Cell number regulator 7

Overview
NameCell number regulator 7
Smed IDSMED30005770
Length (bp)670
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell number regulator 7 (SMED30005770) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell number regulator 7 (SMED30005770) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell number regulator 7 (SMED30005770) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell number regulator 7 (SMED30005770) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005770

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005770 dd_Smed_v4_743_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30005770 dd_Smed_v6_743_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell number regulator 7 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 60.8474 bits (146), Expect = 1.594e-11
Identity = 38/103 (36.89%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+   L CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 60.8474 bits (146), Expect = 1.594e-11
Identity = 38/103 (36.89%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+   L CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 60.8474 bits (146), Expect = 1.594e-11
Identity = 38/103 (36.89%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+   L CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. Ensembl Human
Match: PLAC8 (placenta associated 8 [Source:HGNC Symbol;Acc:HGNC:19254])

HSP 1 Score: 60.8474 bits (146), Expect = 1.594e-11
Identity = 38/103 (36.89%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+   L CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. Ensembl Zebrafish
Match: ponzr10 (plac8 onzin related protein 10 [Source:ZFIN;Acc:ZDB-GENE-081107-68])

HSP 1 Score: 46.595 bits (109), Expect = 3.463e-6
Identity = 37/113 (32.74%), Postives = 49/113 (43.36%), Query Frame = 3
Query:   33 QMSDSDYHEYYWQHGLCSCFDDCGLCLVSFF-CPCYTVGMDAKAVGESCCLCGFATITPAAI------FTVPLI----RSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            Q   S   E  W  G+C CF D   C  +++ CPC+     A   GES CL     + PA +      F VP +    R  IR +  I GS   D  V   C  C+  QM++E
Sbjct:    7 QQVPSKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACS-TAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNRE 118          
BLAST of Cell number regulator 7 vs. Ensembl Zebrafish
Match: BX005027.2 (plac8 onzin related protein 10 [Source:NCBI gene;Acc:100001900])

HSP 1 Score: 46.595 bits (109), Expect = 3.545e-6
Identity = 37/113 (32.74%), Postives = 49/113 (43.36%), Query Frame = 3
Query:   33 QMSDSDYHEYYWQHGLCSCFDDCGLCLVSFF-CPCYTVGMDAKAVGESCCLCGFATITPAAI------FTVPLI----RSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            Q   S   E  W  G+C CF D   C  +++ CPC+     A   GES CL     + PA +      F VP +    R  IR +  I GS   D  V   C  C+  QM++E
Sbjct:    9 QQVPSKPQETLWNSGICDCFQDLNSCCYAYWCCPCFACS-TAGEFGESTCLPLVDILGPAVMASFGVAFCVPPVTMSLRVAIRHKYNIRGSICNDIAVSCCCVMCSWCQMNRE 120          
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Match: paqr6 (progestin and adipoQ receptor family member VI [Source:Xenbase;Acc:XB-GENE-5863258])

HSP 1 Score: 49.2914 bits (116), Expect = 2.070e-7
Identity = 32/91 (35.16%), Postives = 41/91 (45.05%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            W    C C +D G+CL   F PC      AK  GE CCL       P    T   +R+ IR+R  I G+   D+   + C  CT  QM +E
Sbjct:   27 WSSDTCDCCNDAGICLCGAFVPCILACRVAKDYGECCCL-------PCLFGTSIAMRTGIRERYHIEGTICNDWACVMCCGPCTLCQMARE 110          
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Match: eps15l1 (epidermal growth factor receptor pathway substrate 15-like 1 [Source:Xenbase;Acc:XB-GENE-959469])

HSP 1 Score: 49.2914 bits (116), Expect = 2.070e-7
Identity = 32/91 (35.16%), Postives = 41/91 (45.05%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            W    C C +D G+CL   F PC      AK  GE CCL       P    T   +R+ IR+R  I G+   D+   + C  CT  QM +E
Sbjct:   27 WSSDTCDCCNDAGICLCGAFVPCILACRVAKDYGECCCL-------PCLFGTSIAMRTGIRERYHIEGTICNDWACVMCCGPCTLCQMARE 110          
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Match: paqr6 (progestin and adipoQ receptor family member VI [Source:Xenbase;Acc:XB-GENE-5863258])

