEFVTSSDRLQGKVLRMLKCAMQPS-LNNPQLEWTLPPGIVATVVPRLPESIF 324          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009885.1 (pep scaffold:Pmarinus_7.0:GL476547:520883:546470:1 gene:ENSPMAG00000008938.1 transcript:ENSPMAT00000009885.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 3.913e-33
Identity = 148/605 (24.46%), Postives = 250/605 (41.32%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDR-----EVFQVTNH---YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGT-KDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLA-------FLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVF--VRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSI------VTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEET--------LKKDLIDLSLQVNIVTKYTTFVAIDQ 1795
            LK++ V  NI +  +       Y ND  E  E  ++FP++    V  FEA + GK I+G  KE E A   Y  A  +GH A ++++ +   DVF   +GN P      I + +  EL           RF L  P  L P +      GD      E   V  H      + +  +     I NV+S  H + +         A V L S  D    +  + +    + EP +  E             Q     S   ++ F P+F  S        +IV+ +D S SM    +  AK   L  L+ LP   +F +  FG+ + ++F   +  S  +I  A+++ K L A+ G TEL RPL  +         SR A        LLTDG   ++   T+  R++ +  R+   G+G+  +   ++ +A+   G   F   +N    +  ++ L++ A   V   D  +EW      ++      + AP+ I  +F    L  + ++         + TL    N +   F+T +  ++  +     +HRL A   I +  +     +ET        +K  +I+LS + +I+T YT+FVA+++
Sbjct:  357 LKAVHVRANILDFTAQVVVMQEYDNDSTEPIEAKYTFPLDEMAAVCSFEAFINGKHIVGQVKEKETAHQQYRNAVSQGHGAYLMDQESP--DVFVVSVGNLPPACRVLIKVTYVCEL----AAEGAAVRFRL--PGNLAP-WQQRLATGDVTQETVETLAVAKHSGRVRLSVQVSVEMPYEIINVTSPTHAIRV---KRTACKAVVELASSDDSLGSEFQLLVFPAQIHEPRMWVE-------------QNPETDSQACILTFYPEFAPSPSEG---VDIVLCLDCSASMTTQPLTDAKRLALFALRHLPPGSRFNVLKFGTHYKELFPVFRESSPSNIATAVSFIKRLHADAGNTELWRPLRSVALLAGGVGGSRDAAAPPVSVLLLTDGVAQSEARATREARENVRLLRVLACGVGETPNRYFLNALARNSGGACEFFTAKNRSTWTDKMLALMEKATQPV-CRDVTVEWQRFDRGALGGDRVEMQAPRMIRSVFCGTRLVVYGIVP-----HCTQATLHAIINNQ--EFSTMVSTSNLQITRGKMLHRLTAHAIIQDYEDGNLHPDETQHEVIIAEMKSRIIELSKEYSIITPYTSFVAVEE 925          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009886.1 (pep scaffold:Pmarinus_7.0:GL476547:520883:541043:1 gene:ENSPMAG00000008938.1 transcript:ENSPMAT00000009886.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 2.359e-25
Identity = 110/418 (26.32%), Postives = 170/418 (40.67%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDR-----EVFQVTNH---YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGT-KDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLA-------FLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIG 1282
            LK++ V  NI +  +       Y ND  E  E  ++FP++    V  FEA + GK I+G  KE E A   Y  A  +GH A ++++ +   DVF   +GN P      I + +  EL           RF L  P  L P +      GD      E   V  H      + +  +     I NV+S  H + +         A V L S  D    +  + +    + EP +  E             Q     S   ++ F P+F  S        +IV+ +D S SM    +  AK   L  L+ LP   +F +  FG+ + ++F   +  S  +I  A+++ K L A+ G TEL RPL  +         SR A        LLTDG   ++   T+  R++ +  R+   G+G
Sbjct:  373 LKAVHVRANILDFTAQVVVMQEYDNDSTEPIEAKYTFPLDEMAAVCSFEAFINGKHIVGQVKEKETAHQQYRNAVSQGHGAYLMDQESP--DVFVVSVGNLPPACRVLIKVTYVCEL----AAEGAAVRFRL--PGNLAP-WQQRLATGDVTQETVETLAVAKHSGRVRLSVQVSVEMPYEIINVTSPTHAIRV---KRTACKAVVELASSDDSLGSEFQLLVFPAQIHEPRMWVE-------------QNPETDSQACILTFYPEFAPSPSEG---VDIVLCLDCSASMTTQPLTDAKRLALFALRHLPPGSRFNVLKFGTHYKELFPVFRESSPSNIATAVSFIKRLHADAGNTELWRPLRSVALLAGGVGGSRDAAAPPVSVLLLTDGVAQSEARATREARENVRLLRVLACGVG 762          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Match: EDO46745 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW3])

HSP 1 Score: 292.738 bits (748), Expect = 7.634e-86
Identity = 190/607 (31.30%), Postives = 290/607 (47.78%), Query Frame = 2
Query:   41 GLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTP----PEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININ------YLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGD--------VIKCTLSGSANGEPVSFTTEIRNTDAFV-----DEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAID 1792
            GL   K  +K  L+S+ V+  I    +       YKN+G+   E ++ FP++    V  F+A + G+ I+   KE EEA+  Y+ A   GH A ++E++    D+F+  +GN P N  A + LKF  EL++      V      +LP +L PRYTP    P  + +     V   Y + F+  +     I  +SS +H L    + ++   A V L   +   +D++I I         A+ EP +     +      G      F    VAMV F+P F +  +   C  E + VVDRSGSM GS I  A   L +FLKSLP  C F I GFGS +  +F+ S+ Y+D ++  A N+  +L A+ GGTE++ PL  +Y+  L     R  FLLTDG V N  +V  LV ++  + R+F+ GIGDG S  L+  VA+AG G + FVR   +L   V++ L  A+     TD  L W  P    +      +PP+F    L A+ +   + +           +K TL      +       I NT  FV     +    +HRL AK  I+     +       K+D+I LS   ++ +K+T+F+A+D
Sbjct:    4 GLICKKTKEKIPLQSIKVNAEITGYTAQVAAVLGYKNEGSNPIEAVYIFPLDEQAAVCGFQATIDGRTIVAEIKEKEEARGDYDDAISSGHSAFLLEESDESSDIFQMNVGNLPPNESATLQLKFVTELEVDEENGTV----QFVLPTVLNPRYTPVDQQPSISTEIPASSVAKPYSFEFQMNVKSGSAITEISSTSHKLCFQPDPSDNCHASVTLAESHTFRRDVEIQIKSEDPFVAHALVEPGLPRPSDAPEDKTRGLAISTEFLQKPVAMVNFVPAFKADDLT--C-GEFIFVVDRSGSMSGSRIKDAARTLQLFLKSLPDGCYFNIVGFGSSYKTLFSKSKTYNDETLKTATNHAAHLAADLGGTEILEPLRWVYSQSLIEGAPRQLFLLTDGEVGNTAQVISLVAENASTARVFSFGIGDGASTELIKGVARAGHGSAEFVRGQDKLQVKVIKTLKRALQPA-LTDVALSWALPDGWKLQEVQSKLPPVFKGERLIAYGVFKNLNNDSNAKGIGHATVKATLHEGREAK------HIENTVKFVLLPSQENSLVLHRLAAKRFISSSQSALH------KQDIIQLSKTASVASKFTSFIAVD 590          

