Phosphodiesterase

Overview
NamePhosphodiesterase
Smed IDSMED30005765
Length (bp)466
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphodiesterase (SMED30005765) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30005765) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphodiesterase (SMED30005765) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphodiesterase (SMED30005765) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005765

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005765SMESG000019038.1 dd_Smed_v4_8595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005765SMESG000019038.1 dd_Smed_v4_8595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005765SMESG000019038.1 dd_Smed_v4_8595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005765SMESG000019038.1 dd_Smed_v4_8595_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE11A (phosphodiesterase 11A [Source:NCBI gene;Acc:50940])

HSP 1 Score: 99.3673 bits (246), Expect = 2.431e-24
Identity = 58/161 (36.02%), Postives = 94/161 (58.39%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI+ S G ++GV Q +NK+     A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  +LL+ ++     K FT+ +E        ++E + ++  E    S + IN  I+  VA TG
Sbjct:   76 MPIRSSDGEIIGVAQAINKIP--EGAPFTEDDEKVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVK-FTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTG 233          

HSP 2 Score: 48.521 bits (114), Expect = 9.966e-7
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  265 VPIWNSNHQIIGVAQVLNRLDGK---PFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 330          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE11A (phosphodiesterase 11A [Source:HGNC Symbol;Acc:HGNC:8773])

HSP 1 Score: 99.3673 bits (246), Expect = 2.776e-24
Identity = 58/161 (36.02%), Postives = 94/161 (58.39%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI+ S G ++GV Q +NK+     A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  +LL+ ++     K FT+ +E        ++E + ++  E    S + IN  I+  VA TG
Sbjct:  326 MPIRSSDGEIIGVAQAINKIP--EGAPFTEDDEKVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVK-FTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVASTG 483          

HSP 2 Score: 48.521 bits (114), Expect = 1.230e-6
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  515 VPIWNSNHQIIGVAQVLNRLDGK---PFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 580          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE5A (phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:8784])

HSP 1 Score: 93.9745 bits (232), Expect = 1.885e-22
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPIK+    V+GV Q +NK +S N   F  +D K F +YL+FCG+ + NAQ+Y  S LE +RNQVLLDLA LIFEEQ  ++ ++ KI     S +Q ++  I +V
Sbjct:  269 MPIKNHREEVVGVAQAINK-KSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIV 372          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE5A (phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:8784])

HSP 1 Score: 93.9745 bits (232), Expect = 1.948e-22
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPIK+    V+GV Q +NK +S N   F  +D K F +YL+FCG+ + NAQ+Y  S LE +RNQVLLDLA LIFEEQ  ++ ++ KI     S +Q ++  I +V
Sbjct:  227 MPIKNHREEVVGVAQAINK-KSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIV 330          
BLAST of Phosphodiesterase vs. Ensembl Human
Match: PDE5A (phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:8784])

HSP 1 Score: 93.9745 bits (232), Expect = 1.964e-22
Identity = 49/105 (46.67%), Postives = 68/105 (64.76%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPIK+    V+GV Q +NK +S N   F  +D K F +YL+FCG+ + NAQ+Y  S LE +RNQVLLDLA LIFEEQ  ++ ++ KI     S +Q ++  I +V
Sbjct:  217 MPIKNHREEVVGVAQAINK-KSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIV 320          
BLAST of Phosphodiesterase vs. Ensembl Celegans
Match: pde-5 (Probable 3',5'-cyclic phosphodiesterase pde-5 [Source:UniProtKB/Swiss-Prot;Acc:P91119])

HSP 1 Score: 49.2914 bits (116), Expect = 2.378e-7
Identity = 32/95 (33.68%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  196 LLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESE-----INTEDLCESFGNSRFPINIGISGYVAKTG 465
            LLD+AR IF +   M  ++ K+M   Q L+  +R  + L   V+ K+ +I+ RI++    +     +N+E   E     RF ++ GI+GYVA TG
Sbjct:  201 LLDVARSIFHDIVSMDAVIIKVMNFAQKLVDADRASLFL---VDSKNAQIYARIFDVGTGDEEHVRVNSEGQKE----IRFDMSKGIAGYVASTG 288          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0343831)

HSP 1 Score: 172.555 bits (436), Expect = 3.633e-50
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  485 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 635          

HSP 2 Score: 49.2914 bits (116), Expect = 3.217e-7
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  667 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 757          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0112545)

HSP 1 Score: 172.555 bits (436), Expect = 3.633e-50
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  485 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 635          

HSP 2 Score: 49.2914 bits (116), Expect = 3.217e-7
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  667 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 757          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0112544)

HSP 1 Score: 172.555 bits (436), Expect = 3.933e-50
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  529 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 679          

HSP 2 Score: 49.2914 bits (116), Expect = 3.413e-7
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  711 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 801          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0343830)

HSP 1 Score: 172.555 bits (436), Expect = 3.933e-50
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  529 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 679          

HSP 2 Score: 49.2914 bits (116), Expect = 3.413e-7
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  711 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 801          
BLAST of Phosphodiesterase vs. Ensembl Fly
Match: Pde11 (gene:FBgn0085370 transcript:FBtr0303162)

HSP 1 Score: 172.17 bits (435), Expect = 4.686e-50
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  529 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 679          

HSP 2 Score: 49.2914 bits (116), Expect = 3.456e-7
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  711 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 801          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 96.6709 bits (239), Expect = 1.447e-23
Identity = 60/161 (37.27%), Postives = 93/161 (57.76%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI +S G V+GV Q +NK  S N A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  + L+ ++     K FT+ +E        + E + +D  +    S + IN  I+  VA TG
Sbjct:  276 MPIHNSDGEVIGVAQAINK--SPNGALFTQDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVK-FTKSFELLSPKCSADMENSFKDSMDKSSYSDWLINNSIAELVASTG 433          

HSP 2 Score: 47.7506 bits (112), Expect = 1.623e-6
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  465 VPIWNSNHQIIGVAQVLNRLDGKP---FDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 530          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11al (phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-GENE-031118-106])

HSP 1 Score: 93.2041 bits (230), Expect = 2.515e-22
Identity = 56/159 (35.22%), Postives = 93/159 (58.49%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAG--FNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNES--EINTEDLCESFGNSRFPINIGISGYVAKTG 465
            M I++S G V+GV Q +NK    N +G  F   D KV + YL FCG++I NA+++ +S+ E  R++ LL++   +FEEQ+ +++++ KIM    +LLQCER  +LL+ ++ H     F++ +E       ++ +   E    S + IN  I+  VA TG
Sbjct:  282 MAIRNSDGEVIGVVQAINK----NPSGTPFTEDDEKVLQMYLPFCGISISNAKLFSESRKEYERSRALLEVVNDLFEEQTDLEKIVRKIMQRALTLLQCERCSVLLLEDI-HSPVVKFSQTFELMSPLCSVDRDISMEKVSCSDWLINNSIAELVASTG 435          