HSP 1 Score: 49.2914 bits (116), Expect = 2.311e-7
Identity = 32/91 (35.16%), Postives = 41/91 (45.05%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            W    C C +D G+CL   F PC      AK  GE CCL       P    T   +R+ IR+R  I G+   D+   + C  CT  QM +E
Sbjct:   30 WSSDTCDCCNDAGICLCGAFVPCILACRVAKDYGECCCL-------PCLFGTSIAMRTGIRERYHIEGTICNDWACVMCCGPCTLCQMARE 113          
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Match: eps15l1 (epidermal growth factor receptor pathway substrate 15-like 1 [Source:Xenbase;Acc:XB-GENE-959469])

HSP 1 Score: 49.2914 bits (116), Expect = 2.455e-7
Identity = 32/91 (35.16%), Postives = 41/91 (45.05%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            W    C C +D G+CL   F PC      AK  GE CCL       P    T   +R+ IR+R  I G+   D+   + C  CT  QM +E
Sbjct:   30 WSSDTCDCCNDAGICLCGAFVPCILACRVAKDYGECCCL-------PCLFGTSIAMRTGIRERYHIEGTICNDWACVMCCGPCTLCQMARE 113          
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Match: abtb1 (ankyrin repeat and BTB (POZ) domain containing 1 [Source:Xenbase;Acc:XB-GENE-976579])

HSP 1 Score: 48.1358 bits (113), Expect = 5.056e-7
Identity = 31/95 (32.63%), Postives = 43/95 (45.26%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            +   W   +  C +D G+CL   F PC      ++  GE CCL       P    +V  +R+ IR+R  I GS   D+    FC  CT  QM +E
Sbjct:   19 NSSQWNSDVFDCCEDMGICLCGTFVPCILACKVSQDFGECCCL-------PCLFGSVLAVRTGIRERYHIEGSICNDWVCLSFCGQCTLCQMARE 106          
BLAST of Cell number regulator 7 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 63.929 bits (154), Expect = 7.058e-13
Identity = 38/104 (36.54%), Postives = 51/104 (49.04%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYT-VGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMS 362
                WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS  +D+ V LFCP C+  Q+ ++     +M+
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMN 110          
BLAST of Cell number regulator 7 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 63.929 bits (154), Expect = 7.058e-13
Identity = 38/104 (36.54%), Postives = 51/104 (49.04%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYT-VGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMS 362
                WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS  +D+ V LFCP C+  Q+ ++     +M+
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMN 110          
BLAST of Cell number regulator 7 vs. Ensembl Mouse
Match: Plac8 (placenta-specific 8 [Source:MGI Symbol;Acc:MGI:2445289])