HSP 2 Score: 50.0618 bits (118), Expect = 4.425e-6
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 3
Query: 2100 DIIMFLVDLQNINGSWNYDEKIFAYIGID----VNRIKEIQPDKISDIIWSTAVIYQHLMIKEQAREKEWRLFARKAKEWIEQNLNDSAIFNDILNKSAELFH 2396
            D +M LVDLQ   GSW   + + A + +     VN   +  PD  SDI W+T ++   L  K   R+ EW + A K+K W++ +L     +  ++    + FH
Sbjct:  696 DKLMTLVDLQKACGSWELTDALAACLNVSKDVLVNAKPQSTPDLGSDI-WATVLVLVWLSGKFFNRKDEWEMIANKSKRWLKSSLPSGVDYGKLM---GDAFH 794          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Match: EDO45203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF3])

HSP 1 Score: 272.707 bits (696), Expect = 5.916e-79
Identity = 185/612 (30.23%), Postives = 305/612 (49.84%), Query Frame = 2
Query:   38 FGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDR---EVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKE--PSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIP-PIFSDYFLTAFCMINGMKSGD----VIKCTLSGSANG---------EPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINE----MAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDA 1801
            FGL     +Q   L+ + +   +    +       Y N      E ++  P++    V  F+A + G+ I+   +E +EA++ Y+ A   GH A ++E++    D+F+  +GN P  S AK+ L F  EL +     E   R   LLP +L PRYTP    G+     + +V + YE++F+ ++     I+ ++S +  L +  ++ +K  A V L   +    D+D+ +  L      P   +E G      +G +    F    +  + F+P F         +T E + V+DRSGSM G  I  A+E L +FLKSLP +C F + GFGS ++K+F+ S  YSD S+  A N+ KNL+AN GGTE++ PL+ +++  +     R  FL+TDG V N  +V  LV+K++   R FT GIG G S +L+  VA+AG G + F+ ++ ++ A V++ L  A+      D K+ W  P      T PK++P  +FS   +  + +++    G       K TL  +              V+F  E++ +D        +HR+ AK  I E    M E   S  + LK  +I++S   N+V+K T+FVA+D ++
Sbjct:    4 FGLIDSSRNQ-VPLQRIEIRAKVHGYTAEVIATMTYNNKMKNPIEAVYILPLDEEAAVCGFKATIDGRTIVAEVQEKQEARDTYDDAISSGHSAFLLEESDESSDIFQINVGNLPAESTAKVELTFVCELTV-----EKEGRVCFLLPTVLNPRYTP--QGGNSITASLPRVDSAYEFDFELLVQSASEIQEITSPHSKLNVVISSEDKCQATVRLAEPFKF--DVDVKVMILNRDPFLPQATFENG-----VTGSNITQDFLEKPLVTLNFMPDFGK---QEALETGEFIFVIDRSGSMSGDRIKNARETLFLFLKSLPEHCHFNVVGFGSSYEKLFSSSTKYSDSSVNKACNHAKNLEANLGGTEILEPLKYVFSQPVIKGSPRQVFLMTDGEVGNTQQVITLVKKNSTHARCFTFGIGQGASTALIKGVARAGQGTAEFITSSHQMQAKVVKTLRNALQP-SMEDIKVTWDLPHGWDSQTIPKNLPQALFSGNRIIVYGLLSKQGGGRDEELQGKATLQATTRDNTSNMRTITHEVAFKLELKESDGCS----MMHRVAAKRFIQEQQDAMGEDASSWSDDLKAKVINISKAANVVSKVTSFVAVDSES 592          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Match: EDO32379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV91])

HSP 1 Score: 192.971 bits (489), Expect = 4.834e-52
Identity = 157/613 (25.61%), Postives = 276/613 (45.02%), Query Frame = 2
Query:   38 FGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEA--KNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD----REVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSK-YDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMY-NSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMI----NGMKSGDVI---KCTLSGSAN--------GEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQ----IESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQ 1795
            +GL          L+S+ +   IR   +       YKN+ +   + ++ FP++ +  +  F+A + G+ ++   ++  E   +N+      +  +A  I+ N    D F+  +G  P    A + + +  EL +     +VV     +LP ++ PR      A      R    V + Y +     +     I+ ++S    LE   N ++K  A V L  + Y    D+ +N+      EP  ++ +  +       D    F  + + M+ + P+F       + + E + +VDRS +M+G NIDRA+E +L+FLKSLP  C F +  +G+ + K+F  S++    S   A ++  +L A       + PL ++Y ++ + + Y R  FL+T G V N ++VT  VRK+  + R FT+GI  G     V ++A+AG G    V     ++  V  + D A   V  T+  + W  P        P ++PPI+  + L  + ++    N   S  V    K T+S S           + V F+    N    VD +  +HRL AK  I E  ++    + SG    +  ++ LS   NI++K TTFVA+D+
Sbjct:    4 YGLLDKAVGSSVPLESVWIRAVIRGFTAHVLATLEYKNNSSNPLDAIYVFPVDDHAAICGFQATIDGRSVVAAVQDRGEVLKQNIDSARSTQNGLAVNIDDNA---DNFQIGVGILPSYKTAVLQVTYVAELPVGK-DGQVV----FILPSVINPRVFQEHDARKKNLGRRTASVNSKYSFELDLKVQSATSIQEITSPCGGLEYEINASDKRQASVRLTGESYHFNDDVQVNV---IRSEPFQLHALTENGVTTKSSD---KFLATPIVMLNYFPEFTDC--KERTRGEFIFLVDRSKNMKGENIDRAREVVLLFLKSLPDGCHFNVISYGASYIKLFTQSEVCDHSSRERASDFVWDLKAGIDNARPIDPLREVYSHNLIDTGYPRQVFLVTGGEVGNAEQVTDEVRKNAHTARCFTLGINVGKHSDHVRRIARAGRGTCELVSQLDRVAPKVQSMWDEATQPV-VTNFHVSWTLPDGWVARCIPYNLPPIYRGHTLILYGLLMREDNKQPSYIVAVEGKATISASIQHGDTTKDVHQEVRFSALSGNP---VDRDIFLHRLTAKALIEEEEDKRVWNLTSGGLATRAPIVSLSKSTNIISKATTFVAVDK 596          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Match: EDO37524 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFM5])