HSP 2 Score: 49.2914 bits (116), Expect = 4.666e-7
Identity = 21/69 (30.43%), Postives = 42/69 (60.87%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI + +  ++GV Q++N+++ +    FN  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  467 VPIWNRTHQIIGVAQILNRLDRKT---FNDADQRLFEAFVIFCGLGINNTMMYNQVKKTWAKQSVALDM 532          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 90.1225 bits (222), Expect = 2.693e-21
Identity = 59/161 (36.65%), Postives = 92/161 (57.14%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI +S G V+GV Q +NK  S N A F   D K+   YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  + L+ ++     K FT+ +E        + E + +D  +    S + IN  I+  VA TG
Sbjct:  276 MPIHNSDGEVIGVAQAINK--SPNGALFTQDDEKM---YLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVK-FTKSFELLSPKCSADMENSFKDSMDKSSYSDWLINNSIAELVASTG 430          

HSP 2 Score: 47.7506 bits (112), Expect = 1.429e-6
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  462 VPIWNSNHQIIGVAQVLNRLDGKP---FDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 527          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde5ab (phosphodiesterase 5A, cGMP-specific, b [Source:ZFIN;Acc:ZDB-GENE-060824-4])

HSP 1 Score: 88.9669 bits (219), Expect = 6.618e-21
Identity = 58/162 (35.80%), Postives = 83/162 (51.23%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFP--------INIGISGYVAKT 462
            +PIK+    V+GV Q +NK    N + F  +D K F SYL+F G+ + NAQ+Y  SQLE RRNQVLLDLA LIFEEQ  ++ L+ K +    S +Q +   + +    + +    F  ++     EI         G++ FP        IN   + YV  T
Sbjct:  268 LPIKNHRDEVVGVAQAINKKCGEN-STFTEQDEKDFSSYLAFSGIVLHNAQLYETSQLENRRNQVLLDLASLIFEEQQSLEVLLRKTVATILSFMQAQECTVFI---SDRETANTFASVFHMEYEEIA--------GSTDFPNRECDVNKINYMYAQYVKNT 417          
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Match: pde5ab (phosphodiesterase 5A, cGMP-specific, b [Source:ZFIN;Acc:ZDB-GENE-060824-4])

HSP 1 Score: 88.9669 bits (219), Expect = 6.882e-21
Identity = 47/104 (45.19%), Postives = 65/104 (62.50%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILL 312
            +PIK+    V+GV Q +NK    N + F  +D K F SYL+F G+ + NAQ+Y  SQLE RRNQVLLDLA LIFEEQ  ++ L+ K +    S +Q +   + +
Sbjct:  268 LPIKNHRDEVVGVAQAINKKCGEN-STFTEQDEKDFSSYLAFSGIVLHNAQLYETSQLENRRNQVLLDLASLIFEEQQSLEVLLRKTVATILSFMQAQECTVFI 370          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde5a (phosphodiesterase 5A [Source:NCBI gene;Acc:780273])

HSP 1 Score: 98.9821 bits (245), Expect = 2.689e-24
Identity = 59/159 (37.11%), Postives = 87/159 (54.72%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGN-----------------VNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFP 426
            MPIK+    V+GV Q +NK +S +   F  +D K F +YL+FCG+ + NAQ+Y  S LE RRNQVLLDLA LIFEEQ  ++ ++ KI     S +Q +R  I +V                   +++K N ++ +        IN  D+C+   ++RFP
Sbjct:  258 MPIKNHREEVVGVAQAINK-KSGSNGTFTDQDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQVLLDLATLIFEEQQSLEVILKKIAATILSFMQAQRCTIFIVDEDSPVWDLLYRMFGTWDFLDYKMNYMYAQYVANTMEAINIPDICK---DTRFP 412          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: ENSXETT00000053056.1 (phosphodiesterase 11A [Source:NCBI gene;Acc:100379882])

HSP 1 Score: 97.4413 bits (241), Expect = 1.223e-23
Identity = 58/161 (36.02%), Postives = 94/161 (58.39%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI+ S G ++GV Q +NK  +   A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  +LL+ ++     K FT+ +E        ++E + +D  E    S + +N  I+  VA TG
Sbjct:  281 MPIRSSDGEIIGVAQAINK--TPGGAPFIEDDEKVMQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKVVKKIMHRAQNLLKCERCSVLLLEDIESPVVK-FTKSFELLSPKCSADTENSFKDSVEKSSYSDWLVNNSIAELVASTG 438          

HSP 2 Score: 50.8322 bits (120), Expect = 1.537e-7
Identity = 23/69 (33.33%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +SS  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  470 VPIWNSSHQIIGVAQVLNRIDGK---PFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 535          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde5a (phosphodiesterase 5A [Source:NCBI gene;Acc:780273])

HSP 1 Score: 96.2857 bits (238), Expect = 2.951e-23
Identity = 60/156 (38.46%), Postives = 90/156 (57.69%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIY--EYNESEINTEDLCESFGNSRFPINIGISGYVAKT 462
            MPIK+    V+GV Q +NK +S +   F  +D K F +YL+FCG+ + NAQ+Y  S LE RRNQVLLDLA LIFEEQ  ++ ++ KI     S +Q +R  I +   V+      F+ ++  E +E E + + +   +  S+  +N   + YVA T
Sbjct:  334 MPIKNHREEVVGVAQAINK-KSGSNGTFTDQDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQVLLDLATLIFEEQQSLEVILKKIAATILSFMQAQRCTIFI---VDEDSPDTFSSVFHMESDELEESADAVKREYDVSK--MNYMYAQYVANT 483          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde5a (phosphodiesterase 5A [Source:NCBI gene;Acc:780273])

HSP 1 Score: 95.9005 bits (237), Expect = 3.634e-23
Identity = 60/156 (38.46%), Postives = 90/156 (57.69%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIY--EYNESEINTEDLCESFGNSRFPINIGISGYVAKT 462
            MPIK+    V+GV Q +NK +S +   F  +D K F +YL+FCG+ + NAQ+Y  S LE RRNQVLLDLA LIFEEQ  ++ ++ KI     S +Q +R  I +   V+      F+ ++  E +E E + + +   +  S+  +N   + YVA T
Sbjct:  334 MPIKNHREEVVGVAQAINK-KSGSNGTFTDQDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQVLLDLATLIFEEQQSLEVILKKIAATILSFMQAQRCTIFI---VDEDSPDTFSSVFHMESDELEESADAVKREYDVSK--MNYMYAQYVANT 483          
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Match: pde5a (phosphodiesterase 5A [Source:NCBI gene;Acc:780273])