HSP 1 Score: 63.929 bits (154), Expect = 7.058e-13
Identity = 38/104 (36.54%), Postives = 51/104 (49.04%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYT-VGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMS 362
                WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS  +D+ V LFCP C+  Q+ ++     +M+
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMN 110          
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Match: sp|Q9JI48|PLAC8_MOUSE (Placenta-specific gene 8 protein OS=Mus musculus OX=10090 GN=Plac8 PE=1 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.937e-12
Identity = 38/104 (36.54%), Postives = 51/104 (49.04%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYT-VGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMS 362
                WQ  LC CF DCG+CL   F  C+T +G    A    CCLCG          T   +R+  R R  IPGS  +D+ V LFCP C+  Q+ ++     +M+
Sbjct:   19 QNSNWQTSLCDCFSDCGVCLCGTF--CFTCLGCQVAADMNECCLCG----------TTVAMRTLYRTRYGIPGSICDDYMVTLFCPVCSVCQLKRDINRRRAMN 110          
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Match: sp|Q9NZF1|PLAC8_HUMAN (Placenta-specific gene 8 protein OS=Homo sapiens OX=9606 GN=PLAC8 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 7.654e-11
Identity = 38/103 (36.89%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+   L CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Match: sp|Q5REK4|PLAC8_PONAB (Placenta-specific gene 8 protein OS=Pongo abelii OX=9601 GN=PLAC8 PE=3 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.443e-10
Identity = 37/103 (35.92%), Postives = 48/103 (46.60%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSM 359
                WQ G+C CF DCG+CL   FC PC  +G    A    CCLCG          T   +R+  R R  IPGS  +D+     CP CT  Q+ ++     +M
Sbjct:   22 QNSNWQTGMCDCFSDCGVCLCGTFCFPC--LGCQVAADMNECCLCG----------TSVAMRTLYRTRYGIPGSICDDYMATFCCPHCTLCQIKRDINRRRAM 112          
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Match: sp|Q3ZCB2|PLAC8_BOVIN (Placenta-specific gene 8 protein OS=Bos taurus OX=9913 GN=PLAC8 PE=3 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 9.513e-9
Identity = 36/95 (37.89%), Postives = 45/95 (47.37%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
                WQ GLC CF DCG+CL   FC        A  + E CCLCG          T   +R+  R R  IPGS  +DF V   CP C+  Q+ ++
Sbjct:   23 QNSNWQTGLCDCFSDCGVCLCGTFCFTCLACQVASDMNE-CCLCG----------TSVAMRTLYRTRYGIPGSICDDFMVTHCCPLCSLCQIKRD 106          
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Match: sp|Q6DK99|CNFNB_XENLA (Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=cnfn-b PE=3 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 2.258e-6
Identity = 32/95 (33.68%), Postives = 42/95 (44.21%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            +   W   +  C +D G CL   F PC      +K  GE CCL       P    +V  +R+ IR+R  I GS   D+    FC  CT  QM +E
Sbjct:   19 NSSQWNSDVFDCCEDMGTCLCGTFVPCILACKVSKDYGECCCL-------PCLFGSVLAVRTGIRERYHIEGSICNDWVCLSFCAPCTLCQMARE 106          
BLAST of Cell number regulator 7 vs. TrEMBL
Match: A0A267H0G2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011900g1 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.279e-30
Identity = 54/105 (51.43%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            +QHGLC C DDC LC++++FCPCYT G +A+AVG SCCLCG   I        P+IR  IR+RQ I GS+ +D+C++LFC  C   Q  QE   F+  +Q+IERE
Sbjct:    8 FQHGLCGCLDDCSLCIITYFCPCYTFGRNAEAVGSSCCLCGVGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIWLFCSFCALVQEAQEVKSFAIRAQSIERE 112          
BLAST of Cell number regulator 7 vs. TrEMBL
Match: A0A1I8JKZ3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018606g1 PE=4 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.456e-30
Identity = 54/105 (51.43%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            +QHGLC C DDC LC++++FCPCYT G +A+AVG SCCLCG   I        P+IR  IR+RQ I GS+ +D+C++LFC  C   Q  QE   F+  +Q+IERE
Sbjct:    8 FQHGLCGCLDDCSLCIITYFCPCYTFGRNAEAVGSSCCLCGVGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIWLFCGFCALVQEAQEVKSFAIRAQSIERE 112          
BLAST of Cell number regulator 7 vs. TrEMBL
Match: A0A267EXF1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011533g1 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 2.173e-30
Identity = 53/105 (50.48%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            +QHGLC C DDC +C++++FCPCYT G +A+AVG SCCLCG   I        P+IR  IR+RQ I GS+ +D+C++LFC  C   Q  QE   F+  +Q+IERE
Sbjct:    8 FQHGLCGCLDDCSICIITYFCPCYTFGRNAEAVGSSCCLCGLGLILGFGCIIGPMIRGKIRERQGIDGSFCKDWCIWLFCGFCALVQEAQEVKSFAIRAQSIERE 112          
BLAST of Cell number regulator 7 vs. TrEMBL
Match: A0A1I8HVT9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016327g1 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.163e-29
Identity = 51/105 (48.57%), Postives = 68/105 (64.76%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            +QHGLC CFDDCGLC++++F PCYT G +A+AVG+SC LC             P++R  IR+RQ I GS++ DFCV+ FC  C   Q  QE   F+   Q++ERE
Sbjct:    4 FQHGLCGCFDDCGLCIITYFVPCYTFGKNAEAVGDSCMLCALGMACGLGFILGPIVRGKIRERQGIDGSFIGDFCVWFFCGLCALIQEGQEVKSFAMKGQSVERE 108          
BLAST of Cell number regulator 7 vs. TrEMBL
Match: A0A267GVB5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020929g1 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.068e-29
Identity = 52/105 (49.52%), Postives = 71/105 (67.62%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            +QHGL +CFDDCGLCL+++  PCYT GM+A+AVGE+C +CG   +   +    P+IRS IR+RQ IPGS++ D C++ FC  C   Q   E   F++  Q IERE
Sbjct:    4 FQHGLFACFDDCGLCLITYLVPCYTFGMNAEAVGENCFVCGLGMVCGLSFILGPMIRSKIRERQGIPGSFMADCCIWFFCSFCALVQEGLEVKTFAARPQRIERE 108          
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 46.9802 bits (110), Expect = 1.352e-6
Identity = 33/106 (31.13%), Postives = 47/106 (44.34%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCL----CGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            W  G+C C +D G+C   F+CP   +    K  GE  CL      F  + P   ++   +RS +R+R  I GS  +D CV   C  C   Q+ +E        Q I
Sbjct:   24 WSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYS---MRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKYRRQQPQVI 126          
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Match: plac8.1 (placenta associated 8 [Source:NCBI gene;Acc:103039126])