HSP 1 Score: 135.191 bits (339), Expect = 4.931e-34
Identity = 116/439 (26.42%), Postives = 186/439 (42.37%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKK----IIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDL-LLPLILRPRYTPPE---------YAGDREVFQVTNH----YEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKD--LDININYLAMKEPSVVYEVGSSSPLYS-GKDAQGS---------FYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTR 1261
            M GL          LK+ S+   +    +       Y N    D EGLF FP +    V   EA V  +     I     +    K++Y V + +              D+F   IG  P +        FA    L+ + S+   R  L +LP +  PR +  E         Y     +  +       Y +  +  +    ++   SS  H +++  ++    ++ +H+      T D  L + ++     +P V+ E G    + S  +D + S         F      M+ + P    SL ++    E + +VDRSGSM G +I + KE L++FLKSLP  C F + GFGS +  V+ ++Q+Y + +   A NY + + A+ GGT L+ PLE ++N        R  F+LTDG VSN  EV   VR++  STR
Sbjct:    1 MTGLVNRHTSYPLQLKASSIFAEVNGFAARVLATLTYYNQCEYDVEGLFVFPQDERTTVVELEATVEERHVYTDIRAQTGQKSTEKSVYSVEERED-------------DLFSLSIGRIPAHCSV-----FAQVTLLTELISDRKTRGSLFILPSVFTPRLSTDEDEQLDSHDLYGSQMLISDIPRKTLEPYSFELQLEVAAPCLLAGCSSPTHAIQVDADSKATNASSIHITIAEPHTYDCELVVLLHLSHPNDPYVLIEEGKKERVDSVEQDVEKSPVPTNLVEEFTKKPSIMINYTP----SLTSSSQIAEFIFLVDRSGSMSGKHIFQVKEMLILFLKSLPANCYFNLIGFGSYYRSVYQETQIYDEETAEHACNYVQKMRADLGGTNLILPLEFIFNQPPKKGIPRFVFMLTDGGVSNTTEVIDFVRRNAYSTR 417          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Match: EDO46659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPC2])

HSP 1 Score: 109.768 bits (273), Expect = 2.021e-24
Identity = 144/610 (23.61%), Postives = 241/610 (39.51%), Query Frame = 2
Query:   62 DQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYH----------------SDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMY----NSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKS-TRLF---TVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAE--------QIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQ 1795
            D+   LK++ +   + +L +       Y N+ +   E  + FP++    V  FEA + GK IIG  KE E+A+  Y  A   GH A ++++ T   DVF   +GN P  +   I + +  EL    V  E++      LP  + P             +Q T  ++   +  ++   V E   S         N + + S E+  + +       D+ +   + K    V E+     L SG   Q                     S   M+ F P+F+S   ++    E++ V+D S SM+G  +  AK+  L+ L  +     F I  FGS + ++F  SQ     ++  A  + K++ A  G T+L R L  +Y    NS   +DY    FL TDG+V+ +      +R    +  R F      +G G +  L D   K+   + V      +LS +   +L         T  K+ W   QH S    P   P      F  +  ++ G+    V  CT                            +H+L A+  I +  E        + E  +  +K  +I LS + +IV+++T+FVAI+ 
Sbjct:  401 DKPVPLKAVHIRAKLLDLAAQVVVMQAYCNNSDVPIEAKYVFPLDDMAAVCGFEAFINGKHIIGEVKEKEQARKEYREAISAGHGAYLMDEETP--DVFTVNVGNLPPAASVLIKITYVAELT---VEGELIC---FRLPGSVAP-------------WQRTQAHDDVTQTDVDTICVDEENQS---------NTSVQVSVEMPFEIRAILCPGHDVKVKRTSTK---AVVEMAPGGTLGSGFQLQIQLAEIHVPRMWVERHDTEADSQACMLAFYPEFESGPPHH---VEVIFVLDASCSMKGKALQEAKKLTLMCLSLMEEEWAFNIVVFGSNYSELFTQSQKKDKETVARAAKFVKSVKAVKGSTDLWRVLRSLYLLRCNS--TADYPSNVFLFTDGHVTEESTTLAYIRDIRPTCNRHFLRSMARVGAG-AYELFDSKVKSKWERKV----ESQLSKARQPVL---------TSVKVAWQ--QHDSYAKPPVQAPHDIVSLFNGSRQVVYGL----VDNCTQV--------------------------LHQLTARAIIRDWEEGSLDPNHTKHEMAKRDMKDFIISLSKRFSIVSQFTSFVAIEH 926          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Match: ENSORLT00000017719.2 (von Willebrand factor A domain-containing protein 5A [Source:NCBI gene;Acc:101161821])