HSP 1 Score: 95.9005 bits (237), Expect = 3.819e-23
Identity = 60/156 (38.46%), Postives = 90/156 (57.69%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIY--EYNESEINTEDLCESFGNSRFPINIGISGYVAKT 462
            MPIK+    V+GV Q +NK +S +   F  +D K F +YL+FCG+ + NAQ+Y  S LE RRNQVLLDLA LIFEEQ  ++ ++ KI     S +Q +R  I +   V+      F+ ++  E +E E + + +   +  S+  +N   + YVA T
Sbjct:  252 MPIKNHREEVVGVAQAINK-KSGSNGTFTDQDEKDFAAYLAFCGIVLHNAQLYETSLLENRRNQVLLDLATLIFEEQQSLEVILKKIAATILSFMQAQRCTIFI---VDEDSPDTFSSVFHMESDELEESADAVKREYDVSK--MNYMYAQYVANT 401          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde11a (phosphodiesterase 11A [Source:MGI Symbol;Acc:MGI:3036251])

HSP 1 Score: 100.138 bits (248), Expect = 9.497e-25
Identity = 59/161 (36.65%), Postives = 95/161 (59.01%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI++S G ++GV Q +NKV     A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  +LL+ ++     K FT+ +E        ++E + ++  E    S + IN  I+  VA TG
Sbjct:  326 MPIRNSDGEIIGVAQAINKVPE--GAPFTEDDEKVMQMYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVK-FTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSIAELVASTG 483          

HSP 2 Score: 47.7506 bits (112), Expect = 1.525e-6
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  515 VPIWNSNHQIIGVAQVLNRLDGKP---FDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 580          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde5a (phosphodiesterase 5A, cGMP-specific [Source:MGI Symbol;Acc:MGI:2651499])

HSP 1 Score: 95.5153 bits (236), Expect = 4.191e-23
Identity = 56/143 (39.16%), Postives = 82/143 (57.34%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPI 429
            MPIK+    V+GV Q +NK +S N   F  +D K F +YL+FCG+ + NAQ+Y  S LE +RNQVLLDLA LIFEEQ  ++ ++ KI     S +Q ++  I +V + +  D+  F+R++            CE  G    P+
Sbjct:  227 MPIKNHREEVVGVAQAINK-KSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIV-DEDCPDS--FSRVFHME---------CEEVGKPSDPL 356          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde5a (phosphodiesterase 5A, cGMP-specific [Source:MGI Symbol;Acc:MGI:2651499])

HSP 1 Score: 95.1301 bits (235), Expect = 4.683e-23
Identity = 56/143 (39.16%), Postives = 82/143 (57.34%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPI 429
            MPIK+    V+GV Q +NK +S N   F  +D K F +YL+FCG+ + NAQ+Y  S LE +RNQVLLDLA LIFEEQ  ++ ++ KI     S +Q ++  I +V + +  D+  F+R++            CE  G    P+
Sbjct:  259 MPIKNHREEVVGVAQAINK-KSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIV-DEDCPDS--FSRVFHME---------CEEVGKPSDPL 388          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde11a (phosphodiesterase 11A [Source:MGI Symbol;Acc:MGI:3036251])

HSP 1 Score: 69.707 bits (169), Expect = 3.820e-14
Identity = 42/122 (34.43%), Postives = 72/122 (59.02%), Query Frame = 1
Query:  118 LSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            L FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  +LL+ ++     K FT+ +E        ++E + ++  E    S + IN  I+  VA TG
Sbjct:    2 LPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCERCSVLLLEDIESPVVK-FTKSFELMSPKCSADAENSFKESVEKSSYSDWLINNSIAELVASTG 122          
BLAST of Phosphodiesterase vs. Ensembl Mouse
Match: Pde6c (phosphodiesterase 6C, cGMP specific, cone, alpha prime [Source:MGI Symbol;Acc:MGI:105956])

HSP 1 Score: 54.299 bits (129), Expect = 8.973e-9
Identity = 32/103 (31.07%), Postives = 54/103 (52.43%), Query Frame = 1
Query:   28 VLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKD 336
            VL V   VNK+ +     F+ +D +VF  YLSF  + +R         +E+RR+Q+L+  A  +FEE + ++R   K +   ++ L C+R  I L+     K+
Sbjct:  190 VLAVVMAVNKISAPE---FSKQDEEVFSKYLSFVAVALRLQHTSYLYSVESRRSQILMWSANKVFEELTDVERQFHKALYTIRTYLNCDRYSIGLLDMTKEKE 289          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|Q9VJ79|PDE11_DROME (Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4)

HSP 1 Score: 172.555 bits (436), Expect = 3.943e-49
Identity = 86/157 (54.78%), Postives = 117/157 (74.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKDSSG V+GV QV+NK+   N   F+  D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ H QSL+QC+RVQILL   V+  D   F+R++++  ++++ E+     S   SRFPINIGI+G+VA TG
Sbjct:  529 MPIKDSSGDVIGVAQVINKM---NGECFSEIDEKVFSSYLQFCGIGLRNAQLYEKSQLEIKRNQVLLDLARMIFEEQSTIEHMVFRILTHMQSLIQCQRVQILL---VHEADKGSFSRVFDFEANDLSEEEATSRTSPYESRFPINIGITGHVATTG 679          

HSP 2 Score: 49.2914 bits (116), Expect = 3.422e-6
Identity = 28/94 (29.79%), Postives = 47/94 (50.00%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL----ARLIFEEQSFMKRLMFKIMMH 270
            M IK+S G ++GV Q++NK    N+  F   D    E++  FCGM I N  +Y ++ +   +  V L++    A    +E   ++RL     +H
Sbjct:  711 MAIKNSLGQIIGVIQLINKF---NELDFTKNDENFVEAFAIFCGMGIHNTHMYEKAIVAMAKQSVTLEVLSYHASATMDEAHRLRRLRVPSAVH 801          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|B4JXX2|PDE6_DROGR (cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila grimshawi OX=7222 GN=Pde6 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.328e-24
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPI +  G ++GV Q++NK     +  F+  DV++F  YL+FCG+ I+NAQ++  S  E RRNQ+LL+LAR IFEEQ+ ++ L+ KIM   + LL+CER  + LV
Sbjct:  304 MPICNYEGDIIGVAQIINKTNGCME--FDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLV 406          