HSP 1 Score: 45.8246 bits (107), Expect = 2.290e-6
Identity = 35/97 (36.08%), Postives = 48/97 (49.48%), Query Frame = 3
Query:   51 YHEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            +    +Q GL  C DDC  C+  +FC PC    + A  +GE CCLCG           +P IRS  R +  I GS  +DFC+  FC  C   Q+ ++
Sbjct:   10 FARTEFQTGLFECCDDCCTCMYGYFCLPCLGCSI-ASDMGE-CCLCGLG---------MP-IRSVYRTKYNIKGSMCKDFCISQFCLPCAACQLKRD 94          
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Match: plac8.1 (placenta associated 8 [Source:NCBI gene;Acc:103039126])

HSP 1 Score: 45.8246 bits (107), Expect = 2.607e-6
Identity = 35/92 (38.04%), Postives = 47/92 (51.09%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
            +Q GL  C DDC  C+  +FC PC    + A  +GE CCLCG           +P IRS  R +  I GS  +DFC+  FC  C   Q+ ++
Sbjct:   22 FQTGLFECCDDCCTCMYGYFCLPCLGCSI-ASDMGE-CCLCGLG---------MP-IRSVYRTKYNIKGSMCKDFCISQFCLPCAACQLKRD 101          
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 46.2098 bits (108), Expect = 3.385e-6
Identity = 33/106 (31.13%), Postives = 47/106 (44.34%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCL----CGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            W  G+C C +D G+C   F+CP   +    K  GE  CL      F  + P   ++   +RS +R+R  I GS  +D CV   C  C   Q+ +E        Q I
Sbjct:   24 WSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYS---MRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKYRRQQPQVI 126          
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Match: ponzr6 (cornifelin homolog [Source:NCBI gene;Acc:103028345])

HSP 1 Score: 46.2098 bits (108), Expect = 3.385e-6
Identity = 33/106 (31.13%), Postives = 47/106 (44.34%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCL----CGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            W  G+C C +D G+C   F+CP   +    K  GE  CL      F  + P   ++   +RS +R+R  I GS  +D CV   C  C   Q+ +E        Q I
Sbjct:   24 WSSGICDCCEDMGICCFGFWCPYCLMCNTTKKYGECMCLPLVELCFGGLIPPVTYS---MRSSMRERYHIQGSMCDDCCVSTCCGICAWCQIARELKYRRQQPQVI 126          
BLAST of Cell number regulator 7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009354.1 (pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 gene:ENSPMAG00000008464.1 transcript:ENSPMAT00000009354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 43.8986 bits (102), Expect = 2.500e-6
Identity = 31/105 (29.52%), Postives = 45/105 (42.86%), Query Frame = 3
Query:   57 EYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            +  W   +  CF D  +C+  FFC        A   GE  C C    + P A+     +R+ IR+R  I G+  +DF     C  CTT QM +E     +   A+
Sbjct:   20 QAQWSSHMMDCFQDTEICVCGFFCLPLLQCKVASDFGE--CFC--VPMLPGALMA---LRTGIRERHHIEGTVFDDFVSLWCCNHCTTCQMARELRHQKNRGTAV 117          
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Match: EDO50068 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFB0])