HSP 1 Score: 263.077 bits (671), Expect = 3.520e-75
Identity = 175/587 (29.81%), Postives = 292/587 (49.74%), Query Frame = 2
Query:   83 SLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMR---------GSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKI----NEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            S+ V+  +++ +++      Y+N  ++  E LF FP+  +  V +F A +G   I+   KE ++A+  Y+ A   G  A ++E++    D+F   +G+ P    A I+L++ +EL    V ++   RF   LP +L PRY P            +   Y  +F A ++  + +  V S      + + NT+ T A V L + +   +D+++ I Y    +PS V E G  S         G+     V MV   P+F  S+M+ +    E V +VDRSGSM+          + I  A++ LL+ LKSLP+ C F IYGFGS++D +F  S  YS+ S+  AL   + + A+ GGTE+++PL+ +Y+    S+  R  F+ TDG V N  EV  LVRK+  S R F+ GIG+G S +L++ +A+ G G + F+  +  + A VM+ L  A+  V   D  + W  P+ VS       I  IF       +  ++G  S      T++ +    P     +  N +   D    VHRL A+  I    +E  E      E +K+ +++LS+Q  + + +T F+A+++D
Sbjct:   23 SVEVELQVKDHVATVISTLNYQNKEDKPIEALFVFPLPGDAAVCHFSADIGQTHIVAELKEKQQAREEYDDALSSGQQAFLLEESEQSPDIFSLSVGSLPPGESASIMLQYVIELA---VEADGALRF--CLPAVLNPRYQPQGPGVPVSSVPASEIPYSLSFSARVSSPRPVSKVESSCSLEPLQYLNTDHTEAAVKLAAGHKFDRDVELLIYYKDAHQPSAVVEAGQDS------AKPGTLMGDPVVMVSLYPEFPESVMSKRASCGEFVFLVDRSGSMQCPTNNWNQQETRISSARDTLLLLLKSLPMGCYFNIYGFGSRYDHIFPKSVEYSEKSMEEALKKVEVMQADLGGTEILQPLQHIYSQPCISNQPRQLFVFTDGEVGNTKEVLDLVRKNAGSHRCFSFGIGEGASSALINGLAQEGRGHAQFITGSDRMQAKVMQSLKFALQPV-VKDISVTWDLPKGVSATVLSPPITTIFQGQRSLVYAQLSGKSSQTDCSVTVNYTLGDHPYESKQQF-NLNPAKDTGLTVHRLAARILIRSLESEERENRGKSNEDMKRKVVELSVQSGVSSHHTAFIAVNKD 596          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Match: ENSORLT00000029480.1 (pep primary_assembly:ASM223467v1:13:27928104:27975128:-1 gene:ENSORLG00000022184.1 transcript:ENSORLT00000029480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.899 bits (629), Expect = 1.511e-69
Identity = 172/586 (29.35%), Postives = 286/586 (48.81%), Query Frame = 2
Query:   86 LSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD----REVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMRGSN---------IDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEET-LKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            + V+  +++ +++      Y+N  ++  E LF FP+  +  V +F A +G   I+   KE ++A+  Y+ A   G  A ++E++    D+F   +G+ P    A I L++ +EL    V ++   RF   LP +L PRY P    G       V      Y  +F A ++  + +  V S      + + NT+ T A V L + +   +D+++ I Y    +PS V E G  S         G+     V MV   P+F  S+M+ +    E V ++DRSGSMR S          I  A++ LL+ LKSLP+ C F IYGFGS++D++F  S  Y++ S+  AL   K + A+ GGTE+++PL+ +Y+    S+  R  F+ TDG V N  EV  LVRK+  S R F+ GIG+G S +L++ +A+ G G + F+  +  + A VM+ L  A+  V   D  + W  P+ VS       I  IF            G +S  +I   L G            +   D       +V +L  + +  E  ++ E  +   +K+ ++ LS+Q  + + +T F+A+++D
Sbjct:   13 VEVELQVKDHVATVISTLNYQNKEDKPIEALFVFPLPGDAAVCHFSADIGQTHIVAELKEKQQAREEYDDALSSGQQAFLLEESEQSPDIFSLSVGSLPPGESASIRLQYVIELA---VEADGALRF--CLPAVLNPRYQPQGSEGPGVPVSSVPASEIPYSLSFSARVSSPRPVSKVESSCSLEPLQYLNTDHTEAAVKLAAGHKFDRDVELLIYYKDAHQPSAVVEAGQDS------AKPGTLMGDPVVMVSLYPEFPESVMSKRTSCGEFVFLLDRSGSMRCSTSNWNQQETCISSARDTLLLLLKSLPMGCYFNIYGFGSRYDQIFPKSVEYNEKSMEEALKKVKVMQADLGGTEILQPLQHIYSQPCISNQPRQLFVFTDGEVGNTKEVLDLVRKNAGSHRCFSFGIGEGASSALINGLAQEGRGHAQFITGSDRMQAKVMQSLKFALQPV-VKDISVTWDLPKRVSATVLSPPITTIF-----------QGQRS--LIYAQLCGKV----------LDKKDRQTRNHLKVCQLETQSRFIEARKKSEGNQHKDMKRKVVKLSVQSGVSSHHTAFIAVNKD 563          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Match: ENSORLT00000017722.2 (von Willebrand factor A domain-containing protein 5A-like [Source:NCBI gene;Acc:105355516])

HSP 1 Score: 240.35 bits (612), Expect = 1.175e-67
Identity = 174/583 (29.85%), Postives = 283/583 (48.54%), Query Frame = 2
Query:   77 LKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD----REVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQ-GSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGE--ETLKKDLIDLSLQVNIVTKYTTFVAIDQD 1798
            LKS+ V+  +++ +++      Y+N  ++  E LF FP+  +  V +F A +G   I+   KE ++A+  Y+ A   G  A ++E++    D+F   +G+ P    A I+L++ +EL    V ++   RF   LP +L PRY P    G       V      Y  +F A ++  + +  V S      + + NT+ T A V L + +   +D+++ I Y    +PS V E G  S       AQ G+     V MV   P+F  S+M                S R S  +   + LL+ LKSLP+ C F IYGFGS +D +F  S  YS+ S+  AL   + + A+ GGTE+++PL+ +Y+    S+  R  F+ TDG V N  EV  LVRK+  S R F+ GIG+G S +L++ +A+ G G + F+  +  + A VM+ L  A+  V   D  + W  P+ VS       I  IF       +  + G     +++  L  S      S T            +F VHRL A+  I   E  E+   G+  E +K+ +++LS+Q  + + +T F+A+++D
Sbjct:   16 LKSVEVELQVKDHVATVISTLNYQNKEDKPIEALFVFPLPGDAAVCHFSADIGQTHIVAELKEKQQAREEYDDALSSGQQAFLLEESEQSPDIFSLSVGSLPPGESASIMLQYVIELA---VEADGALRF--CLPAVLNPRYHPQGSEGPGVPVSSVPASEIPYSLSFSARVSSPRPVSKVESSCSLEPLHYLNTDHTEAAVKLAAGHKFDRDVELLIYYKDAHQPSAVVEAGQDS-------AQPGTLMGDPVVMVSLYPEFPESVM----------------SKRASCGEFCSDTLLLLLKSLPMGCYFNIYGFGSSYDHIFPQSVEYSEKSMEEALKKVEVMQADLGGTEILQPLQHIYSQPCISNQPRQLFVFTDGEVGNTKEVLDLVRKNAGSHRCFSFGIGEGASSALINGLAQEGRGHAQFITGSDRMQAKVMQSLKFALQLV-VKDISVTWDLPKGVSATVLSPPITTIFQGQRSLVYAQLCGKV---LVRSPLEKS------SLTI-----------QFTVHRLAARILIRSLESEERKNRGKSNEDMKRKVVELSVQSGVSSHHTAFIAVNKD 549          

HSP 2 Score: 53.5286 bits (127), Expect = 1.126e-6
Identity = 30/104 (28.85%), Postives = 58/104 (55.77%), Query Frame = 3
Query: 2034 DSVDGYMETKSMPKIET--KEKRKDIIMFLVDLQNINGSWNYDEKIFAYIGIDVNRIKEIQPDKISDIIWST--AVIYQHLMIKEQAREKEWRLFARKAKEWIE 2333
            D+V G +  +++P      ++ R+D ++ LV LQ  +G W  D  + + +G     +++ +P ++S  +W+T  A+I+ H   K  A++ EW L A KA  W++
Sbjct:  552 DAVQGPLVCRNVPTPAAVPEQPRRDPLLQLVSLQKASGCWLLDTALASVLGKTSEEVEKSKPAEVSSEVWATILALIWLH-GFKMDAKD-EWELLAVKAASWVQ 653          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Match: ENSORLT00000017644.2 (von Willebrand factor A domain-containing protein 5A [Source:NCBI gene;Acc:101161821])