HSP 2 Score: 50.0618 bits (118), Expect = 1.731e-6
Identity = 24/68 (35.29%), Postives = 39/68 (57.35%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLD 204
            MPI ++   V+GV Q++NK    N   F+  DV +FE++  FCG+ I N Q+Y  +     + +V L+
Sbjct:  521 MPIVNAQKTVIGVAQLINKA---NGLPFSESDVSIFEAFAIFCGLGIHNTQMYENACKLMAKQKVALE 585          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|B4LVU6|PDE6_DROVI (cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila virilis OX=7244 GN=Pde6 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.883e-24
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPI +  G ++GV Q++NK     +  F+  DV++F  YL+FCG+ I+NAQ++  S  E RRNQ+LL+LAR IFEEQ+ ++ L+ KIM   + LL+CER  + LV
Sbjct:  129 MPICNYEGDIIGVAQIINKTNGCME--FDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLV 231          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|B4K9L4|PDE6_DROMO (cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila mojavensis OX=7230 GN=Pde6 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.051e-24
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPI +  G ++GV Q++NK     +  F+  DV++F  YL+FCG+ I+NAQ++  S  E RRNQ+LL+LAR IFEEQ+ ++ L+ KIM   + LL+CER  + LV
Sbjct:  349 MPICNYEGDIIGVAQIINKTNGCME--FDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLV 451          
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Match: sp|B4HEM4|PDE6_DROSE (cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila sechellia OX=7238 GN=Pde6 PE=3 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 4.159e-24
Identity = 49/105 (46.67%), Postives = 72/105 (68.57%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            MPI +  G ++GV Q++NK     +  F+  DV++F  YL+FCG+ I+NAQ++  S  E RRNQ+LL+LAR IFEEQ+ ++ L+ KIM   + LL+CER  + LV
Sbjct:  367 MPICNYEGDIIGVAQIINKTNGCME--FDEHDVEIFRRYLTFCGIGIQNAQLFEMSVQEYRRNQILLNLARSIFEEQNNLECLVTKIMTEARELLKCERCSVFLV 469          

HSP 2 Score: 48.521 bits (114), Expect = 6.160e-6
Identity = 21/56 (37.50%), Postives = 32/56 (57.14%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQS 168
            MPI ++   V+GV Q++NK    N   F   D  +FE++  FCG+ I N Q+Y  +
Sbjct:  581 MPIMNAQKKVIGVAQLINKA---NGVPFTDSDASIFEAFAIFCGLGIHNTQMYENA 633          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A2P8Z073 (GAF domain-containing protein OS=Blattella germanica OX=6973 GN=C0J52_14937 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 5.672e-49
Identity = 88/158 (55.70%), Postives = 118/158 (74.68%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIYEYNESEINTE--DLCESFGNSRFPINIGISGYVAKTG 465
            MPIKD +G V+GV QV+NK   +  + F   D KVF SYL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ HTQSL+QC+RVQ+LLV    HK +K  F+R++++  +++N E  D   S   SRFPINIGI+GYVA TG
Sbjct:  372 MPIKDFNGDVIGVAQVINK---QGDSSFTPTDEKVFSSYLQFCGIGLRNAQLYEKSQLEVKRNQVLLDLARMIFEEQSTIEHMVFRILTHTQSLIQCQRVQVLLV----HKASKGSFSRVFDFEANDLNGEENDARTSPFESRFPINIGITGYVATTG 522          
BLAST of Phosphodiesterase vs. TrEMBL
Match: T1JEP4 (GAF domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 5.623e-48
Identity = 88/158 (55.70%), Postives = 116/158 (73.42%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIYEYNESEINTE--DLCESFGNSRFPINIGISGYVAKTG 465
            MPIKD  G VLGV QV+NK+  +    F+  D KVF SYL FCG+ IRNAQIY +SQLE +RNQVLLDLAR+IFE+QS ++ ++++IM HTQSLL+CER Q+LLV    H+ +K  F+R+++  E+++  E  D+  S    RFPINIGISG+VA TG
Sbjct:  391 MPIKDVGGEVLGVAQVINKIGLKGDEPFDENDEKVFASYLQFCGIGIRNAQIYERSQLENKRNQVLLDLARMIFEKQSTIEHVVYRIMTHTQSLLRCERCQVLLV----HEASKGSFSRVFDLEENDLKNEETDVRTSPFEGRFPINIGISGHVATTG 544          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A4S2L480 (Phosphodiesterase OS=Temnothorax longispinosus OX=300112 GN=DBV15_02308 PE=3 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 6.531e-48
Identity = 86/158 (54.43%), Postives = 119/158 (75.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKD +G V+GV QV+NK+   N++ F  +D KVF  YL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ HTQSL+QC+RVQ+LLV    HK +K  F+R++++  +++  ED     S   SRFPIN+GI+GYVA TG
Sbjct:   26 MPIKDCNGDVIGVAQVINKLG--NESQFTTQDEKVFAGYLQFCGIGLRNAQLYEKSQLEVKRNQVLLDLARMIFEEQSTIEHMVFRILTHTQSLIQCQRVQVLLV----HKASKGSFSRVFDFEANDLAGEDSNSRTSPFESRFPINVGITGYVATTG 177          
BLAST of Phosphodiesterase vs. TrEMBL
Match: E0VX88 (Phosphodiesterase OS=Pediculus humanus subsp. corporis OX=121224 GN=8236183 PE=3 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.247e-47
Identity = 88/158 (55.70%), Postives = 117/158 (74.05%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIYEYNESEINTE--DLCESFGNSRFPINIGISGYVAKTG 465
            MPIKD +G VLGV QV+NK    N + F   D KVF SYL FCG+ ++NAQ+Y +SQLE +RNQVLLDLAR+IFEEQS M+ ++F+I+ HTQSL+QC+RVQ+LLV    H+ +K  F+R++++  S++  E  D   S   SRFPIN+GI+GYVA TG
Sbjct:  296 MPIKDINGDVLGVAQVINK---SNDSSFTQADEKVFSSYLQFCGIGLKNAQLYEKSQLEVKRNQVLLDLARMIFEEQSTMEHMVFRILTHTQSLIQCQRVQVLLV----HEASKGSFSRVFDFEASDLEVEENDARTSPFESRFPINVGITGYVATTG 446          
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A0J7KKA5 (Phosphodiesterase OS=Lasius niger OX=67767 GN=RF55_9563 PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.381e-47
Identity = 86/158 (54.43%), Postives = 119/158 (75.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIYEYNESEINTEDLCE--SFGNSRFPINIGISGYVAKTG 465
            MPIKD +G V+GV QV+NK+    +A F A+D K+F  YL FCG+ +RNAQ+Y +SQLE +RNQVLLDLAR+IFEEQS ++ ++F+I+ HTQSL+QC+RVQ+LLV    HK +K  F+R++++  +++  ED     S   SRFPIN+GI+GYVA TG
Sbjct:    1 MPIKDCNGDVIGVAQVINKL--GGEAQFTAQDEKIFAGYLQFCGIGLRNAQLYEKSQLEVKRNQVLLDLARMIFEEQSTIEHMVFRILTHTQSLIQCQRVQVLLV----HKASKGSFSRVFDFEANDLAGEDSDSRTSPFESRFPINVGITGYVATTG 152          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 97.8265 bits (242), Expect = 4.356e-24
Identity = 59/161 (36.65%), Postives = 94/161 (58.39%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI++S G ++GV Q +NK  S   A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  + L+ ++     K FT+ +E        ++E + +D  E    S + IN  I+  VA TG
Sbjct:  282 MPIRNSDGEIIGVAQAINK--SPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVK-FTKSFELLSPKCSADTENSFKDSMEKSSYSDWLINNSIAELVASTG 439          