HSP 1 Score: 85.1149 bits (209), Expect = 1.452e-21
Identity = 42/105 (40.00%), Postives = 63/105 (60.00%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAA-IFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIER 377
            W +GL  CF+DCG CL+++  PCYT G +A+AVG+SC LCG A   P   +  +  +R  IR++  I GS++ D    + CP C+  Q  Q+  + +  SQ+I R
Sbjct:    5 WNNGLFGCFNDCGTCLITYIAPCYTFGKNAEAVGDSCLLCGLAFFVPVVDLIVMSSVRGKIREQHGISGSFIGDCAATICCPFCSLVQSAQQV-KGAPGSQSIAR 108          
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Match: EDO44794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUR8])

HSP 1 Score: 79.7221 bits (195), Expect = 1.817e-19
Identity = 41/105 (39.05%), Postives = 58/105 (55.24%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGF-ATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIER 377
            W  G+C CF+D   C +++FCPC   G +A+AVGE+C L GF +T+    IF    IR  IR++  I GS+  D  +  FCP C  +Q  +E        QA+ R
Sbjct:    3 WSSGICGCFEDINTCALTYFCPCVVAGKNAEAVGENCFLHGFLSTLGCVGIFCGAKIREKIREKHGIEGSFGNDCIMHWFCPLCAYSQEARELKARCPSGQAMAR 107          
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Match: EDO36116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJK5])

HSP 1 Score: 67.781 bits (164), Expect = 7.140e-15
Identity = 37/105 (35.24%), Postives = 56/105 (53.33%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITP-AAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIER 377
            + +GL  CF D  LCL ++  PCYT G  A+AVGE C +CG   + P A I+    IR  +R+++ I GS++ D  +   C  C+  Q   E    + +  +I R
Sbjct:    4 FSNGLFGCFSDIPLCLTTYCVPCYTFGKTAEAVGEDCLMCGIVLMVPCANIWFATQIRGKVREQKGIEGSFVNDLLMTWCCGFCSIIQEALEMGVKAPIGNSIAR 108          
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Match: EDO42612 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W1])

HSP 1 Score: 54.6842 bits (130), Expect = 9.279e-10
Identity = 28/97 (28.87%), Postives = 43/97 (44.33%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSS 356
            W  G+C CFDD G CL+ +FCPC+ +   ++ +GE                 +  +R  +R  Q I GS + D+C     P C   Q+ +E      
Sbjct:   54 WHSGMCGCFDDIGSCLLGYFCPCFLLIDVSQRMGEG------CCFPCCCPGALVGLRVKLRVEQNIQGSLINDYCAVQCLPLCVLCQLSRELKHLGR 144          
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Match: EDO42647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V8])

HSP 1 Score: 45.4394 bits (106), Expect = 1.627e-6
Identity = 32/99 (32.32%), Postives = 42/99 (42.42%), Query Frame = 3
Query:   54 HEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGE----SCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
             +  W  GL  C  D G CLV+F CPC T+   ++ +GE     CC    A  T         +R+ +R  Q I GS   D      C  C   QM +E
Sbjct:   26 QQRDWSSGLFECTKDIGGCLVTFLCPCVTLCQISQRMGEGLAYGCCCADIAAFT---------LRAKLRTEQNIQGSLCNDAIHVSCCMHCALCQMSRE 115          
BLAST of Cell number regulator 7 vs. Ensembl Medaka
Match: ponzr1 (cornifelin homolog B [Source:NCBI gene;Acc:110017082])

HSP 1 Score: 51.9878 bits (123), Expect = 2.366e-8
Identity = 34/103 (33.01%), Postives = 49/103 (47.57%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            W  G+C C  D G C  + +C PC    M  +   +    C    +    + T  L+RS IR+R  IPGS ++D C  +FC  C   QMH+E    S+   A+
Sbjct:   40 WSTGMCECCADVGTCCCAMWCFPC----MQCQTAQKHGWCCAMPLLDICGVVTC-LLRSSIRERHHIPGSCIDDCCKCMFCYPCVWCQMHREVKVRSNAGSAV 137          
BLAST of Cell number regulator 7 vs. Ensembl Medaka
Match: ENSORLT00000028572.1 (cornifelin homolog [Source:NCBI gene;Acc:101172524])