HSP 1 Score: 237.654 bits (605), Expect = 1.391e-66
Identity = 153/495 (30.91%), Postives = 250/495 (50.51%), Query Frame = 2
Query:   83 SLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTN-HYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSMR---------GSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMING 1534
            S+ V+  +++ +++      Y+N  ++  E LF FP+  +  V +F A +G   I+   KE ++A+  Y+ A   G  A ++E++    D+F   +G+ P    A I+L++ +EL    V ++   RF   LP +L PRY P            +   Y  +F A ++  + +  V S      + + NT+ T A V L + +   +D+++ I Y    +PS V E G  S         G+     V MV   P+F  S+M+ +    E V +VDRSGSM+          + I  A++ LL+ LKSLP+ C F IYGFGS++D +F  S  YS+ S+  AL   + + A+ GGTE+++PL+ +Y+    S+  R  F+ TDG V N  EV  LVRK+  S R F+ GIG+G S +L++ +A+ G G + F+  +  + A VM+ L  A+  V   D  + W  P+ VS       I  IF       +  ++G
Sbjct:   23 SVEVELQVKDHVATVISTLNYQNKEDKPIEALFVFPLPGDAAVCHFSADIGQTHIVAELKEKQQAREEYDDALSSGQQAFLLEESEQSPDIFSLSVGSLPPGESASIMLQYVIELA---VEADGALRF--CLPAVLNPRYQPQGPGVPVSSVPASEIPYSLSFSARVSSPRPVSKVESSCSLEPLQYLNTDHTEAAVKLAAGHKFDRDVELLIYYKDAHQPSAVVEAGQDS------AKPGTLMGDPVVMVSLYPEFPESVMSKRASCGEFVFLVDRSGSMQCPTNNWNQQETRISSARDTLLLLLKSLPMGCYFNIYGFGSRYDHIFPKSVEYSEKSMEEALKKVEVMQADLGGTEILQPLQHIYSQPCISNQPRQLFVFTDGEVGNTKEVLDLVRKNAGSHRCFSFGIGEGASSALINGLAQEGRGHAQFITGSDRMQAKVMQSLKFALQPV-VKDISVTWDLPKGVSATVLSPPITTIFQGQRSLVYAQLSG 505          
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Match: ENSORLT00000042884.1 (von Willebrand factor A domain-containing protein 5A [Source:NCBI gene;Acc:101174937])

HSP 1 Score: 237.269 bits (604), Expect = 9.196e-66
Identity = 181/610 (29.67%), Postives = 297/610 (48.69%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGD----REVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQ-GSFYHSDVAMVKFLPKFDSSLMNNQCKT-EIVIVVDRSGSM--------RGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGM--KSGD---VIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKIN--EMAEQIESGE--ETLKKDLIDLSLQVNIVTKYTTFVAIDQ 1795
            +FGL   +  QK  LKS+ V+  +++ +++      Y+N  ++  E LF FP+  +  V +F A +G   I+   KE ++A+  Y+ A   G  A ++E++    D+F   +G+ P    A I L++ +EL    V ++   RF   LP +L PRY P    G       V      Y  +F + ++  + +  V S      + + NT+ T A V L + +   +D+++ I Y    +PS V E G  S       AQ G+     V M  F P F  S+ ++     E V ++DRSGSM          + ID AKE LL+ LKSLP+ C F IY FG +F+ +F  S  YS  ++  AL   + + A+ GGT+++ PL+ +Y         R  F+ TDG VSN  E+  LV+++  S R F+ GIG G S +LV+ +AK G G + F+ +   +    M+ L +A+      D  L W  P  V+      +I  IF       F  + G   K+G+    +K +++G +    +  + +     +  D    VH L A   I   EM E+   GE  E +KK L+++S++  + + +T F+A+D+
Sbjct:    4 LFGLVSCER-QKVPLKSVEVELQVKDHVATVISTLNYQNKEDKPIEALFVFPLPGDAAVCHFSADIGQTHIVAELKEKQQAREEYDDALSSGQQAFLLEESEQNPDIFSLSVGSLPPGESASIRLQYVIELA---VEADGALRF--CLPAVLNPRYQPQGSEGPGVPVSSVPASEIPYSLSFSSRVSSPRPVSKVESSCSLEPLHYLNTDHTEAAVKLAAGHKFDRDVELLIYYKDAHQPSAVVEAGQDS-------AQPGTLMGDPVVMASFYPNFPESVQSSSSSCGEFVFLLDRSGSMDFPMADIHHRTRIDSAKETLLLLLKSLPMGCYFNIYSFGDRFEHLFQKSLRYSQKTMKQALKKVEEMSADLGGTDILEPLQHIYRQSCIRGQPRQLFVFTDGEVSNTKEILDLVKENCASYRCFSFGIGPGASSALVNGMAKEGGGHAQFITDNDRMQLKAMQSLRLALQPS-VEDISLTWDLPAGVTAKVLSPTIQNIFQGQRSVVFAQLTGQSSKTGEGSLTVKYSIAGHSCQNQLFLSLKPAPMGSCTD-SLTVHHLAALTLIRRLEMEERGCEGEQSEGVKKKLVEVSVESGVSSAFTAFIAVDK 598          
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Match: SMESG000053657.1 (SMESG000053657.1)

HSP 1 Score: 1202.19 bits (3109), Expect = 0.000e+0
Identity = 587/601 (97.67%), Postives = 592/601 (98.50%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRP-RYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITD 1834
            MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVF+CRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRP      EYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSS LYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNS+LPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGD+IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVT I +
Sbjct:    1 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFRCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPDTLHQVEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSSLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSHLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDLIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTNIEE 601          
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Match: SMESG000053671.1 (SMESG000053671.1)

HSP 1 Score: 1201.81 bits (3108), Expect = 0.000e+0
Identity = 582/603 (96.52%), Postives = 591/603 (98.01%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV--VDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITDD 1837
            MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFP+EYNCIVYYFEALVGGKKIIG+CKEIEEAKNLYEVAKEKGHMAAIIE+NTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV  VDRFDL LPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEI FNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMV FLPKFDSSLMNNQCKTEIVIVVDRSGSM GSNIDRAKECLLIFLKSLPVYCKFQIYGFGS+FDK FNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDG+V NQDEVTKLVRKHNKSTRLFTVGIGDGVS SLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEP+SFT EIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVT I ++
Sbjct:    1 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPLEYNCIVYYFEALVGGKKIIGVCKEIEEAKNLYEVAKEKGHMAAIIEQNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVEGVDRFDLSLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIVFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVNFLPKFDSSLMNNQCKTEIVIVVDRSGSMHGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSEFDKAFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGDVGNQDEVTKLVRKHNKSTRLFTVGIGDGVSTSLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPISFTIEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTNIEEE 603          