HSP 2 Score: 48.521 bits (114), Expect = 6.115e-7
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  471 VPIWNSNHQIIGVAQVLNRLDGK---PFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 536          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde11a (phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-070912-207])

HSP 1 Score: 97.0561 bits (240), Expect = 7.638e-24
Identity = 59/161 (36.65%), Postives = 94/161 (58.39%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI++S G ++GV Q +NK  S   A F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  + L+ ++     K FT+ +E        ++E + +D  E    S + IN  I+  VA TG
Sbjct:  304 MPIRNSDGEIIGVAQAINK--SPGGALFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVK-FTKSFELLSPKCSADTENSFKDSMEKSSYSDWLINNSIAELVASTG 461          

HSP 2 Score: 47.3654 bits (111), Expect = 1.443e-6
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  493 VPIWNSNHQIIGVAQVLNRLDGKP---FDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 558          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde5ab (cGMP-specific 3',5'-cyclic phosphodiesterase-like [Source:NCBI gene;Acc:103024399])

HSP 1 Score: 93.2041 bits (230), Expect = 1.749e-22
Identity = 54/122 (44.26%), Postives = 73/122 (59.84%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV-GNVNHKDNKIFTRIYE 363
            MPIK+    V+GV Q +NK    N + F  +D K F SYL+F G+ + NAQ+Y  SQLE RRNQVLLDLA LIFEEQ  ++ L+ KI     S +Q +   +  V G  ++  + +F   YE
Sbjct:  232 MPIKNHREEVVGVAQAINKRCGEN-STFTEQDEKDFASYLAFSGIVLHNAQLYETSQLENRRNQVLLDLASLIFEEQQSLEVLLRKIAATILSFMQAQECTVFTVDGETSNAFSSVFHMEYE 352          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde5ab (cGMP-specific 3',5'-cyclic phosphodiesterase-like [Source:NCBI gene;Acc:103024399])

HSP 1 Score: 93.2041 bits (230), Expect = 1.778e-22
Identity = 54/122 (44.26%), Postives = 73/122 (59.84%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV-GNVNHKDNKIFTRIYE 363
            MPIK+    V+GV Q +NK    N + F  +D K F SYL+F G+ + NAQ+Y  SQLE RRNQVLLDLA LIFEEQ  ++ L+ KI     S +Q +   +  V G  ++  + +F   YE
Sbjct:  262 MPIKNHREEVVGVAQAINKRCGEN-STFTEQDEKDFASYLAFSGIVLHNAQLYETSQLENRRNQVLLDLASLIFEEQQSLEVLLRKIAATILSFMQAQECTVFTVDGETSNAFSSVFHMEYE 382          
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Match: pde5ab (cGMP-specific 3',5'-cyclic phosphodiesterase-like [Source:NCBI gene;Acc:103024399])

HSP 1 Score: 93.2041 bits (230), Expect = 1.778e-22
Identity = 54/122 (44.26%), Postives = 73/122 (59.84%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV-GNVNHKDNKIFTRIYE 363
            MPIK+    V+GV Q +NK    N + F  +D K F SYL+F G+ + NAQ+Y  SQLE RRNQVLLDLA LIFEEQ  ++ L+ KI     S +Q +   +  V G  ++  + +F   YE
Sbjct:  262 MPIKNHREEVVGVAQAINKRCGEN-STFTEQDEKDFASYLAFSGIVLHNAQLYETSQLENRRNQVLLDLASLIFEEQQSLEVLLRKIAATILSFMQAQECTVFTVDGETSNAFSSVFHMEYE 382          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde5ab (phosphodiesterase 5A, cGMP-specific, b [Source:ZFIN;Acc:ZDB-GENE-060824-4])

HSP 1 Score: 98.5969 bits (244), Expect = 5.556e-25
Identity = 50/121 (41.32%), Postives = 79/121 (65.29%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNK-IFTRIY 360
            +PIKD+ G ++GV Q +NK +  N+  F  +D + F +YL+FCG+ + NAQ+Y  S LE RRNQVLL+LA L+ EEQS ++ L+ +I+    S + C+R  + +      KD+  IF+R++
Sbjct:  223 LPIKDNKGEIVGVAQAINK-KGNNEGKFTEKDEREFGAYLAFCGIVLHNAQLYEDSLLENRRNQVLLELASLVCEEQSSLEELVGRIIDIILSFMPCQRCAVFIAD----KDSPNIFSRVF 338          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde6b (phosphodiesterase 6B, cGMP-specific, rod, beta [Source:ZFIN;Acc:ZDB-GENE-090421-2])

HSP 1 Score: 57.7658 bits (138), Expect = 6.304e-11
Identity = 36/103 (34.95%), Postives = 50/103 (48.54%), Query Frame = 1
Query:   28 VLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKD 336
            V+ V   VNKV   N   F A D +VF  YL F  + ++   +      ETRR QVLL  A  +FEE + ++R   K M   +  L CER  + L+     K+
Sbjct:  186 VVAVIMAVNKV---NGTAFTALDTEVFLKYLIFASVCLKTYYLSYMHACETRRGQVLLWAASKVFEELTDIERQFHKAMYTVRGYLNCERYSVGLLDMTKQKE 285          
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Match: pde10a (phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-040426-1115])