HSP 1 Score: 45.0542 bits (105), Expect = 4.729e-6
Identity = 29/99 (29.29%), Postives = 44/99 (44.44%), Query Frame = 3
Query:   42 DSDYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQE 338
             ++     W  GLCSCF+DC +C + FFCP       A   GE+ CL       P  +     +R+++R    I G+   D  +   C  C   +M +E
Sbjct:   16 GTNVQTGEWSTGLCSCFNDCLICALGFFCPAGLSCYTAHKYGENFCL----GCVPGGM---TAMRTHMRLTYGIQGTVCNDAIMVFCCGLCEMCRMARE 107          
BLAST of Cell number regulator 7 vs. Ensembl Medaka
Match: ENSORLT00000040567.1 (pep primary_assembly:ASM223467v1:4:15638746:15640366:-1 gene:ENSORLG00000022609.1 transcript:ENSORLT00000040567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 5.182e-6
Identity = 42/145 (28.97%), Postives = 61/145 (42.07%), Query Frame = 3
Query:   12 NNKVL*DQMSDSDYHEYYWQHGLCSCFDDCGLCLVSFFC-PCYTVGMDAKAVGESCCL-------------CGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE*RAEIYIN 404
            N+ +  +QM+ +   E  W  GLC CF+D   C   F+C PC    +  K  GE  CL             CG     P   F+    RS +R+R  I GS  +D  V   C  C+  QMH+E        + I  +   + ++N
Sbjct:    3 NDVLFQNQMAQNALVE--WNTGLCDCFEDAATCCYGFWCGPCLACSVSGK-FGEFYCLPLCDYFCQSTLNACGIPCFVPPVAFST---RSSMRNRYGIKGSLCKDLVVSCCCVWCSWCQMHRELKHQKKAPEVIHMQ--PQTFVN 139          
BLAST of Cell number regulator 7 vs. Ensembl Medaka
Match: ponzr1 (cornifelin homolog B [Source:NCBI gene;Acc:110017082])

HSP 1 Score: 44.669 bits (104), Expect = 5.875e-6
Identity = 21/48 (43.75%), Postives = 29/48 (60.42%), Query Frame = 3
Query:  228 LIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAI 371
            L+RS IR+R  IPGS ++D C  +FC  C   QMH+E    S+   A+
Sbjct:   59 LLRSSIRERHHIPGSCIDDCCKCMFCYPCVWCQMHREVKVRSNAGSAV 106          
BLAST of Cell number regulator 7 vs. Planmine SMEST
Match: SMESG000060415.1 (SMESG000060415.1)

HSP 1 Score: 237.269 bits (604), Expect = 8.232e-81
Identity = 114/115 (99.13%), Postives = 115/115 (100.00%), Query Frame = 3
Query:   36 MSDSDYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            MSDS+YHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE
Sbjct:    1 MSDSEYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 115          
BLAST of Cell number regulator 7 vs. Planmine SMEST
Match: SMESG000060403.1 (SMESG000060403.1)

HSP 1 Score: 200.675 bits (509), Expect = 1.996e-66
Identity = 95/113 (84.07%), Postives = 104/113 (92.04%), Query Frame = 3
Query:   36 MSDSDYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIE 374
            MS+SDYH+Y WQHGLCSCFDDCGLCLV+FFCPCYTVG+DA+AVGE+CCLCGFA +TPAA FTVPLIRSYIRDRQKIPGSY EDFCVF +CPCCTTAQMHQETYEFS  S + E
Sbjct:    1 MSESDYHDYDWQHGLCSCFDDCGLCLVAFFCPCYTVGVDAEAVGENCCLCGFAVLTPAACFTVPLIRSYIRDRQKIPGSYCEDFCVFFWCPCCTTAQMHQETYEFSPHSMSRE 113          
BLAST of Cell number regulator 7 vs. Planmine SMEST
Match: SMESG000023846.1 (SMESG000023846.1)