HSP 2 Score: 103.605 bits (257), Expect = 2.915e-22
Identity = 65/184 (35.33%), Postives = 98/184 (53.26%), Query Frame = 3
Query: 1803 QVNLWSHALLMMGAPQMMCDMYVXXXXXXAMRCSAFGLMSSXXXXXXQYSAMKEQVAIEDFYDDMDCSDNLEAYGCFDSVDGYMETKSMPKIETKEKRK-DIIMFLVDLQNINGSWNYDEKIFAYIGIDVNRIKEIQPDKISDIIWSTAVIYQHLMIKEQAREKEWRLFARKAKEWIEQNLNDS 2351
            ++N     L+  GAPQ++ D Y   P PP M+C       S      + S  KE +        +D   N+  +G   S        S  +    E    D+I++LVD QNINGSWN++E I   IG+++   +   P +IS+ +W T  IYQ+ ++KE +REKEWRL A+KAK WIE+++ +S
Sbjct:  612 RMNFQCVPLMKAGAPQIVYDRY--EPNPPPMKCPEAKFKKSK-----RTSLKKEDIGY------LDKIKNMFYFGKKASKQNRKSKDSSSEEAVSEPEPVDVIIYLVDKQNINGSWNFNESILLKIGVNITEFRNKMPGRISEEVWITVAIYQYFVLKESSREKEWRLVAKKAKNWIEKSIAES 782          
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Match: SMESG000053671.1 (SMESG000053671.1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 582/603 (96.52%), Postives = 591/603 (98.01%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV--VDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITDD 1837
            MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFP+EYNCIVYYFEALVGGKKIIG+CKEIEEAKNLYEVAKEKGHMAAIIE+NTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV  VDRFDL LPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEI FNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMV FLPKFDSSLMNNQCKTEIVIVVDRSGSM GSNIDRAKECLLIFLKSLPVYCKFQIYGFGS+FDK FNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDG+V NQDEVTKLVRKHNKSTRLFTVGIGDGVS SLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEP+SFT EIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVT I ++
Sbjct:    1 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPLEYNCIVYYFEALVGGKKIIGVCKEIEEAKNLYEVAKEKGHMAAIIEQNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVEGVDRFDLSLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIVFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVNFLPKFDSSLMNNQCKTEIVIVVDRSGSMHGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSEFDKAFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGDVGNQDEVTKLVRKHNKSTRLFTVGIGDGVSTSLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPISFTIEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTNIEEE 603          

HSP 2 Score: 102.064 bits (253), Expect = 7.232e-22
Identity = 42/84 (50.00%), Postives = 63/84 (75.00%), Query Frame = 3
Query: 2100 DIIMFLVDLQNINGSWNYDEKIFAYIGIDVNRIKEIQPDKISDIIWSTAVIYQHLMIKEQAREKEWRLFARKAKEWIEQNLNDS 2351
            D+I++LVD QNINGSWN++E I   IG+++   +   P +IS+ +W T  IYQ+ ++KE +REKEWRL A+KAK WIE+++ +S
Sbjct:  685 DVIIYLVDKQNINGSWNFNESILLKIGVNITEFRNKMPGRISEEVWITVAIYQYFVLKESSREKEWRLVAKKAKNWIEKSIAES 768          
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Match: SMESG000053669.1 (SMESG000053669.1)

HSP 1 Score: 1199.88 bits (3103), Expect = 0.000e+0
Identity = 582/602 (96.68%), Postives = 590/602 (98.01%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV--VDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITD 1834
            MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFP+EYNCIVYYFEALVGGKKIIG+CKEIEEAKNLYEVAKEKGHMAAIIE+NTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEV  VDRFDL LPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEI FNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMV FLPKFDSSLMNNQCKTEIVIVVDRSGSM GSNIDRAKECLLIFLKSLPVYCKFQIYGFGS+FDK FNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDG+V NQDEVTKLVRKHNKSTRLFTVGIGDGVS SLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAF MINGMKSGDVIKCTLSGSANGEP+SFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVT I +
Sbjct:    1 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPLEYNCIVYYFEALVGGKKIIGVCKEIEEAKNLYEVAKEKGHMAAIIEQNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVEGVDRFDLSLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIVFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVNFLPKFDSSLMNNQCKTEIVIVVDRSGSMHGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSEFDKAFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGDVGNQDEVTKLVRKHNKSTRLFTVGIGDGVSTSLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFSMINGMKSGDVIKCTLSGSANGEPISFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTNIEE 602          
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Match: SMESG000053657.1 (SMESG000053657.1)

HSP 1 Score: 1162.13 bits (3005), Expect = 0.000e+0
Identity = 569/600 (94.83%), Postives = 575/600 (95.83%), Query Frame = 2
Query:   35 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSEVVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTCITD 1834
            MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVF+CRIGNFPKNSEAKIILKFAMELKLSPVR                      +YAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSS LYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNS+LPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGD+IKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEE+LKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVT I +
Sbjct:    1 MFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKNDGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAKEKGHMAAIIEKNTSMLDVFRCRIGNFPKNSEAKIILKFAMELKLSPVR----------------------KYAGDREVFQVTNHYEYNFKAVINGTKVIENVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVVYEVGSSSSLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVVDRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLYSDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSHLPSDYSRLAFLLTDGNVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVRNAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSDYFLTAFCMINGMKSGDLIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRVHRLLAKYKINEMAEQIESGEESLKKDLIDLSLQVNIVTKYTTFVAIDQDAPGEPLVTNIEE 578          
The following BLAST results are available for this feature:
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VWA5A2.536e-7730.41von Willebrand factor A domain containing 5A [Sour... [more]
VWA5A2.536e-7730.41von Willebrand factor A domain containing 5A [Sour... [more]
VWA5A1.681e-5632.25von Willebrand factor A domain containing 5A [Sour... [more]
VWA5A2.381e-5632.14von Willebrand factor A domain containing 5A [Sour... [more]
VWA5A2.381e-5632.14von Willebrand factor A domain containing 5A [Sour... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-265h17.11.195e-6929.24si:ch73-265h17.1 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
si:ch73-265h17.24.796e-6929.35si:ch73-265h17.2 [Source:ZFIN;Acc:ZDB-GENE-131120-... [more]
vwa5a2.513e-6030.67von Willebrand factor A domain containing 5A [Sour... [more]
vwa5a2.616e-5829.45von Willebrand factor A domain containing 5A [Sour... [more]
vwa5b21.275e-2724.66von Willebrand factor A domain containing 5B2 [Sou... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gzma1.076e-7128.29granzyme A [Source:Xenbase;Acc:XB-GENE-482759][more]
gzma1.226e-6928.73granzyme A [Source:Xenbase;Acc:XB-GENE-482759][more]
gzma2.117e-6927.64granzyme A [Source:Xenbase;Acc:XB-GENE-482759][more]
gzma4.485e-6928.89granzyme A [Source:Xenbase;Acc:XB-GENE-482759][more]
gzma5.083e-6928.28granzyme A [Source:Xenbase;Acc:XB-GENE-482759][more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vwa5a1.041e-6831.05von Willebrand factor A domain containing 5A [Sour... [more]
Vwa5a1.041e-6831.05von Willebrand factor A domain containing 5A [Sour... [more]
AW5519841.776e-6729.31expressed sequence AW551984 [Source:MGI Symbol;Acc... [more]
AW5519841.776e-6729.31expressed sequence AW551984 [Source:MGI Symbol;Acc... [more]
Vwa5b14.890e-3433.75von Willebrand factor A domain containing 5B1 [Sou... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00534|VMA5A_HUMAN1.218e-7630.41von Willebrand factor A domain-containing protein ... [more]
sp|Q75WE7|VWA5A_RAT9.818e-7430.73von Willebrand factor A domain-containing protein ... [more]
sp|Q99KC8|VMA5A_MOUSE7.282e-6831.05von Willebrand factor A domain-containing protein ... [more]
sp|Q54CQ8|Y2740_DICDI1.715e-5226.74von Willebrand factor A domain-containing protein ... [more]
sp|Q54DV3|Y2016_DICDI5.622e-5026.92von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID16.082e-17196.06Vault protein inter alpha trypsin-1 (Fragment) OS=... [more]
K1Q7V62.305e-9634.80von Willebrand factor A domain-containing protein ... [more]
A0A0R3TAC86.730e-9133.22Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A068WQX34.832e-9032.72von Willebrand factor A domain containing protein ... [more]
W6ULK41.313e-8932.56von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016124.24.306e-6827.60pep primary_assembly:Astyanax_mexicanus-2.0:8:2492... [more]
ENSAMXT00000043227.17.197e-6827.11pep primary_assembly:Astyanax_mexicanus-2.0:8:2492... [more]
si:ch73-265h17.11.139e-6629.36von Willebrand factor A domain-containing protein ... [more]
si:ch73-265h17.12.369e-6629.36von Willebrand factor A domain-containing protein ... [more]
ENSAMXT00000052541.16.163e-6626.72pep primary_assembly:Astyanax_mexicanus-2.0:8:2492... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000973.15.553e-6330.65pep scaffold:Pmarinus_7.0:GL479898:11183:30237:-1 ... [more]
ENSPMAT00000001499.13.795e-3831.69pep scaffold:Pmarinus_7.0:GL486103:7907:24271:-1 g... [more]
ENSPMAT00000009885.13.913e-3324.46pep scaffold:Pmarinus_7.0:GL476547:520883:546470:1... [more]
ENSPMAT00000009886.12.359e-2526.32pep scaffold:Pmarinus_7.0:GL476547:520883:541043:1... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO467457.634e-8631.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452035.916e-7930.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323794.834e-5225.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375244.931e-3426.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466592.021e-2423.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017719.23.520e-7529.81von Willebrand factor A domain-containing protein ... [more]
ENSORLT00000029480.11.511e-6929.35pep primary_assembly:ASM223467v1:13:27928104:27975... [more]
ENSORLT00000017722.21.175e-6729.85von Willebrand factor A domain-containing protein ... [more]
ENSORLT00000017644.21.391e-6630.91von Willebrand factor A domain-containing protein ... [more]
ENSORLT00000042884.19.196e-6629.67von Willebrand factor A domain-containing protein ... [more]
back to top
BLAST of vault protein inter alpha trypsin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053657.10.000e+097.67SMESG000053657.1[more]
SMESG000053671.12.915e-2296.52SMESG000053671.1[more]
SMESG000053671.17.232e-2296.52SMESG000053671.1[more]
SMESG000053669.10.000e+096.68SMESG000053669.1[more]
SMESG000053657.10.000e+094.83SMESG000053657.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005772
GenBankAFJ24785.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005772 ID=SMED30005772|Name=vault protein inter alpha trypsin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2882bp
AGTTTCACAATTTGAAATTCTGAATATCACGACAATGTTCGGCTTATGTC
CTTTAAAATATGATCAAAAATTCTCATTGAAGTCATTATCAGTTGACTGT
AATATCCGCAATTTATTAAGTTCATGTACTTGTGAATTCGTTTACAAAAA
CGATGGAAATGAAGATGGAGAGGGATTGTTTTCATTTCCAATCGAATATA
ATTGCATTGTGTATTACTTTGAAGCTTTGGTTGGCGGTAAAAAGATAATA
GGCTTATGCAAAGAAATTGAAGAAGCAAAGAATTTGTATGAAGTTGCGAA
AGAAAAAGGCCACATGGCAGCAATCATTGAAAAAAACACAAGCATGTTGG
ATGTATTTAAATGTCGTATTGGTAATTTCCCAAAGAATTCTGAGGCGAAG
ATCATTTTGAAATTTGCAATGGAATTGAAATTGAGTCCGGTTCGAAGTGA
AGTTGTTGATAGATTCGATTTGTTATTGCCATTGATTCTGAGACCCCGAT
ACACTCCACCAGAATACGCGGGTGACAGAGAAGTTTTTCAAGTCACCAAC
CATTATGAATACAATTTTAAAGCTGTTATAAATGGCACCAAAGTTATTGA
AAATGTTTCATCGGTTAATCACACATTGGAAATTGCGTTTAACAATACCA
ATAAAACAAGTGCTGAGGTTCATCTGAAATCAAAGTACGACGGCACCAAG
GACCTTGATATAAATATTAATTATCTAGCAATGAAGGAACCATCAGTTGT
TTATGAAGTTGGATCCAGTTCACCTCTTTATTCTGGAAAAGATGCACAAG
GATCGTTCTATCATTCTGATGTTGCCATGGTTAAATTTTTGCCCAAATTC
GATAGTTCTTTAATGAATAATCAATGCAAAACTGAAATTGTAATTGTCGT
AGATAGATCAGGAAGTATGCGTGGATCGAATATTGACCGAGCTAAGGAGT
GCCTTTTGATTTTCTTAAAGAGCCTACCAGTGTATTGCAAATTCCAAATT
TACGGATTTGGAAGTCAATTTGATAAAGTATTCAACGATTCGCAGTTGTA
TTCGGATCACTCAATCGGTATAGCACTGAATTATCAGAAAAATCTTGACG
CTAACTTCGGTGGCACTGAATTGATGAGACCTTTGGAAGATATGTACAAT
TCATACCTGCCTTCTGATTATAGCAGGTTGGCATTTTTGCTTACTGATGG
AAACGTGAGCAATCAAGACGAGGTGACGAAATTGGTGAGGAAACACAATA
AATCGACAAGACTATTTACAGTAGGAATCGGAGACGGAGTGTCGATATCA
TTGGTGGATCAAGTAGCAAAAGCCGGTCTTGGGAAATCTGTATTTGTTCG
AAATGCCAAGGAGCTCAGTGCTAGTGTCATGGAATTACTCGATATCGCTA
TGAATAGCGTTCCATTTACCGATGCCAAATTAGAATGGCATTGTCCACAG
CACGTATCGATCGTTACAGCTCCAAAATCAATTCCTCCAATTTTTTCGGA
TTATTTTTTGACGGCATTTTGCATGATTAACGGCATGAAATCAGGTGACG
TAATCAAATGCACGTTATCTGGAAGTGCCAATGGGGAACCGGTTTCATTC
ACAACAGAAATTAGGAATACAGATGCTTTTGTCGATGAAGAATTTCGAGT
TCACCGATTACTGGCCAAATATAAAATTAATGAAATGGCTGAACAAATCG
AAAGTGGAGAAGAAACTTTGAAAAAGGATTTAATAGATTTGAGCTTACAA
GTTAACATTGTAACAAAATACACGACATTTGTGGCTATAGACCAAGACGC
TCCAGGTGAACCTTTGGTCACATGCATTACTGATGATGGGAGCTCCACAG
ATGATGTGCGACATGTATGTTCCACCTCCTCCACCTCCAGCAATGAGATG
TTCTGCATTTGGCCTTATGTCTTCTCCGCCTGCTCCACCTCCCCAATATT
CTGCAATGAAAGAACAAGTTGCTATTGAAGATTTCTATGATGATATGGAC
TGTTCAGACAATTTAGAAGCATATGGTTGTTTTGATTCTGTGGATGGTTA
TATGGAAACTAAGTCAATGCCTAAAATTGAAACCAAAGAGAAAAGAAAGG
ATATAATTATGTTCCTAGTTGACTTGCAGAATATTAATGGATCATGGAAT
TACGATGAGAAAATATTTGCATATATTGGAATTGATGTAAATAGAATAAA
GGAAATCCAACCAGATAAAATTTCGGACATCATTTGGTCAACAGCTGTAA
TTTACCAACATCTAATGATAAAAGAACAAGCTAGAGAAAAAGAGTGGCGA
TTGTTTGCTAGAAAAGCGAAAGAATGGATTGAACAAAATTTGAATGATTC
CGCAATCTTTAATGATATTTTGAATAAAAGTGCGGAATTATTCCATTAGG
AAATGAATATTTATCAACCTCATACAAACAAACATAGATGCTTTCGTAAT
ATATTGTTTAGATACTTTAATGAAACTTGCTTTAGCGTATTTCATTATTC
TTACTTATTTTGTATTTCTATTGCACCATTTAGCGATTGGTTAAAGTTCT
CTCCCAGGGCCTAATTTAAGCTTCAAATTTCAAAGCACAGAATAGTTCAA
ACCTAATTTTTTTATTTGTAAAAAGTGCCCATTTGCCCTGTTCTTTTAAA
TAAAATATTAGAAAACATCAGTTACATAGTATTATTTATTCAGTAAAATA
TGCACTAATGAAATACTTCCTTATACGAAGAGAATGATTCTTTCCCGTGT
TTGTAGACTCCACCAGTGACAATAGATGTTGTTTTTGGAAACAGATTAAG
CCACTCAACCCCTGACATAGCTGCACCTTTTTGCATAACATGATACACCA
ATACTACCACGCTCCTCACTTTCGCTAAATCC
back to top