HSP 1 Score: 56.9954 bits (136), Expect = 1.256e-10
Identity = 39/161 (24.22%), Postives = 82/161 (50.93%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEIN------TEDLCESFGNSRFPINIGISGYVAKTG 465
            +P+  ++G +LGV ++  +     +  F  R  +V  + L++  + I   Q+      +T  N  LLD+++  F+    +  L+  IM++ ++L+  +R  +     V+HK+N++++ +++  E +        T+++       RF I  GI+G VAKTG
Sbjct:  138 LPLITANGDLLGVLELQRR---WGKEPFTIRHQEVATALLAWASVAIHQVQVSHGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF---QVDHKNNELYSDLFDIGEEKEGQPVFRKTKEI-----TCRFSIEKGIAGQVAKTG 287          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO39522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9Q1])

HSP 1 Score: 150.214 bits (378), Expect = 7.984e-43
Identity = 75/155 (48.39%), Postives = 99/155 (63.87%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPIKD  G V+GV QV+NK      + F   D ++F  YL FCG+ I NA++Y ++QLE RRNQVLLDLAR IFEEQ+ +  ++ KIMM TQSLLQCER  +LLV   +     +F + ++    +    D  +     RFPINIGI+G+VA TG
Sbjct:  240 MPIKDHDGEVIGVAQVINKTGKSTDSAFTIDDEQIFLKYLVFCGIGINNAELYERAQLEIRRNQVLLDLARTIFEEQTSLHNIVHKIMMITQSLLQCERCSVLLVDPTS---KTLFAQAFDLEAKDYLQNDDDDKTVEVRFPINIGITGHVATTG 391          

HSP 2 Score: 51.9878 bits (123), Expect = 1.482e-8
Identity = 25/69 (36.23%), Postives = 41/69 (59.42%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            MPIK++SG ++GV Q++NKV+      FN  D  +FE++  FCGM I +  +Y        + +V L++
Sbjct:  423 MPIKNASGDIIGVVQLLNKVDG---TPFNKNDENLFEAFAIFCGMAIHSTVMYENVNKAMAKRKVALEV 488          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO31088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYX3])

HSP 1 Score: 92.4337 bits (228), Expect = 9.939e-23
Identity = 46/122 (37.70%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  100 KVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            +VF+ YL+FC + I NAQ++  S+LE +RNQVLL LA+ IFEEQ+ +   +  I++  Q+LLQCER  + L+ +       +F++ ++    E   ED   S  +S + ++ GI+ +VA +G
Sbjct:  234 EVFKDYLTFCAIGITNAQLFETSELEFKRNQVLLQLAKSIFEEQTNVDDCVNNIIVQAQALLQCERCMVFLIDDSPGTQGVVFSKAFDIQFKE--DEDAVLSTPSSYWSVDTGIAFWVATSG 353          

HSP 2 Score: 43.8986 bits (102), Expect = 9.359e-6
Identity = 18/56 (32.14%), Postives = 35/56 (62.50%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQS 168
            MPI +    ++GV Q++NK++ +    F+  D  +FE++  FCG+ I N ++Y ++
Sbjct:  385 MPIYNREQNIIGVVQLMNKLDGK---PFSESDESIFEAFAIFCGLGINNTKLYEEA 437          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO43657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY89])

HSP 1 Score: 89.3521 bits (220), Expect = 1.306e-21
Identity = 45/117 (38.46%), Postives = 74/117 (63.25%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAG--FNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIF 348
            P+K++ G V+GV Q++NK    N  G  F   D KV + YL+FCG+ I NA+++  S +E  RN+ LL+L   IFEEQ+ +++++ KIM     LL+CE+  +LL+     + +++F
Sbjct:  143 PVKNNEGEVVGVAQIINK----NPGGVPFTKEDEKVCDMYLTFCGIGITNAKLFELSAIEFNRNRALLELVHDIFEEQTSLEKVVHKIMKRALGLLKCEKCSVLLLTQPELRFSRVF 255          

HSP 2 Score: 48.521 bits (114), Expect = 2.464e-7
Identity = 21/69 (30.43%), Postives = 42/69 (60.87%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            MPI+++   ++GV +++N+++++    F+  D  +FE++  FCG+ I N  IY Q      + QV L++
Sbjct:  328 MPIRNNKFEIIGVAELINRLDNK---PFDENDETLFEAFAIFCGLGIHNTMIYDQMARAKAKQQVALEV 393          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO44626 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVE3])

HSP 1 Score: 72.4034 bits (176), Expect = 1.363e-15
Identity = 45/154 (29.22%), Postives = 83/154 (53.90%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            PI  S+G ++G  ++   V    +  F+  D +VF SYL + G+++  A++Y       +  + LL++ R IF++   M  ++ KIM + Q+L+  +R  + LV N   K N+++ RI++   S  ++    +     RFP   G++GYVA +G
Sbjct:   60 PIVQSNGELVGTIELSRMV---GRDPFDEEDEEVFNSYLVWGGISLYYAEMYLHMHKHRKLTEFLLNVTRSIFQDIVSMDTVIMKIMNYAQTLVDADRTSLFLVDN---KTNELYARIFDIGGSLEDSRS-SQLQKEIRFPKTKGVAGYVATSG 206          
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Match: EDO32088 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW30])

HSP 1 Score: 68.9366 bits (167), Expect = 1.922e-14
Identity = 47/155 (30.32%), Postives = 79/155 (50.97%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNS-RFPINIGISGYVAKTG 465
            PI  S G ++GV ++V  + S     F   D ++  SYL +  + I +A+I +Q   +   N  LL++ R IF+E   M  ++ KIM   + L+  +R  + L   ++    ++F  ++     +   ED     GN  RFP++ GI+GYVA TG
Sbjct:   65 PIIQSDGTLVGVVELVKALGS---MPFEKEDEEILNSYLVWGSIAIHHAEISKQITKQKDLNTFLLNVVRSIFDEVCTMDTVIEKIMAFAKKLVNADRCSLFL---LDQASEELFANLF-----DDGNEDGSFRCGNEIRFPVSKGIAGYVACTG 208          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde11a (phosphodiesterase 11A [Source:NCBI gene;Acc:101163533])

HSP 1 Score: 94.7449 bits (234), Expect = 6.026e-23
Identity = 57/161 (35.40%), Postives = 93/161 (57.76%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEY------NESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPI +S G ++GV Q +NK  + N   F   D KV + YL FCG+ I NAQ++  S+ E  R++ LL++   +FEEQ+ +++++ KIM   Q+LL+CER  + L+ ++     + FT+ +E        ++E + +D  E    S + IN  I+  VA TG
Sbjct:  285 MPIHNSDGEIIGVAQAINK--TSNGELFTEDDEKVLQMYLPFCGIAISNAQLFAASRKEYDRSRALLEVVNDLFEEQTDLEKIVRKIMHRAQTLLKCERCSVQLLEDIESPVVR-FTKSFELLSPKCSADAESSFKDSMEKSSYSDWLINNRIAELVASTG 442          