HSP 1 Score: 105.145 bits (261), Expect = 5.844e-29
Identity = 47/105 (44.76%), Postives = 67/105 (63.81%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            WQHGLC CF DCG CL+S+F PCY VG DA+AVG+SC LCG   +         ++R  +R+++ I G++  D     +CPCC+ AQ HQE    ++ + +IER+
Sbjct:    4 WQHGLCGCFSDCGTCLLSYFVPCYLVGKDAEAVGDSCFLCGLGYLVIYGCVG-AIVRKKVREKRGISGNFCFDLVASCWCPCCSVAQTHQEVLAMNAAAMSIERD 107          
BLAST of Cell number regulator 7 vs. Planmine SMEST
Match: SMESG000023831.1 (SMESG000023831.1)

HSP 1 Score: 95.1301 bits (235), Expect = 3.761e-25
Identity = 47/105 (44.76%), Postives = 62/105 (59.05%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            WQ G+C CF D G C++++F PCY VG+DA+ V ++C LC  A +      T   IR  +R ++ IPG    D  V LF PCCT AQMH E    S  + A+ERE
Sbjct:    4 WQQGICGCFGDLGTCVLAYFAPCYLVGLDAETVDKNCVLCCIAFLFFPPCITCH-IRGKVRSKRNIPGGSCNDCVVSLFLPCCTVAQMHHEVKHMSGTAMALERE 107          
BLAST of Cell number regulator 7 vs. Planmine SMEST
Match: SMESG000023842.1 (SMESG000023842.1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.427e-22
Identity = 52/105 (49.52%), Postives = 67/105 (63.81%), Query Frame = 3
Query:   66 WQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLCGFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQETYEFSSMSQAIERE 380
            W+HGLC C DDCG CL+++F PCY +G DA+AVG+SC LCG  ++  A    +  +RS +RDR+ I GS++ D      C CC  AQMHQE       S AIERE
Sbjct:    4 WEHGLCGCCDDCGTCLLTYFVPCYLIGKDAEAVGDSCFLCGCGSLF-AGPCIIAYVRSKVRDRRNITGSFIGDLLCAFCCGCCVVAQMHQEVIAMGGSSMAIERE 107          
The following BLAST results are available for this feature:
BLAST of Cell number regulator 7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PLAC81.594e-1136.89placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC81.594e-1136.89placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC81.594e-1136.89placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
PLAC81.594e-1136.89placenta associated 8 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell number regulator 7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell number regulator 7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ponzr103.463e-632.74plac8 onzin related protein 10 [Source:ZFIN;Acc:ZD... [more]
BX005027.23.545e-632.74plac8 onzin related protein 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
paqr62.070e-735.16progestin and adipoQ receptor family member VI [So... [more]
eps15l12.070e-735.16epidermal growth factor receptor pathway substrate... [more]
paqr62.311e-735.16progestin and adipoQ receptor family member VI [So... [more]
eps15l12.455e-735.16epidermal growth factor receptor pathway substrate... [more]
abtb15.056e-732.63ankyrin repeat and BTB (POZ) domain containing 1 [... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Plac87.058e-1336.54placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac87.058e-1336.54placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
Plac87.058e-1336.54placenta-specific 8 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Cell number regulator 7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JI48|PLAC8_MOUSE4.937e-1236.54Placenta-specific gene 8 protein OS=Mus musculus O... [more]
sp|Q9NZF1|PLAC8_HUMAN7.654e-1136.89Placenta-specific gene 8 protein OS=Homo sapiens O... [more]
sp|Q5REK4|PLAC8_PONAB3.443e-1035.92Placenta-specific gene 8 protein OS=Pongo abelii O... [more]
sp|Q3ZCB2|PLAC8_BOVIN9.513e-937.89Placenta-specific gene 8 protein OS=Bos taurus OX=... [more]
sp|Q6DK99|CNFNB_XENLA2.258e-633.68Cornifelin homolog B OS=Xenopus laevis OX=8355 GN=... [more]
back to top
BLAST of Cell number regulator 7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H0G21.279e-3051.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JKZ31.456e-3051.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EXF12.173e-3050.48Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HVT91.163e-2948.57Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GVB57.068e-2949.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ponzr61.352e-631.13cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
plac8.12.290e-636.08placenta associated 8 [Source:NCBI gene;Acc:103039... [more]
plac8.12.607e-638.04placenta associated 8 [Source:NCBI gene;Acc:103039... [more]
ponzr63.385e-631.13cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
ponzr63.385e-631.13cornifelin homolog [Source:NCBI gene;Acc:103028345... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009354.12.500e-629.52pep scaffold:Pmarinus_7.0:GL483774:7229:14014:-1 g... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cell number regulator 7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO500681.452e-2140.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447941.817e-1939.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361167.140e-1535.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426129.279e-1028.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426471.627e-632.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell number regulator 7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ponzr12.366e-833.01cornifelin homolog B [Source:NCBI gene;Acc:1100170... [more]
ENSORLT00000028572.14.729e-629.29cornifelin homolog [Source:NCBI gene;Acc:101172524... [more]
ENSORLT00000040567.15.182e-628.97pep primary_assembly:ASM223467v1:4:15638746:156403... [more]
ponzr15.875e-643.75cornifelin homolog B [Source:NCBI gene;Acc:1100170... [more]
back to top
BLAST of Cell number regulator 7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060415.18.232e-8199.13SMESG000060415.1[more]
SMESG000060403.11.996e-6684.07SMESG000060403.1[more]
SMESG000023846.15.844e-2944.76SMESG000023846.1[more]
SMESG000023831.13.761e-2544.76SMESG000023831.1[more]
SMESG000023842.11.427e-2249.52SMESG000023842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005770 ID=SMED30005770|Name=Cell number regulator 7|organism=Schmidtea mediterranea sexual|type=transcript|length=670bp
TTTTTTTCAGGAATAATAAAGTTTTATAAGATCAAATGTCTGACTCGGAT
TATCACGAATATTATTGGCAACATGGACTATGCAGTTGTTTTGATGATTG
CGGTTTATGTTTAGTATCATTTTTTTGTCCATGCTACACAGTTGGAATGG
ACGCCAAGGCTGTGGGAGAAAGTTGTTGTCTCTGTGGATTTGCTACAATT
ACACCTGCTGCGATTTTTACAGTTCCACTTATTAGAAGTTATATTCGAGA
CCGACAAAAAATTCCCGGAAGTTATTTAGAAGATTTTTGTGTGTTTCTAT
TTTGTCCATGCTGTACTACTGCTCAGATGCATCAAGAAACTTATGAGTTT
AGTTCAATGTCTCAAGCCATTGAACGAGAGTAAAGAGCCGAAATATATAT
AAATTCTAGATCAGTCTCTTCAGTGGTGATATAAACAAATTTTTCCTCAA
ACCCGTTTTGATTTTAAACATTATAATTGTTTTTGGTACAGCTTTTAAAA
TTTACAATCACTACAGTAAAACAATAAAATGAAATTGTTGTCAGTGTTTA
ATAGATATTATGCAGATATGTGCCTGTATTAGGTTCAGTTATGTAACTTT
AATGGTAATGGAATTGATCTTTGAACTCGAATTAATAAATAAAGTTCAAT
CTATTTTCTTTAAAAAAAAA
back to top

protein sequence of SMED30005770-orf-1

>SMED30005770-orf-1 ID=SMED30005770-orf-1|Name=SMED30005770-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=116bp
MSDSDYHEYYWQHGLCSCFDDCGLCLVSFFCPCYTVGMDAKAVGESCCLC
GFATITPAAIFTVPLIRSYIRDRQKIPGSYLEDFCVFLFCPCCTTAQMHQ
ETYEFSSMSQAIERE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR006461PLAC_motif_containing
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006461PLAC8 motif-containing proteinPFAMPF04749PLAC8coord: 11..101
e-value: 3.1E-19
score: 69.8
IPR006461PLAC8 motif-containing proteinTIGRFAMTIGR01571TIGR01571coord: 11..101
e-value: 5.4E-20
score: 70.1
IPR006461PLAC8 motif-containing proteinPANTHERPTHR15907FAMILY NOT NAMEDcoord: 10..112
NoneNo IPR availablePANTHERPTHR15907:SF102coord: 10..112