protein sequence of SMED30005772-orf-1

>SMED30005772-orf-1 ID=SMED30005772-orf-1|Name=SMED30005772-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MMGAPQMMCDMYVPPPPPPAMRCSAFGLMSSPPAPPPQYSAMKEQVAIED
FYDDMDCSDNLEAYGCFDSVDGYMETKSMPKIETKEKRKDIIMFLVDLQN
INGSWNYDEKIFAYIGIDVNRIKEIQPDKISDIIWSTAVIYQHLMIKEQA
REKEWRLFARKAKEWIEQNLNDSAIFNDILNKSAELFH*
back to top

protein sequence of SMED30005772-orf-2

>SMED30005772-orf-2 ID=SMED30005772-orf-2|Name=SMED30005772-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=659bp
VSQFEILNITTMFGLCPLKYDQKFSLKSLSVDCNIRNLLSSCTCEFVYKN
DGNEDGEGLFSFPIEYNCIVYYFEALVGGKKIIGLCKEIEEAKNLYEVAK
EKGHMAAIIEKNTSMLDVFKCRIGNFPKNSEAKIILKFAMELKLSPVRSE
VVDRFDLLLPLILRPRYTPPEYAGDREVFQVTNHYEYNFKAVINGTKVIE
NVSSVNHTLEIAFNNTNKTSAEVHLKSKYDGTKDLDININYLAMKEPSVV
YEVGSSSPLYSGKDAQGSFYHSDVAMVKFLPKFDSSLMNNQCKTEIVIVV
DRSGSMRGSNIDRAKECLLIFLKSLPVYCKFQIYGFGSQFDKVFNDSQLY
SDHSIGIALNYQKNLDANFGGTELMRPLEDMYNSYLPSDYSRLAFLLTDG
NVSNQDEVTKLVRKHNKSTRLFTVGIGDGVSISLVDQVAKAGLGKSVFVR
NAKELSASVMELLDIAMNSVPFTDAKLEWHCPQHVSIVTAPKSIPPIFSD
YFLTAFCMINGMKSGDVIKCTLSGSANGEPVSFTTEIRNTDAFVDEEFRV
HRLLAKYKINEMAEQIESGEETLKKDLIDLSLQVNIVTKYTTFVAIDQDA
PGEPLVTCITDDGSSTDDVRHVCSTSSTSSNEMFCIWPYVFSACSTSPIF
CNERTSCY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002035VWF_A
IPR013694VIT
IPR014760Serum_albumin_N
IPR008930Terpenoid_cyclase/PrenylTrfase
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space