HSP 2 Score: 48.521 bits (114), Expect = 5.922e-7
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            +PI +S+  ++GV QV+N+++ +    F+  D ++FE+++ FCG+ I N  +Y Q +    +  V LD+
Sbjct:  474 VPIWNSNHQIIGVAQVLNRLDGK---PFDDADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDV 539          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde5ab (phosphodiesterase 5A [Source:NCBI gene;Acc:101173207])

HSP 1 Score: 88.1965 bits (217), Expect = 1.022e-20
Identity = 46/105 (43.81%), Postives = 66/105 (62.86%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            +PIK+  G V+GV Q +NK    + A F  +D K F +YL+F G+ + NAQ+Y  SQLE +RN+VLLDLA LIFEEQ  ++ L+ KI     S +Q +   + + 
Sbjct:  250 LPIKNHRGEVVGVAQAINKTCGEDGA-FTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIA 353          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde5ab (phosphodiesterase 5A [Source:NCBI gene;Acc:101173207])

HSP 1 Score: 88.1965 bits (217), Expect = 1.151e-20
Identity = 46/105 (43.81%), Postives = 66/105 (62.86%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            +PIK+  G V+GV Q +NK    + A F  +D K F +YL+F G+ + NAQ+Y  SQLE +RN+VLLDLA LIFEEQ  ++ L+ KI     S +Q +   + + 
Sbjct:  213 LPIKNHRGEVVGVAQAINKTCGEDGA-FTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIA 316          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde5ab (phosphodiesterase 5A [Source:NCBI gene;Acc:101173207])

HSP 1 Score: 87.8113 bits (216), Expect = 1.257e-20
Identity = 46/105 (43.81%), Postives = 66/105 (62.86%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLV 315
            +PIK+  G V+GV Q +NK    + A F  +D K F +YL+F G+ + NAQ+Y  SQLE +RN+VLLDLA LIFEEQ  ++ L+ KI     S +Q +   + + 
Sbjct:  281 LPIKNHRGEVVGVAQAINKTCGEDGA-FTEQDQKDFSAYLAFSGIVLHNAQLYETSQLENKRNRVLLDLATLIFEEQQCLEVLLRKIAGTILSFMQAQACTVFIA 384          
BLAST of Phosphodiesterase vs. Ensembl Medaka
Match: pde6c (phosphodiesterase 6C [Source:NCBI gene;Acc:101163363])

HSP 1 Score: 53.1434 bits (126), Expect = 1.694e-8
Identity = 32/102 (31.37%), Postives = 53/102 (51.96%), Query Frame = 1
Query:   31 LGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKD 336
            LGV  ++NK+ +     F A D K+F  Y++F  +            +E+RR+QVLL  A  +FEE + ++R   K +   ++ LQCER  + L+     K+
Sbjct:  187 LGVVMMLNKIGAD---AFTAEDEKLFHKYMTFAQVITLQHYTTYMFNVESRRSQVLLWSASKVFEELTDIERQFHKALYTVRTYLQCERYSVGLLDMTKEKE 285          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000019038.1 (SMESG000019038.1)

HSP 1 Score: 285.419 bits (729), Expect = 7.609e-92
Identity = 140/155 (90.32%), Postives = 141/155 (90.97%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG 465
            MPIKDS             +ESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQS MKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG
Sbjct:  331 MPIKDS-------------IESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDLARLIFEEQSSMKRLMFKIMMHTQSLLQCERVQILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGYVAKTG 472          

HSP 2 Score: 51.2174 bits (121), Expect = 5.192e-8
Identity = 24/69 (34.78%), Postives = 39/69 (56.52%), Query Frame = 1
Query:    1 MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLDL 207
            MPIK S+G VL V Q+ NK++      F   D+ +FE++  FCG+ I N  +Y +      R ++ L++
Sbjct:  504 MPIKSSTGQVLSVCQLTNKIQGE---CFTQTDIYLFEAFGLFCGLGIHNTHMYEEITRAMARQRITLEV 569          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000026730.1 (SMESG000026730.1)

HSP 1 Score: 45.0542 bits (105), Expect = 6.253e-6
Identity = 24/67 (35.82%), Postives = 34/67 (50.75%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLD 204
            PI DSS  V+G  QV+NK+E      F+  D  + E+   FC + I N ++Y        R QV L+
Sbjct:  142 PIWDSSNHVIGAAQVINKLER----DFSKNDEDIMEAITIFCTVGITNCRLYEDMTKSNARAQVALE 204          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000026730.1 (SMESG000026730.1)

HSP 1 Score: 45.0542 bits (105), Expect = 6.673e-6
Identity = 24/67 (35.82%), Postives = 34/67 (50.75%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLD 204
            PI DSS  V+G  QV+NK+E      F+  D  + E+   FC + I N ++Y        R QV L+
Sbjct:  166 PIWDSSNHVIGAAQVINKLER----DFSKNDEDIMEAITIFCTVGITNCRLYEDMTKSNARAQVALE 228          
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000026730.1 (SMESG000026730.1)

HSP 1 Score: 45.0542 bits (105), Expect = 8.262e-6
Identity = 24/67 (35.82%), Postives = 34/67 (50.75%), Query Frame = 1
Query:    4 PIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNAQIYRQSQLETRRNQVLLD 204
            PI DSS  V+G  QV+NK+E      F+  D  + E+   FC + I N ++Y        R QV L+
Sbjct:  406 PIWDSSNHVIGAAQVINKLER----DFSKNDEDIMEAITIFCTVGITNCRLYEDMTKSNARAQVALE 468          
The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDE11A2.431e-2436.02phosphodiesterase 11A [Source:NCBI gene;Acc:50940][more]
PDE11A2.776e-2436.02phosphodiesterase 11A [Source:HGNC Symbol;Acc:HGNC... [more]
PDE5A1.885e-2246.67phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE5A1.948e-2246.67phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
PDE5A1.964e-2246.67phosphodiesterase 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pde-52.378e-733.68Probable 3',5'-cyclic phosphodiesterase pde-5 [So... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde113.633e-5054.78gene:FBgn0085370 transcript:FBtr0343831[more]
Pde113.633e-5054.78gene:FBgn0085370 transcript:FBtr0112545[more]
Pde113.933e-5054.78gene:FBgn0085370 transcript:FBtr0112544[more]
Pde113.933e-5054.78gene:FBgn0085370 transcript:FBtr0343830[more]
Pde114.686e-5054.78gene:FBgn0085370 transcript:FBtr0303162[more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a1.447e-2337.27phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde11al2.515e-2235.22phosphodiesterase 11a, like [Source:ZFIN;Acc:ZDB-G... [more]
pde11a2.693e-2136.65phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde5ab6.618e-2135.80phosphodiesterase 5A, cGMP-specific, b [Source:ZFI... [more]
pde5ab6.882e-2145.19phosphodiesterase 5A, cGMP-specific, b [Source:ZFI... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde5a2.689e-2437.11phosphodiesterase 5A [Source:NCBI gene;Acc:780273][more]
ENSXETT00000053056.11.223e-2336.02phosphodiesterase 11A [Source:NCBI gene;Acc:100379... [more]
pde5a2.951e-2338.46phosphodiesterase 5A [Source:NCBI gene;Acc:780273][more]
pde5a3.634e-2338.46phosphodiesterase 5A [Source:NCBI gene;Acc:780273][more]
pde5a3.819e-2338.46phosphodiesterase 5A [Source:NCBI gene;Acc:780273][more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pde11a9.497e-2536.65phosphodiesterase 11A [Source:MGI Symbol;Acc:MGI:3... [more]
Pde5a4.191e-2339.16phosphodiesterase 5A, cGMP-specific [Source:MGI Sy... [more]
Pde5a4.683e-2339.16phosphodiesterase 5A, cGMP-specific [Source:MGI Sy... [more]
Pde11a3.820e-1434.43phosphodiesterase 11A [Source:MGI Symbol;Acc:MGI:3... [more]
Pde6c8.973e-931.07phosphodiesterase 6C, cGMP specific, cone, alpha p... [more]
back to top
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VJ79|PDE11_DROME3.943e-4954.78Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 1... [more]
sp|B4JXX2|PDE6_DROGR3.328e-2446.67cGMP-specific 3',5'-cyclic phosphodiesterase OS=Dr... [more]
sp|B4LVU6|PDE6_DROVI3.883e-2446.67cGMP-specific 3',5'-cyclic phosphodiesterase OS=Dr... [more]
sp|B4K9L4|PDE6_DROMO4.051e-2446.67cGMP-specific 3',5'-cyclic phosphodiesterase OS=Dr... [more]
sp|B4HEM4|PDE6_DROSE4.159e-2446.67cGMP-specific 3',5'-cyclic phosphodiesterase OS=Dr... [more]
back to top
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P8Z0735.672e-4955.70GAF domain-containing protein OS=Blattella germani... [more]
T1JEP45.623e-4855.70GAF domain-containing protein OS=Strigamia maritim... [more]
A0A4S2L4806.531e-4854.43Phosphodiesterase OS=Temnothorax longispinosus OX=... [more]
E0VX881.247e-4755.70Phosphodiesterase OS=Pediculus humanus subsp. corp... [more]
A0A0J7KKA51.381e-4754.43Phosphodiesterase OS=Lasius niger OX=67767 GN=RF55... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a4.356e-2436.65phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde11a7.638e-2436.65phosphodiesterase 11a [Source:ZFIN;Acc:ZDB-GENE-07... [more]
pde5ab1.749e-2244.26cGMP-specific 3',5'-cyclic phosphodiesterase-like ... [more]
pde5ab1.778e-2244.26cGMP-specific 3',5'-cyclic phosphodiesterase-like ... [more]
pde5ab1.778e-2244.26cGMP-specific 3',5'-cyclic phosphodiesterase-like ... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pde5ab5.556e-2541.32phosphodiesterase 5A, cGMP-specific, b [Source:ZFI... [more]
pde6b6.304e-1134.95phosphodiesterase 6B, cGMP-specific, rod, beta [So... [more]
pde10a1.256e-1024.22phosphodiesterase 10A [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO395227.984e-4348.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310889.939e-2337.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436571.306e-2138.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO446261.363e-1529.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320881.922e-1430.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde11a6.026e-2335.40phosphodiesterase 11A [Source:NCBI gene;Acc:101163... [more]
pde5ab1.022e-2043.81phosphodiesterase 5A [Source:NCBI gene;Acc:1011732... [more]
pde5ab1.151e-2043.81phosphodiesterase 5A [Source:NCBI gene;Acc:1011732... [more]
pde5ab1.257e-2043.81phosphodiesterase 5A [Source:NCBI gene;Acc:1011732... [more]
pde6c1.694e-831.37phosphodiesterase 6C [Source:NCBI gene;Acc:1011633... [more]
back to top
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000019038.17.609e-9290.32SMESG000019038.1[more]
SMESG000026730.16.253e-635.82SMESG000026730.1[more]
SMESG000026730.16.673e-635.82SMESG000026730.1[more]
SMESG000026730.18.262e-635.82SMESG000026730.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005765 ID=SMED30005765|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=466bp
ATGCCAATTAAAGATAGCAGTGGAGCAGTTCTCGGGGTCACCCAAGTTGT
AAATAAAGTCGAGAGTAGGAACCAGGCCGGATTCAATGCACGAGATGTCA
AGGTGTTTGAAAGCTATTTAAGTTTCTGTGGTATGAACATTAGAAACGCC
CAAATCTATCGACAATCACAACTGGAAACGAGACGAAATCAAGTTTTGCT
CGATCTCGCTCGACTTATCTTCGAAGAACAATCTTTTATGAAGAGATTAA
TGTTTAAAATTATGATGCATACTCAGAGTTTGCTTCAATGTGAACGGGTC
CAGATTTTGTTGGTTGGGAATGTGAACCACAAGGATAATAAAATCTTCAC
TCGAATCTATGAATATAATGAATCAGAAATTAATACAGAGGATTTGTGTG
AGTCTTTTGGGAATTCACGATTTCCTATTAATATAGGCATCAGTGGCTAT
GTGGCCAAAACTGGCG
back to top

protein sequence of SMED30005765-orf-1

>SMED30005765-orf-1 ID=SMED30005765-orf-1|Name=SMED30005765-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=155bp
MPIKDSSGAVLGVTQVVNKVESRNQAGFNARDVKVFESYLSFCGMNIRNA
QIYRQSQLETRRNQVLLDLARLIFEEQSFMKRLMFKIMMHTQSLLQCERV
QILLVGNVNHKDNKIFTRIYEYNESEINTEDLCESFGNSRFPINIGISGY
VAKTG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR029016GAF-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:00041143',5'-cyclic-nucleotide phosphodiesterase activity
GO:0008081phosphoric diester hydrolase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction