Contactin/TAG-1 cell adhesion molecule

Overview
NameContactin/TAG-1 cell adhesion molecule
Smed IDSMED30005762
Length (bp)4197
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Contactin/TAG-1 cell adhesion molecule (SMED30005762) t-SNE clustered cells

Violin plots show distribution of expression levels for Contactin/TAG-1 cell adhesion molecule (SMED30005762) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Contactin/TAG-1 cell adhesion molecule (SMED30005762) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Contactin/TAG-1 cell adhesion molecule (SMED30005762) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005762

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005762SMESG000036495.1 Contig3005GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005762SMESG000036495.1 dd_Smed_v4_2673_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Match: CNTN2 (contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172])

HSP 1 Score: 310.457 bits (794), Expect = 1.776e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Match: CNTN2 (contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172])

HSP 1 Score: 310.457 bits (794), Expect = 1.776e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Match: CNTN2 (contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172])

HSP 1 Score: 310.457 bits (794), Expect = 1.776e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Match: CNTN2 (contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172])

HSP 1 Score: 310.457 bits (794), Expect = 1.776e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Match: CNTN2 (contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172])

HSP 1 Score: 308.916 bits (790), Expect = 8.366e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Match: lad-2 (L1 CAM ADhesion molecule homolog [Source:UniProtKB/TrEMBL;Acc:H2L0R2])

HSP 1 Score: 147.902 bits (372), Expect = 1.638e-35
Identity = 207/870 (23.79%), Postives = 341/870 (39.20%), Query Frame = 1
Query:  850 LIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGT---YKCMVGWRGLTGTSYKSPD-IPLEVFASNTLYPPPNVHDKFPNFKPSNPFL--GDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVI------TDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKN--QYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--ESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRR--VQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYF-GTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGI------GEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWS-DVSNITSASKLPSYAPQDVHANS-FNSTAINVDWKAPAIGSGEGPIQGYHIVYW 3375
            +ID+      K +Q+G ++    P  +      C   N +GTA+S ++ +  G LE + K   +LLR+ +     L+C PP   P   IV+ +   R  D   V++ +     R+      N G + FS   + D      Y+C      L G  Y+S D I L++  S     P     K  +  PS   +  G  +  +C   G     PL   FW   +  LP   +       +DF R + + N+  +D G Y C      GR  +  +V + + A P +   P      P+  S+  L C A G+P  I+ W  N   F   LA++   R     G +   L V N     D  +  CN  N  G    +AF+ ++  +  P F      + + ++ ++ ++ C  + +P   + W  D     L      QV+   +       PN+   + +V ++D+G Y C  +N  G   ++  L V         P  +R  ++      + C+A   P L I Y W             ++ +   +SQ    YY      L+  +++        C   T  +V  +S  +Q+I        +  T         V+W    DHG  I  Y +E+  +    +W  + E +N   +   T + ++    +V        N+  R+ A NS G       G+P       +T    P   P  V G G +   LVI W+PL     N  N  Y +RYK  + I   T    +  SL N     +  D P  + Y+   +QV++ N +GP     ++ +  S   +P  AP+D H ++  N T IN  W      +  G   GY I YW
Sbjct:   72 VIDSEDVLWEKESQSGSIV-FTKPHASHQGYYQCFASNIFGTALSNKMHLRLGSLEHFPKRDVKLLRVKEGESLTLNCTPPRGTPDPKIVWLY---RSLDDSSVIETI-----RSRHITVDNEGHLHFSSVELSDGKATLVYECAATSPVLRG-EYRSGDRIQLDIEPSQDKSHPV----KKMSVSPSEVTVRAGGQLKLQCIFGG----RPLPTIFWSKIDGELPKSRIKDLTSHESDFGRSLIVENVHPDDAGAYECR-----GR-HLVHTVNVRVMAAPFWEFDPPRDISLPE-ESTGELECLAGGQPTPIITWSMNG-KFLHELAED-SRRVLLDHGRI---LRVRNLNHDLDTGVYQCNASNPLGYVFANAFVHVR--AHAPFFRMPAARHWKVVLHSTVVLDCDVDAAPEAMVRWV-DADDRPL------QVVEGKNKL----FPNHTFMVYDVNSADEGLYYCNVSNKYGINRATNRLQVFKPTYFVRIPTPKRLILEAGETAEVFCEAVADPRLPIRYQW------------TINGKVLTESQ----YYEILPDRLRFRSVRGRHSGIIDCAAITDVDVKLAS--MQLIVKDVPAHPVVETAHCSERKATVKWVAASDHGDSIKKYIVEMFTDFKKNEWEVINEEVN---VNKETFEVDITLTPWV--------NYTFRVVAVNSHGRSDMKIDGQPKEDWLTCQTRPSFPYTNPTGVKGEGTEPDNLVISWKPLDRYYWNAPNMQYLVRYKLDEPIHGWT-EFLVEDSLAN---FTIIRDQPTFRKYL---IQVQSVNSVGPSIVEPEIHHGWSGEDVPDEAPRDFHIDTQINFTTINFTWNPVDANTVNGHFVGYEIEYW 862          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Match: rig-4 (pep chromosome:WBcel235:IV:7991410:8004136:-1 gene:WBGene00004371.1 transcript:Y42H9B.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rig-4)

HSP 1 Score: 148.288 bits (373), Expect = 2.266e-35
Identity = 187/813 (23.00%), Postives = 326/813 (40.10%), Query Frame = 1
Query: 1534 RRVTLNNIQFEDEGVY--SCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPR--------YNFTEGNVSVALLVINGVK--------TTDNAMIGCNIY-----------------NIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVE--WTDGYDHGQPILWYRLEVAKEDGT---QKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQV-TWNGVRVMPEEESVDGYRIRYWLSGAP-VRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNG 3846
            RR+ ++N      G +   C  +   GR S  +S  ++  ++P     P      VGSS++L C    K  + ++WY+N +  ++   K    R        Y     N + A L    VK         T+ +  G ++                  N   +E  F     +       K P   T A      ++ C   GSP P I W  +G ++      ++             L N+ L I ++  SD+G Y C  + S  KA  +A + V     +   P  ++  + TNV   C+ A         +WY  +V L  +           +  +R      G+L I  +   +   Y CRVT      ++SA++Q+I  P +   +        +   V   W +G+D  +PI+ + +E+     T     W    + I K + KP    +          +L  ++    R+ A+N  G G+PS PS        PP  AP+NV        +++++W+      ++GD   Y +RY+    +   ++  +  K+L     R   +D      + ++++QV A N  G G +S+   +T++   P+ AP++V     NSTA+ +++ AP      G   GY + +W +    K +      L+  +R       LT+ V+  L    +Y +    F T GD   S+ V   T +  P+   ++  L+     +   V TWN    + +   V  Y IR+W + +P V+T  +VD G      I+ LQ   RY + V A +R G+G
Sbjct:  282 RRLIISNPSSFTRGEHKLECRADAAMGRTSDQKSAYMTFISRPILKDLPNEIQKTVGSSLSLKCSVKKKSSMDIKWYKNGLMMTTQRGKLTIDRIKQDDFGLYQCEATNAAGADLASVWVKEGEANETVATEMSEDGMSLEEEISMETPPPRKLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGTDRIMMECAATGSPPPNIIWLLNGHEIQTDNVKYD-------------LTNDGLAIHDIRKSDEGEYTCEISGSNVKA--TANVQVNGDSLIEYGPADQKSLIGTNVEFSCEVAKEYVRKASVEWYLNDVLLPVN----------GNSGLRISRNRKGSLIIRQVGPDNTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMPAKVRVRWNEGFDGNEPIIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTD--------IEDLRPSSTAEFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYR----LAGYSSLTWNEKNLTTKDARNTLVDELIT--WREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNSTAVAIEFTAPEQQRIPGVNLGYKVQFW-KGEPEKGELYKQVILDPDRRQ------LTT-VVNELEKFGHYNLTTLCFTTPGDGPRSNVVKVVTEEDTPE---SVDELSIAEVMYNGAVITWNS--PLKQNGIVTKYTIRHWAASSPDVKTKHEVD-GSTTNFTIDGLQPSTRYGVDVMASTRKGDG 1041          

HSP 2 Score: 59.3066 bits (142), Expect = 2.364e-8
Identity = 62/241 (25.73%), Postives = 110/241 (45.64%), Query Frame = 1
Query: 3169 QVQVRATNIMGPGPWSDVS-NITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTN-TPHQIQVTWNGVRVMPEEESVDG----YRIRYWLSGAPVRTALDVDVGL-----KITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            + +V A+N  GPG  S  S ++T   + PS AP++V A++ +  ++ V W+ P      G + GY + Y +         A Y  L  +++  L      + ++  L+    Y I V  +N  G  + S  ++ TT +  P   P  VR+   N T   I+ T       PE++ + G    Y++++W  G P +  L   V L     ++T ++N L+    YN+    ++  G+G  SN
Sbjct:  725 EFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYRL---------AGYSSLTWNEK-NLTTKDARNTLVDELITWREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNSTAVAIEFT------APEQQRIPGVNLGYKVQFW-KGEPEKGELYKQVILDPDRRQLTTVVNELEKFGHYNLTTLCFTTPGDGPRSN 948          

HSP 3 Score: 58.151 bits (139), Expect = 5.130e-8
Identity = 82/379 (21.64%), Postives = 160/379 (42.22%), Query Frame = 1
Query: 2791 LIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPX--XXXXXXXXXXXLVIRWEPLLP--LEENGDN--FAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSN-ITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFV-DQTTFKKPPQNFPTIVR--LNSTNTPHQIQVTWNGVRVMPEE--ESVDGYRIRYWLSGAPVRTALDVDVGLKITG---LINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFM 3876
            L+ N  +F+   L  NT +   + A NS G  E +    +  +  +P + AP     T    +   ++IRW+  LP  L E+ ++   A ++ Y+++ E EWIT    + K  +  K R V   L  N     F+ ++R         WS  S  + +    P   P  + A  +   ++ ++W  P   +      GY I Y    S+   Q       +  +            ++  L +  +Y + +++FN+ G+   S+ V     +  P +N   I+   L+S++    I+V W+     P+E  E++  +++RY    + + +    +  + +      +N+L+    Y + V  Y+R G GK+S   D+ +
Sbjct: 1413 LLGNLLMFAAMSLNPNTQYTFAIKARNSKGESEEAVAEVMTSSVRLPVRNAPAPVRDTLSQHQATEIIIRWDESLPRKLTEDAESPVRAVQVSYQKTNEDEWIT----LEKKFEYSKRRSVIKHLSPNS---MFRFRIRFIGDFLESSWSPESEWMRTLPSAPFAQPISLKATPYERNSVQLEWVVPHKSTWNSDAIGYRIHYREYPSNETWQMEEIAIRDEHE-------DKEEKILAKLDSFKHYILRMRIFNSEGEGPFSAPVFAYVGYSIPKRNLNNIITEPLSSSS----IRVKWDA---WPKEDSETITSFKVRYVPVASVLSSVSSEEEIMIVDTNECTLNDLRKFTEYQISVSPYNRAGEGKMSQVRDKTL 1770          

HSP 4 Score: 56.225 bits (134), Expect = 1.957e-7
Identity = 69/316 (21.84%), Postives = 118/316 (37.34%), Query Frame = 1
Query: 2833 TNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLES----SFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTW------NGVRVMPEEESVDGYRIRYWLSGAPVRTALDV 3750
            T ++LRL A N  G G PS PS  F+T    P    + +        ++ + W PLL    NG    Y I Y+E  +  W        K +     R     +   + +  ++V V + N  G    +D     +   +PS +P+++   +  S A  + W   A  S  G + GY +     V + +S  A   ++     + + G       +  L     Y + +  +   G+  E+    SF        PP++F       S  +  ++++ W      NG         +  Y I YW S  P   A+D 
Sbjct: 1125 TQYQLRLIAENVKGRGAPSEPSRSFETLQTNPDTPSQRLFAEPVSATSISVSWTPLLATHWNGQPKGYLIVYREIDDENW--------KEVRTPALRSSEHTVTDLRPFTSYEVNVFSENGFGRSLPTDSVKARTYESVPSGSPRNIVVTAEGSKAAIIKWNPVAELSTNGDVIGYKLRV---VPERESLMADETKV-----IDIPGQSTLMAKVSDLRPFTSYHVYMSAYTIVGNGPENSTPISFETMEDVPAPPESFQC-----SYISEQEVRMKWLPPGSPNG--------KITNYIISYWKSHEPRSMAIDA 1411          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Match: rig-4 (pep chromosome:WBcel235:IV:7991410:8004119:-1 gene:WBGene00004371.1 transcript:Y42H9B.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rig-4)

HSP 1 Score: 148.288 bits (373), Expect = 2.266e-35
Identity = 187/813 (23.00%), Postives = 326/813 (40.10%), Query Frame = 1
Query: 1534 RRVTLNNIQFEDEGVY--SCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPR--------YNFTEGNVSVALLVINGVK--------TTDNAMIGCNIY-----------------NIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVE--WTDGYDHGQPILWYRLEVAKEDGT---QKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQV-TWNGVRVMPEEESVDGYRIRYWLSGAP-VRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNG 3846
            RR+ ++N      G +   C  +   GR S  +S  ++  ++P     P      VGSS++L C    K  + ++WY+N +  ++   K    R        Y     N + A L    VK         T+ +  G ++                  N   +E  F     +       K P   T A      ++ C   GSP P I W  +G ++      ++             L N+ L I ++  SD+G Y C  + S  KA  +A + V     +   P  ++  + TNV   C+ A         +WY  +V L  +           +  +R      G+L I  +   +   Y CRVT      ++SA++Q+I  P +   +        +   V   W +G+D  +PI+ + +E+     T     W    + I K + KP    +          +L  ++    R+ A+N  G G+PS PS        PP  AP+NV        +++++W+      ++GD   Y +RY+    +   ++  +  K+L     R   +D      + ++++QV A N  G G +S+   +T++   P+ AP++V     NSTA+ +++ AP      G   GY + +W +    K +      L+  +R       LT+ V+  L    +Y +    F T GD   S+ V   T +  P+   ++  L+     +   V TWN    + +   V  Y IR+W + +P V+T  +VD G      I+ LQ   RY + V A +R G+G
Sbjct:  282 RRLIISNPSSFTRGEHKLECRADAAMGRTSDQKSAYMTFISRPILKDLPNEIQKTVGSSLSLKCSVKKKSSMDIKWYKNGLMMTTQRGKLTIDRIKQDDFGLYQCEATNAAGADLASVWVKEGEANETVATEMSEDGMSLEEEISMETPPPRKLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGTDRIMMECAATGSPPPNIIWLLNGHEIQTDNVKYD-------------LTNDGLAIHDIRKSDEGEYTCEISGSNVKA--TANVQVNGDSLIEYGPADQKSLIGTNVEFSCEVAKEYVRKASVEWYLNDVLLPVN----------GNSGLRISRNRKGSLIIRQVGPDNTGEYRCRVTVDGREENASAMLQIIEKPAMPERVRAELHNETMPAKVRVRWNEGFDGNEPIIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTD--------IEDLRPSSTAEFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYR----LAGYSSLTWNEKNLTTKDARNTLVDELIT--WREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNSTAVAIEFTAPEQQRIPGVNLGYKVQFW-KGEPEKGELYKQVILDPDRRQ------LTT-VVNELEKFGHYNLTTLCFTTPGDGPRSNVVKVVTEEDTPE---SVDELSIAEVMYNGAVITWNS--PLKQNGIVTKYTIRHWAASSPDVKTKHEVD-GSTTNFTIDGLQPSTRYGVDVMASTRKGDG 1041          

HSP 2 Score: 59.3066 bits (142), Expect = 2.364e-8
Identity = 62/241 (25.73%), Postives = 110/241 (45.64%), Query Frame = 1
Query: 3169 QVQVRATNIMGPGPWSDVS-NITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTN-TPHQIQVTWNGVRVMPEEESVDG----YRIRYWLSGAPVRTALDVDVGL-----KITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            + +V A+N  GPG  S  S ++T   + PS AP++V A++ +  ++ V W+ P      G + GY + Y +         A Y  L  +++  L      + ++  L+    Y I V  +N  G  + S  ++ TT +  P   P  VR+   N T   I+ T       PE++ + G    Y++++W  G P +  L   V L     ++T ++N L+    YN+    ++  G+G  SN
Sbjct:  725 EFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYRL---------AGYSSLTWNEK-NLTTKDARNTLVDELITWREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNSTAVAIEFT------APEQQRIPGVNLGYKVQFW-KGEPEKGELYKQVILDPDRRQLTTVVNELEKFGHYNLTTLCFTTPGDGPRSN 948          

HSP 3 Score: 58.151 bits (139), Expect = 5.130e-8
Identity = 82/379 (21.64%), Postives = 160/379 (42.22%), Query Frame = 1
Query: 2791 LIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPX--XXXXXXXXXXXLVIRWEPLLP--LEENGDN--FAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSN-ITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFV-DQTTFKKPPQNFPTIVR--LNSTNTPHQIQVTWNGVRVMPEE--ESVDGYRIRYWLSGAPVRTALDVDVGLKITG---LINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFM 3876
            L+ N  +F+   L  NT +   + A NS G  E +    +  +  +P + AP     T    +   ++IRW+  LP  L E+ ++   A ++ Y+++ E EWIT    + K  +  K R V   L  N     F+ ++R         WS  S  + +    P   P  + A  +   ++ ++W  P   +      GY I Y    S+   Q       +  +            ++  L +  +Y + +++FN+ G+   S+ V     +  P +N   I+   L+S++    I+V W+     P+E  E++  +++RY    + + +    +  + +      +N+L+    Y + V  Y+R G GK+S   D+ +
Sbjct: 1413 LLGNLLMFAAMSLNPNTQYTFAIKARNSKGESEEAVAEVMTSSVRLPVRNAPAPVRDTLSQHQATEIIIRWDESLPRKLTEDAESPVRAVQVSYQKTNEDEWIT----LEKKFEYSKRRSVIKHLSPNS---MFRFRIRFIGDFLESSWSPESEWMRTLPSAPFAQPISLKATPYERNSVQLEWVVPHKSTWNSDAIGYRIHYREYPSNETWQMEEIAIRDEHE-------DKEEKILAKLDSFKHYILRMRIFNSEGEGPFSAPVFAYVGYSIPKRNLNNIITEPLSSSS----IRVKWDA---WPKEDSETITSFKVRYVPVASVLSSVSSEEEIMIVDTNECTLNDLRKFTEYQISVSPYNRAGEGKMSQVRDKTL 1770          

HSP 4 Score: 56.225 bits (134), Expect = 1.957e-7
Identity = 69/316 (21.84%), Postives = 118/316 (37.34%), Query Frame = 1
Query: 2833 TNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLES----SFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTW------NGVRVMPEEESVDGYRIRYWLSGAPVRTALDV 3750
            T ++LRL A N  G G PS PS  F+T    P    + +        ++ + W PLL    NG    Y I Y+E  +  W        K +     R     +   + +  ++V V + N  G    +D     +   +PS +P+++   +  S A  + W   A  S  G + GY +     V + +S  A   ++     + + G       +  L     Y + +  +   G+  E+    SF        PP++F       S  +  ++++ W      NG         +  Y I YW S  P   A+D 
Sbjct: 1125 TQYQLRLIAENVKGRGAPSEPSRSFETLQTNPDTPSQRLFAEPVSATSISVSWTPLLATHWNGQPKGYLIVYREIDDENW--------KEVRTPALRSSEHTVTDLRPFTSYEVNVFSENGFGRSLPTDSVKARTYESVPSGSPRNIVVTAEGSKAAIIKWNPVAELSTNGDVIGYKLRV---VPERESLMADETKV-----IDIPGQSTLMAKVSDLRPFTSYHVYMSAYTIVGNGPENSTPISFETMEDVPAPPESFQC-----SYISEQEVRMKWLPPGSPNG--------KITNYIISYWKSHEPRSMAIDA 1411          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Match: sax-3 (pep chromosome:WBcel235:X:3451945:3465925:-1 gene:WBGene00004729.1 transcript:ZK377.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sax-3)

HSP 1 Score: 119.783 bits (299), Expect = 7.746e-27
Identity = 133/552 (24.09%), Postives = 218/552 (39.49%), Query Frame = 1
Query:  673 DLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWY------FTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKID---CQVQNDYGTAISRQVQIIRGRL-EIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLP-PKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYR---NEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKE--SAFIELKTVSLVPNFDKYP-------LLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            D +N+   P I++ P D +    VS     T  C    +    ++WY       T        R ++D  S           LL +N   N  D+      C   N++G   S +  +    L E +   PR +  +      +L+C PP   P+  + +     RK+DK   + D+ +  L ++       G +        DSGTY+C+     + G    +P   L VF        P         K     +G  V+F+C   G+ +    +  WK  N+P+P  +A I    R + +  +Q  DEG Y C      G  ++  S  L + A P+F  KP +Q    G + T  C  VG+P     W +    ++ F S+++ +   + + T        L I  V+  D     C   N  G     A +++ T ++  N    P         N   ++G+S I+PCQ  G PTP I+W +DG  + ++ S            R+      +L I +++  D G Y C A N  G++  SA L V
Sbjct:   25 DASNL--APVIIEHPIDVV----VSRGSPATLNCGAKPS-TAKITWYKDGQPVITNKEQVNSHRIVLDTGSLF---------LLKVNSGKNGKDSDAGAYYCVASNEHGEVKSNEGSLKLAMLREDFRVRPRTVQALGGEMA-VLECSPPRGFPEPVVSW-----RKDDKELRIQDMPRYTLHSD-------GNLIIDPVDRSDSGTYQCVA--NNMVGERVSNP-ARLSVFEKPKFEQEP---------KDMTVDVGAAVLFDCRVTGDPQP---QITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARNPAG--TLEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPAYFWSKEGQQDLLFPSYVSADGRTKVSPT------GTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGISWLRDGLPIDITDS------------RISQHSTGSLHIADLKKPDTGVYTCIAKNEDGESTWSASLTV 512          

HSP 2 Score: 102.449 bits (254), Expect = 1.716e-21
Identity = 104/395 (26.33%), Postives = 153/395 (38.73%), Query Frame = 1
Query: 1414 GDTVIFECFGYGEIKQNPLKYF------WKWNNKPLPPKAVITDFER-------RVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPV-----------GRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTC 2526
            G+  + EC        +P + F      W+ ++K L     I D  R        + ++ +   D G Y C    M G   ++    LS+  KP F  +PK+   DVG++V   C+  G PQ  + W R   P        P  R    + N     L I  V+ +D     C   N  G   A   L+ V   P+F   P   +    GT+T   C   G P+P   W+K+G Q  L PS     + A   T++   P   L I+ V   D+G Y C   NS G + S A L V       N P             + + V ++  LPCQA+G P   I   W  + + +       D+R    S          G+L I +++  D   YTC
Sbjct:  147 GEMAVLEC--------SPPRGFPEPVVSWRKDDKEL----RIQDMPRYTLHSDGNLIIDPVDRSDSGTYQCVANNMVGE-RVSNPARLSVFEKPKFEQEPKDMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPM-------PVTRAYIAKDNRG---LRIERVQPSDEGEYVCYARNPAGTLEASAHLR-VQAPPSFQTKPADQSVPAGGTATF-ECTLVGQPSPAYFWSKEGQQDLLFPS----YVSADGRTKVS--PTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGI--SWLRDGLPIDI----TDSRISQHST---------GSLHIADLKKPDTGVYTC 495          

HSP 3 Score: 73.9442 bits (180), Expect = 7.579e-13
Identity = 81/328 (24.70%), Postives = 127/328 (38.72%), Query Frame = 1
Query: 1552 NIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQA-VGKPQVIMQWYRNEIPFSSWLAKNPDPRYNF-TEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTC 2526
            N +  D G Y C      G V S   S+ L++  +  F V+P+      G    L C    G P+ ++ W +++      L     PRY   ++GN     L+I+ V  +D+    C   N+ G+  +     +V   P F++ P  +    +G + +  C+  G P P ITW +    + ++ +               +  N  L I+ V+ SD+G Y C A N  G   +SA+L V    +    P  + V         C   G P     Y W  E       + DL    Y  S   R      GTL I  ++  DE  Y C
Sbjct:   99 NGKDSDAGAYYCVASNEHGEVKSNEGSLKLAM-LREDFRVRPRTVQALGGEMAVLECSPPRGFPEPVVSWRKDD----KELRIQDMPRYTLHSDGN-----LIIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPK-DMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPMPVTRA-------------YIAKDNRGLRIERVQPSDEGEYVCYARNPAGTLEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQP--SPAYFWSKEG------QQDLLFPSY-VSADGRTKVSPTGTLTIEEVRQVDEGAYVC 393          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Match: sax-3 (pep chromosome:WBcel235:X:3451945:3465925:-1 gene:WBGene00004729.1 transcript:ZK377.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:sax-3)

HSP 1 Score: 119.783 bits (299), Expect = 7.896e-27
Identity = 133/552 (24.09%), Postives = 218/552 (39.49%), Query Frame = 1
Query:  673 DLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWY------FTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKID---CQVQNDYGTAISRQVQIIRGRL-EIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLP-PKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYR---NEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKE--SAFIELKTVSLVPNFDKYP-------LLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            D +N+   P I++ P D +    VS     T  C    +    ++WY       T        R ++D  S           LL +N   N  D+      C   N++G   S +  +    L E +   PR +  +      +L+C PP   P+  + +     RK+DK   + D+ +  L ++       G +        DSGTY+C+     + G    +P   L VF        P         K     +G  V+F+C   G+ +    +  WK  N+P+P  +A I    R + +  +Q  DEG Y C      G  ++  S  L + A P+F  KP +Q    G + T  C  VG+P     W +    ++ F S+++ +   + + T        L I  V+  D     C   N  G     A +++ T ++  N    P         N   ++G+S I+PCQ  G PTP I+W +DG  + ++ S            R+      +L I +++  D G Y C A N  G++  SA L V
Sbjct:   25 DASNL--APVIIEHPIDVV----VSRGSPATLNCGAKPS-TAKITWYKDGQPVITNKEQVNSHRIVLDTGSLF---------LLKVNSGKNGKDSDAGAYYCVASNEHGEVKSNEGSLKLAMLREDFRVRPRTVQALGGEMA-VLECSPPRGFPEPVVSW-----RKDDKELRIQDMPRYTLHSD-------GNLIIDPVDRSDSGTYQCVA--NNMVGERVSNP-ARLSVFEKPKFEQEP---------KDMTVDVGAAVLFDCRVTGDPQP---QITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARNPAG--TLEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQPSPAYFWSKEGQQDLLFPSYVSADGRTKVSPT------GTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGISWLRDGLPIDITDS------------RISQHSTGSLHIADLKKPDTGVYTCIAKNEDGESTWSASLTV 512          

HSP 2 Score: 102.449 bits (254), Expect = 1.778e-21
Identity = 106/395 (26.84%), Postives = 154/395 (38.99%), Query Frame = 1
Query: 1414 GDTVIFECFGYGEIKQNPLKYF------WKWNNKPLPPKAVITDFER-------RVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPV--------GRRVQ---VNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTC 2526
            G+  + EC        +P + F      W+ ++K L     I D  R        + ++ +   D G Y C    M G   ++    LS+  KP F  +PK+   DVG++V   C+  G PQ  + W R   P        P  R    + N     L I  V+ +D     C   N  G   A   L+ V   P+F   P   +    GT+T   C   G P+P   W+K+G Q  L PS     + A   T++   P   L I+ V   D+G Y C   NS G + S A L V       N P         G + Q   V ++  LPCQA+G P   I   W  + + +       D+R    S          G+L I +++  D   YTC
Sbjct:  147 GEMAVLEC--------SPPRGFPEPVVSWRKDDKEL----RIQDMPRYTLHSDGNLIIDPVDRSDSGTYQCVANNMVGE-RVSNPARLSVFEKPKFEQEPKDMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPM-------PVTRAYIAKDNRG---LRIERVQPSDEGEYVCYARNPAGTLEASAHLR-VQAPPSFQTKPADQSVPAGGTATF-ECTLVGQPSPAYFWSKEGQQDLLFPS----YVSADGRTKVS--PTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKAALKVTTKAVTGNTPAKPPPTIEHGHQNQTLMVGSSAILPCQASGKPTPGI--SWLRDGLPIDI----TDSRISQHST---------GSLHIADLKKPDTGVYTC 495          

HSP 3 Score: 74.3294 bits (181), Expect = 6.796e-13
Identity = 81/328 (24.70%), Postives = 127/328 (38.72%), Query Frame = 1
Query: 1552 NIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQA-VGKPQVIMQWYRNEIPFSSWLAKNPDPRYNF-TEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTC 2526
            N +  D G Y C      G V S   S+ L++  +  F V+P+      G    L C    G P+ ++ W +++      L     PRY   ++GN     L+I+ V  +D+    C   N+ G+  +     +V   P F++ P  +    +G + +  C+  G P P ITW +    + ++ +               +  N  L I+ V+ SD+G Y C A N  G   +SA+L V    +    P  + V         C   G P     Y W  E       + DL    Y  S   R      GTL I  ++  DE  Y C
Sbjct:   99 NGKDSDAGAYYCVASNEHGEVKSNEGSLKLAM-LREDFRVRPRTVQALGGEMAVLECSPPRGFPEPVVSWRKDD----KELRIQDMPRYTLHSDGN-----LIIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPK-DMTVDVGAAVLFDCRVTGDPQPQITWKRKNEPMPVTRA-------------YIAKDNRGLRIERVQPSDEGEYVCYARNPAGTLEASAHLRVQAPPSFQTKPADQSVPAGGTATFECTLVGQP--SPAYFWSKEG------QQDLLFPSY-VSADGRTKVSPTGTLTIEEVRQVDEGAYVC 393          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Match: Cont (gene:FBgn0037240 transcript:FBtr0078917)

HSP 1 Score: 402.134 bits (1032), Expect = 1.578e-117
Identity = 372/1313 (28.33%), Postives = 572/1313 (43.56%), Query Frame = 1
Query:  184 CPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSD--LLNNNAVNRS-IQWYTAGAM----DSQSTGRYIWDGFPPDLKT--FNTEL-------------------------IPLLIDVPDINNLVAW----------NKDRSKIVYIYYNMK--WMLNLTTPTDNNYFICESPKSVITKTVSMS----RSADFGQ--SDLTNIKRGPCILDQPTDQLYAPQVSNSKL---VTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGR-LEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDP------RYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTN-VYLPCQAAGTPYLDIDYDWYFENVRLKFD-----RMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGE---GPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALD--VDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSR 3894
            CP  W S+   CY+F  SP  N+ +++  C    A L+ ++++ +H F     +L N   NR  I     G +    D  +    I D F  D +    N +L                         +P  ++  + NNL  +             R ++VY +   +  WM       + N FICES     +  V++     R   +G   +D+  I RGP  + QP D  +   V+ ++L   VT +C   G P P+ +WY         +   ID L+    + T +GG L I +P    D     C  +N +G   S    +  G  +E   K   +   M  N G  + C+PP H P       +Y  R      V +D         +F+S + G + FS     D   Y C V    ++ T    P  PL V   N+ Y      + FP   P  P  GD +  EC  +G     P+  Y W     PL   A   ++ R + + N    D G YSC I   + R ++ +S+ ++I  +P F +  K+   D  S VT  C+A   P     WY+N        A+  DP      RY   +  +++  L     K  D+AM  C   N      +  +L+ +S+ P+F K+PL +   A+   +T I C PE +P P   W KDG           QVIG+    R+  LP+  L I      D+G Y C A+N  G   S A + V+  +     P  R V    + ++L C+AA    LDI Y W      LK +     R+ +D  R                L ++N    D  +Y C V +  N ISS   + + G PG  GG+ V  +    + ++EW DG  +G+ I +Y + + + +  + W  +   +   ++   T      R Q     L   + +   + A N  GIG PS PS ++ T    P  AP+NV GGGGK+G L I W+PLLP E++     Y++ +K    IEW  A++ I K    D      +++P N  Y +++V+V+A N +G GP S+++ I SA  +P  APQ   A ++NST  NV W+ P   S E   G + G+ + YW      K+     D +    R T         +I+GL  D YY + V  +N AG+  ES   ++ T++K PQ  P+ V +   N P  ++V W  V    +EE V+GY++R W S   + TA +  V +G K+   INNL     YNMRV AYS GG+G++S+P   F +   +R
Sbjct:  139 CPEHWVSFRQTCYRFIRSPKRNWAEAKKICKAHNADLINVDNVEKHSFILKNLILQNQRQNRFFISARQTGPLNWVNDDNTQLVQIEDSFSMDEQVPLENEDLHDNRFLVQNDLNNQNINNPNQFYNSLPGTVNQRNQNNLRGFIGPNQPYGDNRYVRDRVVYAFSKKRDRWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDINDMERIPRGPYFVKQPNDTTF--DVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLA--QDRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLKRSAETSEM--NWGKSIFCDPPQHYPD----VRYYWARDYFPNFVEED-------QRVFVSRD-GALYFSFIETVDRANYSCTVQ-TLVSDTGRNGPFFPLRV-TPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGY----PIPSYNWTRQGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTI--TNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYNSDVTFICEAFAIPDANYTWYKN--------AERLDPANINRDRYIIQDNVLTIKFLE----KDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDG-----------QVIGSGGHRRI--LPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNR----------------LTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKA-IIEWVDGSHNGRAIRYYNI-LGRTNWNRTWVNVSTHVQAREVDRYTS-----RQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEW--ASDEIKKQ---DHMGVAVVNIPLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQ-PIDMSRENIRGKLIGHRLKYW------KTTHQEEDSVYYLSRTT-----RNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGIN-PSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYNMRVLAYSNGGDGRMSSPTLHFQMGKTTR 1359          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0302259)

HSP 1 Score: 187.193 bits (474), Expect = 3.062e-47
Identity = 203/785 (25.86%), Postives = 313/785 (39.87%), Query Frame = 1
Query: 1528 FERRVTLNNIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQ-YPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVD-CTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXX--XXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWY-PLKERINKTDIKPITKQNNLIRNQ--FVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYK--ESKEIEWITANNFINKSLDNDKYRQVTL-DLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFAYSRGGNG 3846
            + R + L        G Y+C +    G   +++ S  L I   P F    + + + + G  V LTC  VG+P   ++W+RN     + +      RY     N     LVI  +   D AM  C   N  G+ SA   L+  +  P  +  P  N  A+ G    I C+  GSP P ITW  + +QL             VD  +R+  L + +L I N+ + D G Y C   N  G     AYL V+    +   PV   V +     L C+ +  P +  + DWY E                  S   R   +  G L+I  ++  D  +Y C VT+P    + +A + VI    P     +   P     S  V WT G+D   PI  + ++  +    +K+  P+ + +    +  IT+ +N+  +Q   +   L A T ++ R+ A N  G G PS PS V +     P   P    G    +  ++ +W+P L    NG    Y +RY+      + W   N      + N+  R   + +L   KDYI   VQ+ A N MG G +++ S I +   +P   P +V   + NSTA    W  P      G  QGY I  W R            R+ T     +      + ++ GL     Y I V  F   GD + SS V   T    P    T +  +  +    ++V W   R       + GY +RY +   P  T    ++    T L +N LQ    Y   + A++R G+G
Sbjct:  317 WNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESG---RYTLNTDNT----LVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIME-LPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQL-------------VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREG-----------QSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPL----LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQN------ITNEAQRNFLIQELITWKDYI---VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEV-TGLHFDDVSD-RSVKVLWAPPRA--SNGILTGYTVRYQVKDRP-DTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSG 1051          

HSP 2 Score: 78.1814 bits (191), Expect = 6.338e-14
Identity = 67/246 (27.24%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 2635 SNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVY 3372
            S V+++T G+D    I  +++E  +      W+ + E IN  D + +T            + L   T +RLRL A+N  G  +PS  ++ F+T    P+  P NVT        L +RW PL   E  G+   Y I YK+   ++      ++ +S+  + +   +  L + +++  ++V++ A N +G    SD +   +   +PSY P DV AN+ +ST + V W         G I GY + Y
Sbjct: 1082 SVVLQFTPGFDGNSSITKWKVE-GQTARNMTWFTICE-INDPDAETLT-----------VTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQL--VKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFY 1312          

HSP 3 Score: 75.0998 bits (183), Expect = 5.348e-13
Identity = 92/395 (23.29%), Postives = 159/395 (40.25%), Query Frame = 1
Query: 2650 WTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGD--NFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFA 3825
            WT G D   P+ +Y +E+ + +G  +W PL ER++ +             + F    L     ++ R+ A N  G    S  S + +T    P      +        ++ ++W  L     NGD     Y I Y++  +      +         ++   V  DL  +++Y   ++ V   N  GPGP +  + +     +P+  P+ V A   +ST + + WK P      G I GY I Y +  S    QA    R    + + +     TS  ++ L     Y I +  FN AGD   S+ +   T    P + P  +R +   T   ++VTW+  + +  E  + GY + Y  +    + +  V   +  T L + NL+ +V Y   V A
Sbjct: 1494 WTPGRDGFAPLRYYTVEMRENEG--RWQPLPERVDPS------------LSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNY---EIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYS---PQALEPGR-KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVP-SAPLHLRFSDI-TMQSLEVTWDPPKFLNGE--ILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFTVRA 1863          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0070132)

HSP 1 Score: 187.193 bits (474), Expect = 3.062e-47
Identity = 203/785 (25.86%), Postives = 313/785 (39.87%), Query Frame = 1
Query: 1528 FERRVTLNNIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQ-YPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVD-CTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXX--XXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWY-PLKERINKTDIKPITKQNNLIRNQ--FVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYK--ESKEIEWITANNFINKSLDNDKYRQVTL-DLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFAYSRGGNG 3846
            + R + L        G Y+C +    G   +++ S  L I   P F    + + + + G  V LTC  VG+P   ++W+RN     + +      RY     N     LVI  +   D AM  C   N  G+ SA   L+  +  P  +  P  N  A+ G    I C+  GSP P ITW  + +QL             VD  +R+  L + +L I N+ + D G Y C   N  G     AYL V+    +   PV   V +     L C+ +  P +  + DWY E                  S   R   +  G L+I  ++  D  +Y C VT+P    + +A + VI    P     +   P     S  V WT G+D   PI  + ++  +    +K+  P+ + +    +  IT+ +N+  +Q   +   L A T ++ R+ A N  G G PS PS V +     P   P    G    +  ++ +W+P L    NG    Y +RY+      + W   N      + N+  R   + +L   KDYI   VQ+ A N MG G +++ S I +   +P   P +V   + NSTA    W  P      G  QGY I  W R            R+ T     +      + ++ GL     Y I V  F   GD + SS V   T    P    T +  +  +    ++V W   R       + GY +RY +   P  T    ++    T L +N LQ    Y   + A++R G+G
Sbjct:  317 WNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESG---RYTLNTDNT----LVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIME-LPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQL-------------VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREG-----------QSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPL----LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQN------ITNEAQRNFLIQELITWKDYI---VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEV-TGLHFDDVSD-RSVKVLWAPPRA--SNGILTGYTVRYQVKDRP-DTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSG 1051          

HSP 2 Score: 78.1814 bits (191), Expect = 6.338e-14
Identity = 67/246 (27.24%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 2635 SNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVY 3372
            S V+++T G+D    I  +++E  +      W+ + E IN  D + +T            + L   T +RLRL A+N  G  +PS  ++ F+T    P+  P NVT        L +RW PL   E  G+   Y I YK+   ++      ++ +S+  + +   +  L + +++  ++V++ A N +G    SD +   +   +PSY P DV AN+ +ST + V W         G I GY + Y
Sbjct: 1082 SVVLQFTPGFDGNSSITKWKVE-GQTARNMTWFTICE-INDPDAETLT-----------VTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQL--VKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFY 1312          

HSP 3 Score: 75.0998 bits (183), Expect = 5.348e-13
Identity = 92/395 (23.29%), Postives = 159/395 (40.25%), Query Frame = 1
Query: 2650 WTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGD--NFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFA 3825
            WT G D   P+ +Y +E+ + +G  +W PL ER++ +             + F    L     ++ R+ A N  G    S  S + +T    P      +        ++ ++W  L     NGD     Y I Y++  +      +         ++   V  DL  +++Y   ++ V   N  GPGP +  + +     +P+  P+ V A   +ST + + WK P      G I GY I Y +  S    QA    R    + + +     TS  ++ L     Y I +  FN AGD   S+ +   T    P + P  +R +   T   ++VTW+  + +  E  + GY + Y  +    + +  V   +  T L + NL+ +V Y   V A
Sbjct: 1494 WTPGRDGFAPLRYYTVEMRENEG--RWQPLPERVDPS------------LSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNY---EIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYS---PQALEPGR-KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVP-SAPLHLRFSDI-TMQSLEVTWDPPKFLNGE--ILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFTVRA 1863          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0070130)

HSP 1 Score: 187.193 bits (474), Expect = 3.062e-47
Identity = 203/785 (25.86%), Postives = 313/785 (39.87%), Query Frame = 1
Query: 1528 FERRVTLNNIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQ-YPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVD-CTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXX--XXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWY-PLKERINKTDIKPITKQNNLIRNQ--FVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYK--ESKEIEWITANNFINKSLDNDKYRQVTL-DLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFAYSRGGNG 3846
            + R + L        G Y+C +    G   +++ S  L I   P F    + + + + G  V LTC  VG+P   ++W+RN     + +      RY     N     LVI  +   D AM  C   N  G+ SA   L+  +  P  +  P  N  A+ G    I C+  GSP P ITW  + +QL             VD  +R+  L + +L I N+ + D G Y C   N  G     AYL V+    +   PV   V +     L C+ +  P +  + DWY E                  S   R   +  G L+I  ++  D  +Y C VT+P    + +A + VI    P     +   P     S  V WT G+D   PI  + ++  +    +K+  P+ + +    +  IT+ +N+  +Q   +   L A T ++ R+ A N  G G PS PS V +     P   P    G    +  ++ +W+P L    NG    Y +RY+      + W   N      + N+  R   + +L   KDYI   VQ+ A N MG G +++ S I +   +P   P +V   + NSTA    W  P      G  QGY I  W R            R+ T     +      + ++ GL     Y I V  F   GD + SS V   T    P    T +  +  +    ++V W   R       + GY +RY +   P  T    ++    T L +N LQ    Y   + A++R G+G
Sbjct:  317 WNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESG---RYTLNTDNT----LVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIME-LPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQL-------------VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREG-----------QSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPL----LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQN------ITNEAQRNFLIQELITWKDYI---VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEV-TGLHFDDVSD-RSVKVLWAPPRA--SNGILTGYTVRYQVKDRP-DTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSG 1051          

HSP 2 Score: 78.1814 bits (191), Expect = 6.338e-14
Identity = 67/246 (27.24%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 2635 SNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVY 3372
            S V+++T G+D    I  +++E  +      W+ + E IN  D + +T            + L   T +RLRL A+N  G  +PS  ++ F+T    P+  P NVT        L +RW PL   E  G+   Y I YK+   ++      ++ +S+  + +   +  L + +++  ++V++ A N +G    SD +   +   +PSY P DV AN+ +ST + V W         G I GY + Y
Sbjct: 1082 SVVLQFTPGFDGNSSITKWKVE-GQTARNMTWFTICE-INDPDAETLT-----------VTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQL--VKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFY 1312          

HSP 3 Score: 75.0998 bits (183), Expect = 5.348e-13
Identity = 92/395 (23.29%), Postives = 159/395 (40.25%), Query Frame = 1
Query: 2650 WTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGD--NFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFA 3825
            WT G D   P+ +Y +E+ + +G  +W PL ER++ +             + F    L     ++ R+ A N  G    S  S + +T    P      +        ++ ++W  L     NGD     Y I Y++  +      +         ++   V  DL  +++Y   ++ V   N  GPGP +  + +     +P+  P+ V A   +ST + + WK P      G I GY I Y +  S    QA    R    + + +     TS  ++ L     Y I +  FN AGD   S+ +   T    P + P  +R +   T   ++VTW+  + +  E  + GY + Y  +    + +  V   +  T L + NL+ +V Y   V A
Sbjct: 1494 WTPGRDGFAPLRYYTVEMRENEG--RWQPLPERVDPS------------LSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNY---EIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYS---PQALEPGR-KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVP-SAPLHLRFSDI-TMQSLEVTWDPPKFLNGE--ILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFTVRA 1863          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Match: sdk (gene:FBgn0021764 transcript:FBtr0070133)

HSP 1 Score: 187.193 bits (474), Expect = 3.062e-47
Identity = 203/785 (25.86%), Postives = 313/785 (39.87%), Query Frame = 1
Query: 1528 FERRVTLNNIQFEDEGVYSCNIETMDGRV-SIARSVTLSINAKPTFVVKPKNQ-YPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVD-CTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXX--XXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWY-PLKERINKTDIKPITKQNNLIRNQ--FVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYK--ESKEIEWITANNFINKSLDNDKYRQVTL-DLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFAYSRGGNG 3846
            + R + L        G Y+C +    G   +++ S  L I   P F    + + + + G  V LTC  VG+P   ++W+RN     + +      RY     N     LVI  +   D AM  C   N  G+ SA   L+  +  P  +  P  N  A+ G    I C+  GSP P ITW  + +QL             VD  +R+  L + +L I N+ + D G Y C   N  G     AYL V+    +   PV   V +     L C+ +  P +  + DWY E                  S   R   +  G L+I  ++  D  +Y C VT+P    + +A + VI    P     +   P     S  V WT G+D   PI  + ++  +    +K+  P+ + +    +  IT+ +N+  +Q   +   L A T ++ R+ A N  G G PS PS V +     P   P    G    +  ++ +W+P L    NG    Y +RY+      + W   N      + N+  R   + +L   KDYI   VQ+ A N MG G +++ S I +   +P   P +V   + NSTA    W  P      G  QGY I  W R            R+ T     +      + ++ GL     Y I V  F   GD + SS V   T    P    T +  +  +    ++V W   R       + GY +RY +   P  T    ++    T L +N LQ    Y   + A++R G+G
Sbjct:  317 WNRTLALLQANSSHSGEYTCQVRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRNAESVDAHIESG---RYTLNTDNT----LVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIME-LPPQNVTALDGKDATISCRAVGSPNPNITWIYNETQL-------------VDISSRVQILESGDLLISNIRSVDAGLYICVRANEAGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREG-----------QSSTPISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPL----LNWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQN------ITNEAQRNFLIQELITWKDYI---VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGINQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTDPGDGVASSQVAVMTMDDVPDEV-TGLHFDDVSD-RSVKVLWAPPRA--SNGILTGYTVRYQVKDRP-DTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSG 1051          

HSP 2 Score: 78.1814 bits (191), Expect = 6.338e-14
Identity = 67/246 (27.24%), Postives = 115/246 (46.75%), Query Frame = 1
Query: 2635 SNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVY 3372
            S V+++T G+D    I  +++E  +      W+ + E IN  D + +T            + L   T +RLRL A+N  G  +PS  ++ F+T    P+  P NVT        L +RW PL   E  G+   Y I YK+   ++      ++ +S+  + +   +  L + +++  ++V++ A N +G    SD +   +   +PSY P DV AN+ +ST + V W         G I GY + Y
Sbjct: 1082 SVVLQFTPGFDGNSSITKWKVE-GQTARNMTWFTICE-INDPDAETLT-----------VTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQL--VKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFY 1312          

HSP 3 Score: 75.0998 bits (183), Expect = 5.348e-13
Identity = 92/395 (23.29%), Postives = 159/395 (40.25%), Query Frame = 1
Query: 2650 WTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGD--NFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGL-INNLQYDVRYNMRVFA 3825
            WT G D   P+ +Y +E+ + +G  +W PL ER++ +             + F    L     ++ R+ A N  G    S  S + +T    P      +        ++ ++W  L     NGD     Y I Y++  +      +         ++   V  DL  +++Y   ++ V   N  GPGP +  + +     +P+  P+ V A   +ST + + WK P      G I GY I Y +  S    QA    R    + + +     TS  ++ L     Y I +  FN AGD   S+ +   T    P + P  +R +   T   ++VTW+  + +  E  + GY + Y  +    + +  V   +  T L + NL+ +V Y   V A
Sbjct: 1494 WTPGRDGFAPLRYYTVEMRENEG--RWQPLPERVDPS------------LSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLPAAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPKTDVHGINENSVVLSDLQQDRNY---EIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYS---PQALEPGR-KWEEEIEVVSATATSHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVP-SAPLHLRFSDI-TMQSLEVTWDPPKFLNGE--ILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFTVRA 1863          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Match: cntn3a.1 (contactin 3a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-081030-10])

HSP 1 Score: 290.041 bits (741), Expect = 4.957e-81
Identity = 281/1060 (26.51%), Postives = 441/1060 (41.60%), Query Frame = 1
Query:  697 PCILDQPTDQLYAPQVSN-SKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKW-NNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPL-LNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            P    QP   ++   ++  S+ VTF+C   G P P+  W    D+   PQ            + + +GG L I+  +   D  I  C   N +GT +SR+  +    LE +    R  +R+ +  G +L C PP +  + +  + F         E    V Q   R   F+S   G +  +     D G Y C+V    +T    + P  PL + +   +    P +  +FP         G TV  ECF  G    NP+    W+  +  P P K  ++     + +   Q ED G Y C  E   G+ +      LS  A P  V KP++    +  S+   C+A  KP+   +W +N  P  S+     + R     G +S++ L +     +D  M  C   N  G+  A  EL+ +++ P+F    L   T A  G   +I C+P  SP   I+W K    L              +  R+  L N +L I N+   D G Y C A N  G A+S+  L V     +T+      V V  +V +PCQ +  P LD+ + W+F    + F              F +      G + I NIQ      YTC V T  +  S +  + V+  P           V   ++ V W+ G D+  P+  Y +++         + L  +  KT  + +  Q +  R      EL     +  R+ A NS G GEP+ PS+  +T    P+  P  V+GGGG    LVI WEP+   ++ G  F Y + ++      W+ A      S D  +Y      +P    +  F V+V   N  G GP+  V+ I SA + PS AP  + A S +++ + V WK     +    I GY + YW          ++ DR +T+  +    G  TS VI GL     Y I ++ +N+AG   +S+ V+ TT + PP   P  V  N+T++  ++ + W+ V+ +  E  V GY++ Y  S    R      V    T L  +L  D  Y +++   S GG G  S 
Sbjct:   26 PVFTKQPGSIVFPLHLNEPSREVTFSCEAQGRPPPSYRWKMN-DSFISPQ---------PGSRYSISGGNLRISQLNKEEDAGIYQCLASNSFGTILSREASLHIAYLEEFKTQMRSPVRVREGQGVVLLCGPPAYMGELTFSWIF--------NEYPSFVEQDTRR---FVSQKTGNLYIAKVEPSDVGNYTCVVT-NTVTQNRVQGPPTPLILRSDGIMGEYEPKIEVQFPEVLAVAK--GLTVKLECFALG----NPVPAISWRRPDGVPFPRKVDVSKSSGVLEIPYFQQEDAGPYECVAENSRGKNT--GKGRLSFYAPPHLVEKPQDVQRAIDESLLWECKASAKPKPSYRWLKNGEPLESF-----EDRIQVINGALSISSLTL-----SDTGMYQCIAENRHGRVFANAELRVIAVAPDFSNSVLKAQTLARQGGDVLIECRPRMSPRGMISWRKGKEALR-------------ESHRVSVLDNGSLRISNITKLDAGLYTCVARNQFGVASSAGTLVVKEPTIITSKATQLDVTVGESVVIPCQVSRDPSLDVRFTWFFNEQLINFGSHG--------GYFEKVGGASAGDIMIRNIQLRHAGRYTCAVQTKVDSASIATDV-VVRGPPDPPLDIRVDEVTETTSFVSWSPGPDNHSPVFAYNIQIRSP------FSLGWQAAKTVPESLGGQQSSAR----VVELSPWVEYEFRVLATNSIGTGEPTKPSQKIRTKDTMPRITPARVSGGGGSRSELVITWEPVPEEQQAGPGFGYVVAFRPLGGQNWMQA---AVTSPDASRYIFKNDSIPP---FSPFHVKVGVYNNKGEGPFGPVTTIYSAEEEPSRAPSRIRAKSLSASEVEVSWKPLPWSTSRTRIMGYELRYW----------STKDRPDTASVMRTV-GNRTSAVIRGLDPSSTYNIKLKAYNSAGVGPDSAVVNVTTKRPPPSQSPVKVMWNTTDS--KLILKWDHVKALENESEVMGYKVMYKQS----RQTRPSVVETNSTSLELSLPVDEDYIIQIKPVSEGGEGSSSK 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Match: cntn3a.1 (contactin 3a, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-081030-10])

HSP 1 Score: 289.271 bits (739), Expect = 1.438e-80
Identity = 281/1060 (26.51%), Postives = 442/1060 (41.70%), Query Frame = 1
Query:  697 PCILDQPTDQLYAPQVSN-SKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKW-NNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPL-LNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            P    QP   ++   ++  S+ VTF+C   G P P+  W    D+   PQ            + + +GG L I+  +   D  I  C   N +GT +SR+  +    LE +    R  +R+ +  G +L C PP +  + +  + F         E    V Q   R   F+S   G +  +     D G Y C+V    +T    + P  PL + +   +    P +  +FP         G TV  ECF  G    NP+    W+  +  P P K  ++     + +   Q ED G Y C  E   G+ +      LS  A P  V KP++    +  S+   C+A  KP+   +W +N  P  S+     + R     G +S++ L +     +D  M  C   N  G+  A  EL+ +++ P+F    L   T A  G   +I C+P  SP   I+W K    L              +  R+  L N +L I N+   D G Y C A N  G A+S+  L V     +T+      V V  +V +PCQ +  P LD+ + W+F    + F              F +      G + I NIQ      YTC V T  +  S +  + V+  P           V   ++ V W+ G D+  P+  Y +++      +  + L  +  KT  + +  Q +  R      EL     +  R+ A NS G GEP+ PS+  +T    P+  P  V+GGGG    LVI WEP+   ++ G  F Y + ++      W+ A      S D  +Y      +P    +  F V+V   N  G GP+  V+ I SA + PS AP  + A S +++ + V WK     +    I GY + YW          ++ DR +T+  +    G  TS VI GL     Y I ++ +N+AG   +S+ V+ TT + PP   P  V  N+T++  ++ + W+ V+ +  E  V GY++ Y  S    R      V    T L  +L  D  Y +++   S GG G  S 
Sbjct:   26 PVFTKQPGSIVFPLHLNEPSREVTFSCEAQGRPPPSYRWKMN-DSFISPQ---------PGSRYSISGGNLRISQLNKEEDAGIYQCLASNSFGTILSREASLHIAYLEEFKTQMRSPVRVREGQGVVLLCGPPAYMGELTFSWIF--------NEYPSFVEQDTRR---FVSQKTGNLYIAKVEPSDVGNYTCVVT-NTVTQNRVQGPPTPLILRSDGIMGEYEPKIEVQFPEVLAVAK--GLTVKLECFALG----NPVPAISWRRPDGVPFPRKVDVSKSSGVLEIPYFQQEDAGPYECVAENSRGKNT--GKGRLSFYAPPHLVEKPQDVQRAIDESLLWECKASAKPKPSYRWLKNGEPLESF-----EDRIQVINGALSISSLTL-----SDTGMYQCIAENRHGRVFANAELRVIAVAPDFSNSVLKAQTLARQGGDVLIECRPRMSPRGMISWRKGKEALR-------------ESHRVSVLDNGSLRISNITKLDAGLYTCVARNQFGVASSAGTLVVKEPTIITSKATQLDVTVGESVVIPCQVSRDPSLDVRFTWFFNEQLINFGSHG--------GYFEKVGGASAGDIMIRNIQLRHAGRYTCAVQTKVDSASIATDV-VVRGPPDPPLDIRVDEVTETTSFVSWSPGPDNHSPVFAYNIQI------RSPFSLGWQAAKTVPESLGGQQSSAR----VVELSPWVEYEFRVLATNSIGTGEPTKPSQKIRTKDTMPRITPARVSGGGGSRSELVITWEPVPEEQQAGPGFGYVVAFRPLGGQNWMQA---AVTSPDASRYIFKNDSIPP---FSPFHVKVGVYNNKGEGPFGPVTTIYSAEEEPSRAPSRIRAKSLSASEVEVSWKPLPWSTSRTRIMGYELRYW----------STKDRPDTASVMRTV-GNRTSAVIRGLDPSSTYNIKLKAYNSAGVGPDSAVVNVTTKRPPPSQSPVKVMWNTTDS--KLILKWDHVKALENESEVMGYKVMYKQS----RQTRPSVVETNSTSLELSLPVDEDYIIQIKPVSEGGEGSSSK 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Match: cntn5 (contactin 5 [Source:NCBI gene;Acc:327429])

HSP 1 Score: 286.96 bits (733), Expect = 9.893e-80
Identity = 290/1083 (26.78%), Postives = 451/1083 (41.64%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTK---DTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKK----PPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKI 3912
            GP  + +P D +++   S+ K +   C   GNP PT SW       DT    + +LID             G L I++     D  +  C+ +N  G  +SR   +    L  ++   R  + + +  G +L C PP H P+  I+Y++         E+   V +   R   F+S   G +  S     D G+Y C V    +T     SP  PL +     +    P +   FP    +    G TV  ECF  G    NP+    W+  +  +P KA +   +  + + NIQ ED G Y C  E   G    A    L +   P ++    +   D G  +   C+A GKP+   +W RN  P S+        R     G      L I+ ++  D+ M  C   N +G   +  ELK ++  P F+  P+    A +G    + C+P  SP P I+W K+  +L  S              R+  L NN L I N   SD+G+Y C A N  G A  +  L V   + +  +P+   V V  +V L C+    P LD+ + W   N  L   + D     Y ++Q           L I +I       Y CR  T  + + + A + V GPPG  G + V  +  + +  + W+ G D+  PI  Y ++ A+   +  W  +     KTD  P+T          +  +L     +  R+ A NS G G+PS PS   +T    P  AP NV GG G+   LVI WEP+    +NG+ F Y + ++ +    W      +  S D+  Y+      P       F+V+V   N  G GP+S+V  + SA   P   P +V A + +S+ I V WK P+ G G    QGY + +W  V          + L   +R TL  G  T+ ++ GL  +  Y + V+ FN+AG    S+ V  +T K     PP N   I   N+      + ++W+ V+    E  V GY++     G      +        + ++  L     Y + V A S GG G  S  + + +     R +NG++
Sbjct:   56 GPVFIQEPDDAIFSLD-SDDKKIIMNCEARGNPVPTYSWLINGTNVDTEADFRYSLID-------------GNLIIHNASEVIDYGRYQCRAENSIGIVLSRDALLQFAYLGPFSGKTRGAVSVREGQGVVLMCAPPSHSPE--IIYSWVFN------ELPSFVAEDSRR---FISQETGNLYISKVQPSDVGSYVCQVK-NTVTNARVLSPPTPLTLKTDGVMGEYEPKIEAHFPQTVLAAK--GVTVRLECFALG----NPVPTITWRKMSGNIPKKARLRKSQAVLEIPNIQLEDSGSYECKAENTRG--GTAFRGHLQVYTLPQWISMINDTQLDSGEQLRWECRATGKPRPTYRWLRNGEPLST------QSRVEMVNGE-----LTIHRLQQADSGMYQCIAENKYGAIYSSAELKILASAPMFNNNPV-RLIATVGKDVSLECRPRASPKPRISWRKNDRRLQPS-------------RRIMLLRNNTLRIINSSRSDEGSYVCRAENQFGSAELTTVLLVKEPMRVELSPLRVEVTVGESVVLSCKVTHDPSLDVSFLWLLNNQPLN-TQQDGGHFEYIQTQ------SSTADLMIRSILLKHAGKYGCRAQTSADSVLAEAELLVRGPPGAPGVVIVEEITASTA-TLSWSHGVDNHSPITTYNVQ-ARSPVSLGWQTV-----KTDPDPVTGS----MESAMAVDLNPWVEYEFRVVATNSIGTGDPSPPSRAVRTKEAVPSVAPANVRGGNGRRHELVISWEPVSEEYQNGEGFGYIVAFRVNGTRGW---KEKMVTSADSTTYKYRDETFPP---LTPFEVRVGVYNNKGDGPFSEVVTVFSAEGEPREPPSEVQAFAVSSSEIKVLWKPPSPGLGRP--QGYEVSFWKDVEQ--------EELGKKKR-TL--GNETNMLLSGLDGNTQYLVSVKGFNSAGQGPSSTAVKISTKKNAPSLPPGNLMWIQEGNN------VSLSWDPVKARDNESEVIGYKVLLRQEGRGHSQVMRT----PNSAVVLTLPEGGTYIIEVRAVSEGGEGAASAQV-RVLTSSGVRAKNGQL 1031          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Match: cntn4 (contactin 4 [Source:ZFIN;Acc:ZDB-GENE-060929-776])

HSP 1 Score: 271.937 bits (694), Expect = 7.240e-75
Identity = 281/1051 (26.74%), Postives = 435/1051 (41.39%), Query Frame = 1
Query:  742 VSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNI---QFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSV--ALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLL-NTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKY--RQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            +  S+ V F+C   G+P P   W           G   +L             TGG L IN  +   D     C   N +GT +SR+  +    LE +  + R  + + +  G +L C PP H    +  + F         E    V Q   R   F+S   G +  +     D G Y C+V    +T T  + P  PL +     +    P +  +FP         G TV  ECF  G    NP+     W      P A   D  +   +  I   Q ED G Y C  E   GR S+     LS  A P  + KP++    +  S+   C+A GKP+   +W +N         +N +P    TE  V V    L I  +  +D  M  C   N +G+  +  EL+ +++ P+F +  L  +T    G   +I C+P+ SP  +I+W K    L              + +R+  L + +L I NV  SD G+Y C A N  G+A+S   L V     +T  P    V V  ++ LPCQ +  P L++ + W+F    + F        +              G + I NIQ      YTC V T  +  SS A   ++  P           + + +  + W  G D+  PI  Y ++ A+   +  W  +      + +  +   ++L        EL     +  R+ A+N+ G GEPS PS+  +T    P+  P NV+GGGG    LVI WEP+    +NG  F Y + ++      W+ A      S +  KY  +  T+ LP    +  FQV+V   N  G GP+  V  I SA + P  AP  + A S +++ + V WKA    + +  + GY + YW +  + K  A+S  R           G  T  +I GL     Y I V+ +NTAG    S  V+ TT K PP   P+ V  N++N+  +I + W  V+ +  E  V GY++ Y  +       ++ +     T +  +L  D  Y +++  +  GG G  S
Sbjct:   41 MEKSREVVFSCEAQGDPPPFYRWKLNGSVVNPKPGSHHSL-------------TGGNLRINHLNKDMDAGTYQCLASNSFGTIVSREASLTFAYLENFKTHKRSSVSVREGQGVVLLCGPPPHSGALTFSWIF--------NEYPSIVKQDSRR---FVSQETGNLYIAKVEPSDVGNYTCVVT-NTVTKTQVQGPPTPLILRTDGIMGEYEPKIEVQFPEI--VQVAKGSTVRLECFALG----NPVPSI-SWRRVDGVPFARKVDVRKTSGVMEIPYFQQEDAGTYECVAENSKGRNSVQGK--LSFFASPQLIEKPQDVQKPIDDSLVWECKATGKPKPSYRWMKN--------GENLEP----TEERVQVINGALSITHLALSDIGMYQCVAGNKYGEVYSNAELRVIAVAPDFSQNQLKSHTLVKEGGDVLIECKPKMSPRGSISWRKGNDALR-------------ESSRIAVLESGSLRISNVSKSDAGSYTCVAHNQFGEASSLGNLLVKEPTIITTAPNTLDVTVGESIILPCQVSYDPSLELKFTWFFNEQLIHFGSHGGYFEKVGGQHSA-------GDIMIRNIQLRHAGKYTCAVQTKVDS-SSIATDLIVRGPPGPPTSIHVEEITDTTATLSWRPGPDNHSPITAYTIQ-ARTPFSLGWQAV------STVPEVVGGSHLTATVI---ELNPWVEYEFRVLASNAVGTGEPSKPSKKARTKDTVPKVTPANVSGGGGSRSELVITWEPVPEELQNGAGFGYVVAFRPFGSTGWMQA---AVPSPEASKYVFKNETI-LP----FSPFQVKVGVYNNKGEGPFGPVITIYSAEEEPGRAPSRLRAKSLSASDVEVSWKALPWSTSKKRVLGYELRYWEK--NEKEDASSVLRTV---------GNRTLAIIQGLKGSSTYYITVRAYNTAGTGPPSPVVNITTKKPPPSQPPSKVMWNTSNS--KIILNWEQVKPLENESEVMGYKVMYRRNRFSRPNVMETNT----TSVELSLPTDEEYIIQIKPFGEGGEGSSS 989          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Match: cntn3a.2 (contactin 3a, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-090312-57])

HSP 1 Score: 262.692 bits (670), Expect = 2.808e-72
Identity = 281/1008 (27.88%), Postives = 424/1008 (42.06%), Query Frame = 1
Query:  871 TNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFML 3879
            T+ +   +GG L I   D   D  I  C   N +G  +SR+  +    L + T+  R  + + +  G +L C  P +    S  + F     N+    V      Q  N  F+S   G +  +     D G Y C+V  R   G    SP  PL +     +    P +   F +  P+    G  V  ECF  G    NP+ +  W+  N  P P K  + +    + + + Q ED G Y C  E   G+ ++     LS +AKP +V   ++    +   +   C+A GKP+    W +N    ++      + R     G      L I+ V  +D  M  C   N  G      EL  ++  P+F + PL    +A  G++  + C+P+  P+    W K            N+V+   D  R+  LP+  L + NV   D G YAC A N  G A++S  L V +   +T  P+   + V  ++ LPCQ +  P LD+ + W F    L   ++D        S          G L I NIQ      Y C V T    +S++A++ V GPPG   G+TV  +  + +  + W  G D+G PI  Y ++ AK   T  W          +  P     N +    V  +L A   F  R+ A NS G+GEPS  S   +T    P  AP +V GGGG    LVI WEP+    +NGD F Y I ++   E+ W  A   +  +     YR  ++ LP    +  F V+V A N  G GP+S V+ + SA   PS  P  V A S ++T I V W   ++ +    + GY +VYW    D K +     R++ +Q             I GL     Y + V  FNTAG    S  ++ TT K PP   P  V  N   +  ++ V W  V  +  E  V GY++ Y  +    R      +   +T +   L  D  Y +++ A S GG G  + P++   L
Sbjct:   13 TDSRRRLSGGNLVIRSLDRAQDGGIYQCTAFNPHGAILSRRASLQFAYLNLKTQT-RSAVSVREGQGVVLLCGTPSYAGDLSFAWVF-----NEYPYFV------QQDNRRFVSQETGNLYIAKVEPSDVGNYTCVVVNRITKGKVLSSP-TPLVLRTDGVMGEYEPKIEVHFSDMVPAAK--GSVVTLECFALG----NPVPEITWRRANAVPFPSKVKMKNSNVVLEIPSFQQEDAGGYECVAENKMGKNTVQGR--LSFHAKPQWVQTMRDIALSIEERLFWECKANGKPKPSYSWLKNGELLAA------EDRIQIENG-----ALTISSVNLSDAGMYQCVAENKHGIIYFGAELVVLASPPDFSRSPLRTLLKAKTGSTVTMECKPQAFPSAITLWRKG-----------NEVMQRTD--RITFLPDGTLRLTNVTKMDGGNYACLARNQFGTASTSGRLLVTDPTQITQGPMDMEIIVGESIVLPCQISCDPALDVSFSWAFNGQLLS--KLDQHYEHVGGST--------SGDLMIRNIQLKHAGKYVCVVDTDVESLSAAAILIVKGPPGAPDGVTVEEITDSTAQ-LSWRPGQDNGSPITSYIIQ-AKTAFTVGW-------QAVNTVPEVIDGNTLTATVV--DLNAWVEFEFRVLARNSVGVGEPSPASLKTRTEDAVPDTAPTDVGGGGGSKSELVITWEPVPEDLQNGDGFGYIIAFRPLGEVNWTHAVTSV-PTQSRYVYRNESI-LP----FSPFSVKVGAYNTKGQGPFSPVTIVFSAENEPSGVPDGVWARSISATEIEVSWHILSVSTER--VLGYEVVYWE--DDTKPETMGKVRVSANQDKV---------NISGLRGYTQYFLTVSAFNTAGTGPLSPTINVTTKKSPPGQPPLNVEWNLIGS--KLTVHWEPVISLEMESDVTGYQVSYRRN----RHKEINTITTNLTSVELTLPADDDYVIQIRALSDGGEGMPTEPINIHKL 929          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:100487602])

HSP 1 Score: 300.056 bits (767), Expect = 2.469e-84
Identity = 294/1087 (27.05%), Postives = 453/1087 (41.67%), Query Frame = 1
Query:  688 KRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASN-TLYPPPNVHDKFP--------NFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSC---NIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYI----------QFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            + GP   +QP D ++ P+ S    V+  C    NP P   W              ID L   N   +  GG L IN+PD   D+ K  C V N YG   SR+  +  G L+ +    R  +++ + TG +L C+PP H P D     ++  F +    D    V     +Q   N++++              D G Y C V           SP +   VF+   +L P  +  +K           FK +       V  ECF  G    NP+    W+  N+ +P  A I+     + + NIQ EDEG Y C   NI+ MD          + +   P +V    +   D+GS +   C A GKPQ  ++W +N                ++ +G+     L+  G+   D  M  C   N+ G   A  ELK ++L P F+  P+     A  G   II C+P+ +P    +W+K G++L             ++ +R+    + +L I N+   D+G+Y C A N  GKANS+  L V  A  +T  P    V V  N  + C A+  P LD+ + W      ++FD+ D    R D              L I N Q      YTC   T  +  S+SA +  +  P    G      + + S  + W+ G D+ QPI  Y ++ AK   ++ W  +K           T+  N+  N  +    +L    ++  R+ A N+ G+GEPS PS   +T    P  AP  V GGGG    L + W+PL      GD F Y + +K     EW                R+V +  P +  Y+          QFQV+V+A N +G GP+S    I SA  +P  AP  +  N  +S+ ++V W  P     E  I+GY + YW           + D+   + R+ +    +T+  + GL+ D +Y + V+ FN+AGD   S  +   T K PP   P I   ++     Q  +TW  V  +  E +V+GY++ Y   G   R       G     L   +  +  Y + V A+S GG+G ++
Sbjct:   33 RYGPVFEEQPIDTIF-PEESMEGKVSVNCRARANPPPVYKWRR--------NNWEIDLL---NEHYSLVGGNLVINNPDKYKDSGKYVCIVSNMYGKVWSREANLNFGYLDPFPTEERYEVKVKEGTGAVLICDPPPHFPDDLNYRWLLNEFPVFISPDNRRFV-----TQANGNLYIAKV---------EQSDRGNYSCFVS----------SPSVTKSVFSKFISLLPQTDTSEKPKRYTPVINVKFKDTRALKDQNVTLECFALG----NPIPVITWRKTNEAMPASAEISMSGAVLKIFNIQPEDEGTYECEAKNIKGMD-----THKAYVYVEGVPEWVEHINDTERDIGSDLHWACVAKGKPQPSIRWLKNGA--------------SYGKGD-----LIKRGLTLEDAGMYQCIAENMHGIIYANAELKILALAPTFEFTPMRKKVLAAKGGRVIIECKPKAAPKAKFSWSK-GTEL------------LINSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGKANSTGVLSVTAATKITLAPSNADVTVGENATMQCHASHDPTLDLTFIWTLNGFPIEFDKEDGHYERNDVGS----------ELVIKNAQLKHAGRYTCTAQTIVDNSSASADLV-VRGPPGPPGGVRVEEIRDTSVKLTWSSGTDNHQPISKYNIQ-AKNILSEDWKDVK-----------TENPNIEGNMEMARAIDLIPWMDYEFRVTATNTLGVGEPSLPSPKIRTEGAAPIVAPAEVGGGGGSNRELTVTWQPLSREYHYGDGFGYVVAFKLFNYREW----------------RKVIVTNPESGHYVHKDDTITPATQFQVKVKAFNKVGEGPYSSTVVIYSAEDVPIEAPTAIVYNILSSSEVSVAWH-PVY---EKSIEGYQVRYWR----------TQDKEAAAHRVQVKASDITTR-LEGLLPDTHYNLEVRAFNSAGDGPPSRVITFLTKKAPPSQKPRIT--SAVRYGSQYIITWEHVVPLSNESAVNGYKVLYRQDGQ--RDGKLYSTGKHSVEL--PVPEEGEYVVEVRAHSEGGDGAVA 982          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:100487602])

HSP 1 Score: 299.286 bits (765), Expect = 5.258e-84
Identity = 296/1092 (27.11%), Postives = 462/1092 (42.31%), Query Frame = 1
Query:  688 KRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASN-TLYPPPNVHDKFP--------NFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSC---NIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGT-LKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYI----------QFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDV----RYNMRVFAYSRGGNGKLS 3855
            + GP   +QP D ++ P+ S    V+  C    NP P   W   ++  +      ID L   N   +  GG L IN+PD   D+ K  C V N YG   SR+  +  G L+ +    R  +++ + TG +L C+PP H P D     ++  F +    D    V     +Q   N++++              D G Y C V           SP +   VF+   +L P  +  +K           FK +       V  ECF  G    NP+    W+  N+ +P  A I+     + + NIQ EDEG Y C   NI+ MD          + +   P +V    +   D+GS +   C A GKPQ  ++W +N                ++ +G+     L+  G+   D  M  C   N+ G   A  ELK ++L P F+  P+     A  G   II C+P+ +P    +W+K G++L             ++ +R+    + +L I N+   D+G+Y C A N  GKANS+  L V  A  +T  P    V V  N  + C A+  P LD+ + W      ++FD+ D          + R      G+ L I N Q      YTC   T  +  S+SA +  +  P    G      + + S  + W+ G D+ QPI  Y ++ AK   ++ W  +K           T+  N+  N  +    +L    ++  R+ A N+ G+GEPS PS   +T    P  AP  V GGGG    L + W+PL      GD F Y + +K     EW                R+V +  P +  Y+          QFQV+V+A N +G GP+S    I SA  +P  AP  +  N  +S+ ++V W  P     E  I+GY + YW           + D+   + R+ +    +T+  + GL+ D +Y + V+ FN+AGD   S  +   T K PP   P I   ++     Q  +TW  V  +  E +V+GY++ Y   G         D  L  TG  ++++  V     Y + V A+S GG+G ++
Sbjct:   19 RYGPVFEEQPIDTIF-PEESMEGKVSVNCRARANPPPVYKW--RRNNWE------IDLL---NEHYSLVGGNLVINNPDKYKDSGKYVCIVSNMYGKVWSREANLNFGYLDPFPTEERYEVKVKEGTGAVLICDPPPHFPDDLNYRWLLNEFPVFISPDNRRFV-----TQANGNLYIAKV---------EQSDRGNYSCFVS----------SPSVTKSVFSKFISLLPQTDTSEKPKRYTPVINVKFKDTRALKDQNVTLECFALG----NPIPVITWRKTNEAMPASAEISMSGAVLKIFNIQPEDEGTYECEAKNIKGMD-----THKAYVYVEGVPEWVEHINDTERDIGSDLHWACVAKGKPQPSIRWLKNGA--------------SYGKGD-----LIKRGLTLEDAGMYQCIAENMHGIIYANAELKILALAPTFEFTPMRKKVLAAKGGRVIIECKPKAAPKAKFSWSK-GTEL------------LINSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGKANSTGVLSVTAATKITLAPSNADVTVGENATMQCHASHDPTLDLTFIWTLNGFPIEFDKED--------GHYERAIRNDVGSELVIKNAQLKHAGRYTCTAQTIVDNSSASADLV-VRGPPGPPGGVRVEEIRDTSVKLTWSSGTDNHQPISKYNIQ-AKNILSEDWKDVK-----------TENPNIEGNMEMARAIDLIPWMDYEFRVTATNTLGVGEPSLPSPKIRTEGAAPIVAPAEVGGGGGSNRELTVTWQPLSREYHYGDGFGYVVAFKLFNYREW----------------RKVIVTNPESGHYVHKDDTITPATQFQVKVKAFNKVGEGPYSSTVVIYSAEDVPIEAPTAIVYNILSSSEVSVAWH-PVY---EKSIEGYQVRYWR----------TQDKEAAAHRVQVKASDITTR-LEGLLPDTHYNLEVRAFNSAGDGPPSRVITFLTKKAPPSQKPRIT--SAVRYGSQYIITWEHVVPLSNESAVNGYKVLYRQDG-------QRDGKLYSTGK-HSVELPVPEEGEYVVEVRAHSEGGDGAVA 971          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:100487602])

HSP 1 Score: 299.286 bits (765), Expect = 5.340e-84
Identity = 296/1092 (27.11%), Postives = 462/1092 (42.31%), Query Frame = 1
Query:  688 KRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASN-TLYPPPNVHDKFP--------NFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSC---NIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGT-LKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYI----------QFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDV----RYNMRVFAYSRGGNGKLS 3855
            + GP   +QP D ++ P+ S    V+  C    NP P   W   ++  +      ID L   N   +  GG L IN+PD   D+ K  C V N YG   SR+  +  G L+ +    R  +++ + TG +L C+PP H P D     ++  F +    D    V     +Q   N++++              D G Y C V           SP +   VF+   +L P  +  +K           FK +       V  ECF  G    NP+    W+  N+ +P  A I+     + + NIQ EDEG Y C   NI+ MD          + +   P +V    +   D+GS +   C A GKPQ  ++W +N                ++ +G+     L+  G+   D  M  C   N+ G   A  ELK ++L P F+  P+     A  G   II C+P+ +P    +W+K G++L             ++ +R+    + +L I N+   D+G+Y C A N  GKANS+  L V  A  +T  P    V V  N  + C A+  P LD+ + W      ++FD+ D          + R      G+ L I N Q      YTC   T  +  S+SA +  +  P    G      + + S  + W+ G D+ QPI  Y ++ AK   ++ W  +K           T+  N+  N  +    +L    ++  R+ A N+ G+GEPS PS   +T    P  AP  V GGGG    L + W+PL      GD F Y + +K     EW                R+V +  P +  Y+          QFQV+V+A N +G GP+S    I SA  +P  AP  +  N  +S+ ++V W  P     E  I+GY + YW           + D+   + R+ +    +T+  + GL+ D +Y + V+ FN+AGD   S  +   T K PP   P I   ++     Q  +TW  V  +  E +V+GY++ Y   G         D  L  TG  ++++  V     Y + V A+S GG+G ++
Sbjct:   22 RYGPVFEEQPIDTIF-PEESMEGKVSVNCRARANPPPVYKW--RRNNWE------IDLL---NEHYSLVGGNLVINNPDKYKDSGKYVCIVSNMYGKVWSREANLNFGYLDPFPTEERYEVKVKEGTGAVLICDPPPHFPDDLNYRWLLNEFPVFISPDNRRFV-----TQANGNLYIAKV---------EQSDRGNYSCFVS----------SPSVTKSVFSKFISLLPQTDTSEKPKRYTPVINVKFKDTRALKDQNVTLECFALG----NPIPVITWRKTNEAMPASAEISMSGAVLKIFNIQPEDEGTYECEAKNIKGMD-----THKAYVYVEGVPEWVEHINDTERDIGSDLHWACVAKGKPQPSIRWLKNGA--------------SYGKGD-----LIKRGLTLEDAGMYQCIAENMHGIIYANAELKILALAPTFEFTPMRKKVLAAKGGRVIIECKPKAAPKAKFSWSK-GTEL------------LINSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGKANSTGVLSVTAATKITLAPSNADVTVGENATMQCHASHDPTLDLTFIWTLNGFPIEFDKED--------GHYERAIRNDVGSELVIKNAQLKHAGRYTCTAQTIVDNSSASADLV-VRGPPGPPGGVRVEEIRDTSVKLTWSSGTDNHQPISKYNIQ-AKNILSEDWKDVK-----------TENPNIEGNMEMARAIDLIPWMDYEFRVTATNTLGVGEPSLPSPKIRTEGAAPIVAPAEVGGGGGSNRELTVTWQPLSREYHYGDGFGYVVAFKLFNYREW----------------RKVIVTNPESGHYVHKDDTITPATQFQVKVKAFNKVGEGPYSSTVVIYSAEDVPIEAPTAIVYNILSSSEVSVAWH-PVY---EKSIEGYQVRYWR----------TQDKEAAAHRVQVKASDITTR-LEGLLPDTHYNLEVRAFNSAGDGPPSRVITFLTKKAPPSQKPRIT--SAVRYGSQYIITWEHVVPLSNESAVNGYKVLYRQDG-------QRDGKLYSTGK-HSVELPVPEEGEYVVEVRAHSEGGDGAVA 974          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:100487602])

HSP 1 Score: 295.434 bits (755), Expect = 2.007e-82
Identity = 293/1084 (27.03%), Postives = 451/1084 (41.61%), Query Frame = 1
Query:  697 PCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASN-TLYPPPNVHDKFP--------NFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSC---NIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFS--ELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYI----------QFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDV----RYNMRVFAYSRGGNGKLS 3855
            P   +QP D ++ P+ S    V+  C    NP P   W              ID L   N   +  GG L IN+PD   D+ K  C V N YG   SR+  +  G L+ +    R  +++ + TG +L C+PP H P D + Y + +          +  +     N  F++   G +  +     D G Y C V           SP +   VF+   +L P  +  +K           FK +       V  ECF  G    NP+    W+  N+ +P  A I+     + + NIQ EDEG Y C   NI+ MD          + +   P +V    +   D+GS +   C A GKPQ  ++W +N                       +   L+  G+   D  M  C   N+ G   A  ELK ++L P F+  P+     A  G   II C+P+ +P    +W+K G++L             ++ +R+    + +L I N+   D+G+Y C A N  GKANS+  L V  A  +T  P    V V  N  + C A+  P LD+ + W      ++FD+ D    R D              L I N Q      YTC   T  +  S+SA +  +  P    G      + + S  + W+ G D+ QPI  Y ++ AK   ++ W  +K           T+  N+  N  +    +L    ++  R+ A N+ G+GEPS PS   +T    P  AP  V GGGG    L + W+PL      GD F Y + +K     EW                R+V +  P +  Y+          QFQV+V+A N +G GP+S    I SA  +P  AP  +  N  +S+ ++V W  P     E  I+GY + YW           + D+   + R+ +    +T+  + GL+ D +Y + V+ FN+AGD   S  +   T K PP   P I   ++     Q  +TW  V  +  E +V+GY++ Y   G         D  L  TG  ++++  V     Y + V A+S GG+G ++
Sbjct:    1 PVFEEQPIDTIF-PEESMEGKVSVNCRARANPPPVYKWRR--------NNWEIDLL---NEHYSLVGGNLVINNPDKYKDSGKYVCIVSNMYGKVWSREANLNFGYLDPFPTEERYEVKVKEGTGAVLICDPPPHFP-DDLNYRWLLN---------EFPVFISPDNRRFVTQANGNLYIAKVEQSDRGNYSCFVS----------SPSVTKSVFSKFISLLPQTDTSEKPKRYTPVINVKFKDTRALKDQNVTLECFALG----NPIPVITWRKTNEAMPASAEISMSGAVLKIFNIQPEDEGTYECEAKNIKGMD-----THKAYVYVEGVPEWVEHINDTERDIGSDLHWACVAKGKPQPSIRWLKNG----------------------ASGDLIKRGLTLEDAGMYQCIAENMHGIIYANAELKILALAPTFEFTPMRKKVLAAKGGRVIIECKPKAAPKAKFSWSK-GTEL------------LINSSRVSIWDDGSLEILNITKLDEGSYTCFAENDRGKANSTGVLSVTAATKITLAPSNADVTVGENATMQCHASHDPTLDLTFIWTLNGFPIEFDKEDGHYERNDVGS----------ELVIKNAQLKHAGRYTCTAQTIVDNSSASADLV-VRGPPGPPGGVRVEEIRDTSVKLTWSSGTDNHQPISKYNIQ-AKNILSEDWKDVK-----------TENPNIEGNMEMARAIDLIPWMDYEFRVTATNTLGVGEPSLPSPKIRTEGAAPIVAPAEVGGGGGSNRELTVTWQPLSREYHYGDGFGYVVAFKLFNYREW----------------RKVIVTNPESGHYVHKDDTITPATQFQVKVKAFNKVGEGPYSSTVVIYSAEDVPIEAPTAIVYNILSSSEVSVAWH-PVY---EKSIEGYQVRYWR----------TQDKEAAAHRVQVKASDITTR-LEGLLPDTHYNLEVRAFNSAGDGPPSRVITFLTKKAPPSQKPRIT--SAVRYGSQYIITWEHVVPLSNESAVNGYKVLYRQDG-------QRDGKLYSTGK-HSVELPVPEEGEYVVEVRAHSEGGDGAVA 944          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Match: cep131 (centrosomal protein 131kDa [Source:Xenbase;Acc:XB-GENE-1016768])

HSP 1 Score: 292.738 bits (748), Expect = 9.405e-82
Identity = 279/1012 (27.57%), Postives = 428/1012 (42.29%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WK-WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDK-YPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            +GP    +P + +  P  S  + +   C V G+P P V W            TL+D       +V      L I  PD   D     C+  N  GT +SR+  +    L+ +    R  + + +  G +L C PP H     +VY +     N+    V      Q  N  F+S   G +  +     D+G Y C+V    +T T    P  PL +     +    P +   FP   PS    G TV  ECF  G    NP+    W+  + KP+  K         + + N Q ED G Y C  E   G+ ++ R   L+  A PT+V K  + +  +  ++   C+A G+P+    W +N     S        R     G+     L I  V  +D+ M  C   N  G   +  EL+ +++ P+F K +    T   +G S +I C+P+ SP P+ITW K G +L              + +R+  L +  L I N+  +D G+Y CTA+N  G A+S+  L V +   +   P    V V  ++ LPCQ +    LDI + W F    + F +        D   F R      G L I +IQ      Y C V T  + +S+ A + ++  P           + + +  + W  G D+  PI+ Y ++ A+   +  W  +       D +  T              L     +  R+ A N  GIGEPS PS+  +T    P+  P NV+GGGG  G LVI WEP+    +NG  F Y + ++    I W+     +  S D+ +Y      LP    +  ++V+V   N  G GP+S ++ + SA + P  AP  V + S  +  I V W A      +G IQGY + YW +  + K Q A   R       TL  G  TS  +  L     Y + V+ +N+AG    S+ V+ TT K PP   P  +  NS+N+  +I + W+ V    +E  V GYR+ Y
Sbjct:   20 QGPVFTQEPPN-INFPLDSEDRTLRLVCEVQGHPKPVVRWRVNG--------TLMDEAQDYRYRVLDRS--LIIASPDRNRDVGTFQCEATNSLGTILSREAYVQFSYLDSFQTRTRSTVSVREGQGMVLLCGPPAHS--GELVYAWIF---NEYPPFV------QQDNRRFVSQVTGNLYIAKVEPSDAGNYTCVVT-NTVTNTRELGPSTPLTLRTDGVMGEYEPKIEVHFPESVPSAK--GSTVKLECFALG----NPVPTITWRRADGKPISRKVRRHRSSGVLEIPNFQQEDAGPYECVAENTRGK-NMVRG-QLTYFAPPTWVQKINDAHIAIEENILWECKASGRPKASYTWLKNGQRLQS------KGRLQIDHGS-----LTITSVNISDSGMYQCLAENKHGTIYSSAELRVIAVGPDFSKGFVKRVTLGKVGGSVLIECKPKASPKPSITW-KKGKELQR------------ESSRISILDDGTLKISNLTKADAGSYTCTASNHFGTASSTGTLVVKDLTQVLVPPSSMDVTVGESIVLPCQVSHDHSLDISFSWVFNGQLIDFQK--------DGEHFERVGGDSAGDLMIRSIQLKHAGKYICLVHTSVDKLSAGADL-IVRGPPGPPDALTVEEITDTTAQLSWMPGVDNHSPIIMYSVQ-ARTPFSVGWQAVSTVPEVVDGRSFTA---------TVVGLSPWVEYEFRVIAINEIGIGEPSPPSDKRRTEEALPEVTPANVSGGGGSKGELVITWEPVPEELQNGGGFGYVVAFRPFGTISWMQT---VVASADSSRYVYRNESLPP---FSPYEVKVGVYNNRGEGPFSPLTVVYSAEEEPGRAPAGVFSRSLTAWDIEVSWIAVPGSLSKGRIQGYEVRYWKQ--NEKEQNARKLR-------TL--GNQTSTKLSHLQGHTLYHLNVRAYNSAGTGPASTTVNVTTRKPPPSQPPGNIIWNSSNS--KIILNWDQVTAQEDESEVKGYRVLY 938          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Match: Cntn3 (contactin 3 [Source:MGI Symbol;Acc:MGI:99534])

HSP 1 Score: 315.849 bits (808), Expect = 1.374e-89
Identity = 281/1014 (27.71%), Postives = 426/1014 (42.01%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAI-IGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQF---QVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            +GP  + +P++ ++ P  S  K +T  C   GNP P   W            T +D     NG     G L+ IN   N       C   N  GT +SR+ ++    LE +    R  + + +  G +L C PP H  + S  + F     N+    V++       +  F+S   G +  +     D G Y C+V    +T T       PL + +   +    P +  +FP   P+    G TV  ECF  G    NP+    W+ ++  P P K  +  F   + + N Q ED G Y C  E   G+ ++AR   L+  AKP ++   ++    V  S+   C+A GKP+          P   WL KN D         +    L I  +  TD+ M  C   N  G   +  ELK V+  P+F + P+     + +G+  I+ C+P  SP     W K    +              +  R+  L +  L I NV  +D GTY CTA N  GKAN + +L V     +   P    V V  +V LPCQ    P LDI + WYF      F +        D S F +      G L I NIQ      Y C V T  + +SS+A + ++              + + +  + WT+G D   P++ Y ++ A+   +  W  ++      D K  T             EL     +  R+ A+N  G GEPS PSE  +T    P+ AP  V+GGGG    LVI W+P+    +NG  F Y + ++      WI     +  S DN +Y      +  N+  + F   +V+V   N  G GP+S V+ + SA + P+ AP  + A+S +S+ I V W         G + GY + YW    +             S R     G  TS V+ GL ++  Y   V+ +N+AG    S+ V+ TT K PP   P  V  N+T+T  ++ + W  V+ M  E  V GY++ Y
Sbjct:   24 QGPVFIKEPSNSIF-PVDSEDKKITLNCEARGNPSPHYRWQLNGSDID----TSLDHRYKLNG-----GNLIVINPNRNWDTGSYQCFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVF-----NEYPSFVEE------DSRRFVSQETGHLYIAKVEPSDVGNYTCVVT-STVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAK--GSTVRLECFALG----NPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGK-NVARG-RLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPK----------PSYRWL-KNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAELKVVASAPDFSRNPMKKMVQVQVGSLVILDCKPRASPRALSFWKKGDMMVR-------------EQARVSFLNDGGLKIMNVTKADAGTYTCTAENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGALTDFKK--------DGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAEL-IVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHSPVISYAVQ-ARTPFSVGWQSVRTVPEVIDGKTHTA---------TVVELNPWVEYEFRIVASNKIGGGEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVTTWIQT---VVTSPDNPRY------VFRNESIVPFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSLSSSEIEVSWNTIPWKLSNGHLLGYEVRYWNNGGE-----------EESSRKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKKTPPSQPPGNVVWNATDT--KVLLNWEQVKAMENESEVTGYKVFY 942          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Match: Cntn3 (contactin 3 [Source:MGI Symbol;Acc:MGI:99534])

HSP 1 Score: 315.849 bits (808), Expect = 1.374e-89
Identity = 281/1014 (27.71%), Postives = 426/1014 (42.01%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAI-IGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQF---QVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            +GP  + +P++ ++ P  S  K +T  C   GNP P   W            T +D     NG     G L+ IN   N       C   N  GT +SR+ ++    LE +    R  + + +  G +L C PP H  + S  + F     N+    V++       +  F+S   G +  +     D G Y C+V    +T T       PL + +   +    P +  +FP   P+    G TV  ECF  G    NP+    W+ ++  P P K  +  F   + + N Q ED G Y C  E   G+ ++AR   L+  AKP ++   ++    V  S+   C+A GKP+          P   WL KN D         +    L I  +  TD+ M  C   N  G   +  ELK V+  P+F + P+     + +G+  I+ C+P  SP     W K    +              +  R+  L +  L I NV  +D GTY CTA N  GKAN + +L V     +   P    V V  +V LPCQ    P LDI + WYF      F +        D S F +      G L I NIQ      Y C V T  + +SS+A + ++              + + +  + WT+G D   P++ Y ++ A+   +  W  ++      D K  T             EL     +  R+ A+N  G GEPS PSE  +T    P+ AP  V+GGGG    LVI W+P+    +NG  F Y + ++      WI     +  S DN +Y      +  N+  + F   +V+V   N  G GP+S V+ + SA + P+ AP  + A+S +S+ I V W         G + GY + YW    +             S R     G  TS V+ GL ++  Y   V+ +N+AG    S+ V+ TT K PP   P  V  N+T+T  ++ + W  V+ M  E  V GY++ Y
Sbjct:   24 QGPVFIKEPSNSIF-PVDSEDKKITLNCEARGNPSPHYRWQLNGSDID----TSLDHRYKLNG-----GNLIVINPNRNWDTGSYQCFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVF-----NEYPSFVEE------DSRRFVSQETGHLYIAKVEPSDVGNYTCVVT-STVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAK--GSTVRLECFALG----NPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGK-NVARG-RLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPK----------PSYRWL-KNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAELKVVASAPDFSRNPMKKMVQVQVGSLVILDCKPRASPRALSFWKKGDMMVR-------------EQARVSFLNDGGLKIMNVTKADAGTYTCTAENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGALTDFKK--------DGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAEL-IVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHSPVISYAVQ-ARTPFSVGWQSVRTVPEVIDGKTHTA---------TVVELNPWVEYEFRIVASNKIGGGEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVTTWIQT---VVTSPDNPRY------VFRNESIVPFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSLSSSEIEVSWNTIPWKLSNGHLLGYEVRYWNNGGE-----------EESSRKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKKTPPSQPPGNVVWNATDT--KVLLNWEQVKAMENESEVTGYKVFY 942          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 303.908 bits (777), Expect = 1.483e-85
Identity = 295/1079 (27.34%), Postives = 456/1079 (42.26%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKID-CQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSA-LIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQ----------FQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG-------APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            GP   +QP + +Y P+ S    V+  C    +PFP   W                 +  TN + +  GG L IN+PD   D  +  C   N+YG   S +  +  G L+ +    R  +++ +  G +L C+PP H P D     ++  F +    DK   V     SQ   N++++ N+           D G Y C V    +T + + S  IPL      T  P P   D    FK     +G  V  ECF  G    NP+    W+   +P+P  A I+     + + NIQ EDEG+Y C  E + G+        + + A P +V    +   D+GS +   C A GKP   ++W +N               Y++ +G      L +  V   +  M  C   N +G   A  ELK ++L P F+  P+     A  G   II C+P+ +P P  +W+K    L             V+ +R+    + +L I N+  +D G Y C A N+ GKANS+  L + N   +   P+   + V  N  + C A+  P LD+ + W F    + F++ ++    Y ++  +       G L I N Q      YTC   T  +  S+SA L+    P   GG         +V+  + W+ G D+  PI  Y ++  K   +  W     +  KTD  P   + N+   + V  +L     +  R+ A N+ G GEPS PS   KT    P  AP +V GGGG    L I W PL      G+NF Y + +                K  D +++++VT+  P    Y+           FQV+V+A N  G GP+S V+ I SA   PS AP +V     +S+ I+V WK       E  ++ Y I YW   +    +AA++    TSQ          S  +  L+ D  Y I V   N+AG    S  ++  T K PP   P I+  +S  +  +  +TW+ V  +  E +V GY+I Y   G       +  + +++V +             D  Y + V A+S GG+G +S
Sbjct:   40 GPIFEEQPINTIY-PEESLEGKVSLNCRARASPFPVYKWRMNNGD-----------VDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFV-----SQTNGNLYIA-NV--------ESSDRGNYSCFVSSPSITKSVF-SKFIPLIPIPERTTKPYPA--DIVVQFKDIYTMMGQNVTLECFALG----NPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDK--HQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKN--------------GYSYHKGE-----LRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWL-------------VNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNK-EITHIHYQRNFMLDAN----GELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVA--LTWSRGSDNHSPISKYTIQT-KTILSDDW-----KDAKTD--PPIIEGNMESAKAV--DLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGGTNRELTITWAPLSREYHYGNNFGYIVAF----------------KPFDGEEWKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVL----EKIVESYQIRYW---AGHDKEAAAHRVQVTSQEY--------SARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAPPSQPPRII--SSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTHKHSIEVPI-----------PRDGEYVVEVRAHSDGGDGVVS 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 303.908 bits (777), Expect = 1.483e-85
Identity = 295/1079 (27.34%), Postives = 456/1079 (42.26%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKID-CQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSA-LIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQ----------FQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG-------APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            GP   +QP + +Y P+ S    V+  C    +PFP   W                 +  TN + +  GG L IN+PD   D  +  C   N+YG   S +  +  G L+ +    R  +++ +  G +L C+PP H P D     ++  F +    DK   V     SQ   N++++ N+           D G Y C V    +T + + S  IPL      T  P P   D    FK     +G  V  ECF  G    NP+    W+   +P+P  A I+     + + NIQ EDEG+Y C  E + G+        + + A P +V    +   D+GS +   C A GKP   ++W +N               Y++ +G      L +  V   +  M  C   N +G   A  ELK ++L P F+  P+     A  G   II C+P+ +P P  +W+K    L             V+ +R+    + +L I N+  +D G Y C A N+ GKANS+  L + N   +   P+   + V  N  + C A+  P LD+ + W F    + F++ ++    Y ++  +       G L I N Q      YTC   T  +  S+SA L+    P   GG         +V+  + W+ G D+  PI  Y ++  K   +  W     +  KTD  P   + N+   + V  +L     +  R+ A N+ G GEPS PS   KT    P  AP +V GGGG    L I W PL      G+NF Y + +                K  D +++++VT+  P    Y+           FQV+V+A N  G GP+S V+ I SA   PS AP +V     +S+ I+V WK       E  ++ Y I YW   +    +AA++    TSQ          S  +  L+ D  Y I V   N+AG    S  ++  T K PP   P I+  +S  +  +  +TW+ V  +  E +V GY+I Y   G       +  + +++V +             D  Y + V A+S GG+G +S
Sbjct:   40 GPIFEEQPINTIY-PEESLEGKVSLNCRARASPFPVYKWRMNNGD-----------VDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFV-----SQTNGNLYIA-NV--------ESSDRGNYSCFVSSPSITKSVF-SKFIPLIPIPERTTKPYPA--DIVVQFKDIYTMMGQNVTLECFALG----NPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDK--HQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKN--------------GYSYHKGE-----LRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWL-------------VNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNK-EITHIHYQRNFMLDAN----GELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVA--LTWSRGSDNHSPISKYTIQT-KTILSDDW-----KDAKTD--PPIIEGNMESAKAV--DLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGGTNRELTITWAPLSREYHYGNNFGYIVAF----------------KPFDGEEWKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVL----EKIVESYQIRYW---AGHDKEAAAHRVQVTSQEY--------SARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAPPSQPPRII--SSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTHKHSIEVPI-----------PRDGEYVVEVRAHSDGGDGVVS 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Match: Cntn1 (contactin 1 [Source:MGI Symbol;Acc:MGI:105980])

HSP 1 Score: 303.908 bits (777), Expect = 1.483e-85
Identity = 295/1079 (27.34%), Postives = 456/1079 (42.26%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKID-CQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSA-LIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQ----------FQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG-------APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            GP   +QP + +Y P+ S    V+  C    +PFP   W                 +  TN + +  GG L IN+PD   D  +  C   N+YG   S +  +  G L+ +    R  +++ +  G +L C+PP H P D     ++  F +    DK   V     SQ   N++++ N+           D G Y C V    +T + + S  IPL      T  P P   D    FK     +G  V  ECF  G    NP+    W+   +P+P  A I+     + + NIQ EDEG+Y C  E + G+        + + A P +V    +   D+GS +   C A GKP   ++W +N               Y++ +G      L +  V   +  M  C   N +G   A  ELK ++L P F+  P+     A  G   II C+P+ +P P  +W+K    L             V+ +R+    + +L I N+  +D G Y C A N+ GKANS+  L + N   +   P+   + V  N  + C A+  P LD+ + W F    + F++ ++    Y ++  +       G L I N Q      YTC   T  +  S+SA L+    P   GG         +V+  + W+ G D+  PI  Y ++  K   +  W     +  KTD  P   + N+   + V  +L     +  R+ A N+ G GEPS PS   KT    P  AP +V GGGG    L I W PL      G+NF Y + +                K  D +++++VT+  P    Y+           FQV+V+A N  G GP+S V+ I SA   PS AP +V     +S+ I+V WK       E  ++ Y I YW   +    +AA++    TSQ          S  +  L+ D  Y I V   N+AG    S  ++  T K PP   P I+  +S  +  +  +TW+ V  +  E +V GY+I Y   G       +  + +++V +             D  Y + V A+S GG+G +S
Sbjct:   40 GPIFEEQPINTIY-PEESLEGKVSLNCRARASPFPVYKWRMNNGD-----------VDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNYGMVRSTEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFV-----SQTNGNLYIA-NV--------ESSDRGNYSCFVSSPSITKSVF-SKFIPLIPIPERTTKPYPA--DIVVQFKDIYTMMGQNVTLECFALG----NPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNIQLEDEGLYECEAENIRGKDK--HQARIYVQAFPEWVEHINDTEVDIGSDLYWPCIATGKPIPTIRWLKN--------------GYSYHKGE-----LRLYDVTFENAGMYQCIAENAYGSIYANAELKILALAPTFEMNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWL-------------VNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNK-EITHIHYQRNFMLDAN----GELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVA--LTWSRGSDNHSPISKYTIQT-KTILSDDW-----KDAKTD--PPIIEGNMESAKAV--DLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGGTNRELTITWAPLSREYHYGNNFGYIVAF----------------KPFDGEEWKKVTVTNPDTGRYVHKDETMTPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVL----EKIVESYQIRYW---AGHDKEAAAHRVQVTSQEY--------SARLENLLPDTQYFIEVGACNSAGCGPSSDVIETFTRKAPPSQPPRII--SSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTHKHSIEVPI-----------PRDGEYVVEVRAHSDGGDGVVS 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q9VN14|CONT_DROME (Contactin OS=Drosophila melanogaster OX=7227 GN=Cont PE=1 SV=2)

HSP 1 Score: 402.134 bits (1032), Expect = 1.582e-116
Identity = 372/1313 (28.33%), Postives = 572/1313 (43.56%), Query Frame = 1
Query:  184 CPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSD--LLNNNAVNRS-IQWYTAGAM----DSQSTGRYIWDGFPPDLKT--FNTEL-------------------------IPLLIDVPDINNLVAW----------NKDRSKIVYIYYNMK--WMLNLTTPTDNNYFICESPKSVITKTVSMS----RSADFGQ--SDLTNIKRGPCILDQPTDQLYAPQVSNSKL---VTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGR-LEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDP------RYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTN-VYLPCQAAGTPYLDIDYDWYFENVRLKFD-----RMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGE---GPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALD--VDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSR 3894
            CP  W S+   CY+F  SP  N+ +++  C    A L+ ++++ +H F     +L N   NR  I     G +    D  +    I D F  D +    N +L                         +P  ++  + NNL  +             R ++VY +   +  WM       + N FICES     +  V++     R   +G   +D+  I RGP  + QP D  +   V+ ++L   VT +C   G P P+ +WY         +   ID L+    + T +GG L I +P    D     C  +N +G   S    +  G  +E   K   +   M  N G  + C+PP H P       +Y  R      V +D         +F+S + G + FS     D   Y C V    ++ T    P  PL V   N+ Y      + FP   P  P  GD +  EC  +G     P+  Y W     PL   A   ++ R + + N    D G YSC I   + R ++ +S+ ++I  +P F +  K+   D  S VT  C+A   P     WY+N        A+  DP      RY   +  +++  L     K  D+AM  C   N      +  +L+ +S+ P+F K+PL +   A+   +T I C PE +P P   W KDG           QVIG+    R+  LP+  L I      D+G Y C A+N  G   S A + V+  +     P  R V    + ++L C+AA    LDI Y W      LK +     R+ +D  R                L ++N    D  +Y C V +  N ISS   + + G PG  GG+ V  +    + ++EW DG  +G+ I +Y + + + +  + W  +   +   ++   T      R Q     L   + +   + A N  GIG PS PS ++ T    P  AP+NV GGGGK+G L I W+PLLP E++     Y++ +K    IEW  A++ I K    D      +++P N  Y +++V+V+A N +G GP S+++ I SA  +P  APQ   A ++NST  NV W+ P   S E   G + G+ + YW      K+     D +    R T         +I+GL  D YY + V  +N AG+  ES   ++ T++K PQ  P+ V +   N P  ++V W  V    +EE V+GY++R W S   + TA +  V +G K+   INNL     YNMRV AYS GG+G++S+P   F +   +R
Sbjct:  139 CPEHWVSFRQTCYRFIRSPKRNWAEAKKICKAHNADLINVDNVEKHSFILKNLILQNQRQNRFFISARQTGPLNWVNDDNTQLVQIEDSFSMDEQVPLENEDLHDNRFLVQNDLNNQNINNPNQFYNSLPGTVNQRNQNNLRGFIGPNQPYGDNRYVRDRVVYAFSKKRDRWMFMPAYEIELNLFICESKVLYSSDNVNIKLDDKRPYHYGLDINDMERIPRGPYFVKQPNDTTF--DVNKNRLINDVTLSCLANGYPTPSYTWYREVYVDDRLEYQKIDPLA--QDRYTISGGNLIIYEPKQALDQGAYHCVAENKFGRIRSESAHLNFGFIMEFNLKRSAETSEM--NWGKSIFCDPPQHYPD----VRYYWARDYFPNFVEED-------QRVFVSRD-GALYFSFIETVDRANYSCTVQ-TLVSDTGRNGPFFPLRV-TPNSNYQALIFANTFPKVFPEAPVAGDEIRLECMAFGY----PIPSYNWTRQGLPLQRNAYTINYGRVLIIQNATTNDNGEYSCTI--TNPRKTLMKSIYINIQMRPQFTIPLKDMIKDYNSDVTFICEAFAIPDANYTWYKN--------AERLDPANINRDRYIIQDNVLTIKFLE----KDKDDAMYQCGAQNQLKTSFSSAQLRVLSMKPSFKKHPLESEVYAVYNGNTTIVCDPEAAPRPKFQWKKDG-----------QVIGSGGHRRI--LPSGTLTISPTSRDDEGIYTCIASNQAGTDESHARVIVLQEIRFIETPPQRIVSKEHDLIFLHCEAAFDELLDIAYVWKHNGEVLKNNHDGTGRIIVDWNR----------------LTVHNTSMRDAGDYECVVKSAVNEISSKTSVSIEGAPGAPGGVQVIQISKTKA-IIEWVDGSHNGRAIRYYNI-LGRTNWNRTWVNVSTHVQAREVDRYTS-----RQQAEVVNLTPWSAYEFSVTAVNDLGIGTPSAPSPIYSTYEDKPYIAPRNVGGGGGKIGDLTITWDPLLPQEQHSHGIHYKVFWKLKGAIEW--ASDEIKKQ---DHMGVAVVNIPLNNYYTEYEVKVQAINSVGKGPESEIAVIHSAEDMPQVAPQKPIALAYNSTCFNVTWQ-PIDMSRENIRGKLIGHRLKYW------KTTHQEEDSVYYLSRTT-----RNWALIVGLQPDTYYFVKVMAYNAAGEGPESERFEERTYRKAPQKPPSSVHVYGIN-PSTVRVVWRYVSPSQDEEPVEGYKVRIWESDQNMITANNTIVPIGQKLESYINNLTPGKSYNMRVLAYSNGGDGRMSSPTLHFQMGKTTR 1359          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Match: sp|P14781|CNTN1_CHICK (Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 1.321e-91
Identity = 293/1076 (27.23%), Postives = 467/1076 (43.40%), Query Frame = 1
Query:  670 SDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEW---ITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG-------APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            S+  N   GP   +QP D +Y P+ S+   V+  C     PFPT  W                 +  T  + +  GG L I++P+ + D  K  C V N +GT  S +  +  G L+ +       +++ +  G +L CEPP H P D + Y + +          +  +   L    F+S   G +  +     D G Y C V    +T + + S  IPL   A      P ++  KF   K +   LG  V  ECF  G    NP+ +  W    +P+P  A I+     + + NIQ+EDEG+Y C  E   G+        + + A P +V    +   D+GS +   C A GKP   ++W +N + F                       L I G+   D  M  C   N  G   A  ELK V+  P F+  P+     A  G   II C+P+ +P P  +W+K G++L             V+ +R+    + +L I NV   D+G Y C A N+ GKANS+  L++  A  +T  P+   V V  N  + C A+  P LD+ + W      + F++   +   Y+++  ++      G L I N+Q      YTC   T  +  S+SA + V+  P    G      + + +  + W+ G D+  PI  Y ++ +K   +++W   K        +P   + N+   + +  +L     +  R+ A N+ G GEPS PS+  +T   PP  AP +V GGGG    L I W PL      G+NF Y + +K   E EW      N  I + +  D+       +P +    Q+QV+V+A N  G GP+S  + I SA   P+  P DV     +S+ I+V W        E  ++GY I YW          A++D+   +QR+ +     ++  +  L  +  Y I V  FN+AG    S  +D  T K PP   P I+  +S  +  +  +TW+ V+ M  E +V+GY++ Y   G       +  +  ++V V             D  Y + V A+S GG+G+++ 
Sbjct:   24 SEEGNKGYGPVFEEQPIDTIY-PEESSDGQVSMNCRARAVPFPTYKWKLNNWD-----------IDLTKDRYSMVGGRLVISNPEKSRDAGKYVCVVSNIFGTVRSSEATLSFGYLDPFPPEEHYEVKVREGVGAVLLCEPPYHYP-DDLSYRWLLN---------EFPVFIALDRRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVF-SKFIPLIPQADRAKVYPADIKVKF---KDTYALLGQNVTLECFALG----NPVPELRWSKYLEPMPATAEISMSGAVLKIFNIQYEDEGLYECEAENYKGKDK--HQARVYVQASPEWVEHINDTEKDIGSDLYWPCVATGKPIPTIRWLKNGVSFRK-------------------GELRIQGLTFEDAGMYQCIAENAHGIIYANAELKIVASPPTFELNPMKKKILAAKGGRVIIECKPKAAPKPKFSWSK-GTEL------------LVNGSRIHIWDDGSLEIINVTKLDEGRYTCFAENNRGKANSTGVLEMTEATRITLAPLNVDVTVGENATMQCIASHDPTLDLTFIWSLNGFVIDFEK---EHEHYERNVMIKSN----GELLIKNVQLRHAGRYTCTAQTIVDNSSASADL-VVRGPPGPPGGIRIEEIRDTAVALTWSRGTDNHSPISKYTIQ-SKTFLSEEWKDAK-------TEPSDIEGNMESARVI--DLIPWMEYEFRIIATNTLGTGEPSMPSQRIRTEGAPPNVAPSDVGGGGGSNRELTITWMPLSREYHYGNNFGYIVAFKPFGEKEWRRVTVTNPEIGRYVHKDE------SMPPS---TQYQVKVKAFNSKGDGPFSLTAVIYSAQDAPTEVPTDVSVKVLSSSEISVSWHHVT----EKSVEGYQIRYW----------AAHDKEAAAQRVQVSNQEYSTK-LENLKPNTRYHIDVSAFNSAGYGPPSRTIDIITRKAPPSQRPRII--SSVRSGSRYIITWDHVKAMSNESAVEGYKVLYRPDGQHEGKLFSTGKHTIEVPV-----------PSDGEYVVEVRAHSEGGDGEVAQ 980          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q07409|CNTN3_MOUSE (Contactin-3 OS=Mus musculus OX=10090 GN=Cntn3 PE=1 SV=2)

HSP 1 Score: 315.849 bits (808), Expect = 9.611e-89
Identity = 281/1014 (27.71%), Postives = 426/1014 (42.01%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAI-IGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQF---QVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            +GP  + +P++ ++ P  S  K +T  C   GNP P   W            T +D     NG     G L+ IN   N       C   N  GT +SR+ ++    LE +    R  + + +  G +L C PP H  + S  + F     N+    V++       +  F+S   G +  +     D G Y C+V    +T T       PL + +   +    P +  +FP   P+    G TV  ECF  G    NP+    W+ ++  P P K  +  F   + + N Q ED G Y C  E   G+ ++AR   L+  AKP ++   ++    V  S+   C+A GKP+          P   WL KN D         +    L I  +  TD+ M  C   N  G   +  ELK V+  P+F + P+     + +G+  I+ C+P  SP     W K    +              +  R+  L +  L I NV  +D GTY CTA N  GKAN + +L V     +   P    V V  +V LPCQ    P LDI + WYF      F +        D S F +      G L I NIQ      Y C V T  + +SS+A + ++              + + +  + WT+G D   P++ Y ++ A+   +  W  ++      D K  T             EL     +  R+ A+N  G GEPS PSE  +T    P+ AP  V+GGGG    LVI W+P+    +NG  F Y + ++      WI     +  S DN +Y      +  N+  + F   +V+V   N  G GP+S V+ + SA + P+ AP  + A+S +S+ I V W         G + GY + YW    +             S R     G  TS V+ GL ++  Y   V+ +N+AG    S+ V+ TT K PP   P  V  N+T+T  ++ + W  V+ M  E  V GY++ Y
Sbjct:   24 QGPVFIKEPSNSIF-PVDSEDKKITLNCEARGNPSPHYRWQLNGSDID----TSLDHRYKLNG-----GNLIVINPNRNWDTGSYQCFATNSLGTIVSREAKLQFAYLENFKTRMRSTVSVREGQGVVLLCGPPPHSGELSYAWVF-----NEYPSFVEE------DSRRFVSQETGHLYIAKVEPSDVGNYTCVVT-STVTNTRVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAAK--GSTVRLECFALG----NPVPQINWRRSDGMPFPNKIKLRKFNGMLEIQNFQQEDTGSYECIAENSRGK-NVARG-RLTYYAKPYWLQLLRDVEIAVEDSLYWECRASGKPK----------PSYRWL-KNGDALVLEERIQIENGALTITNLNVTDSGMFQCIAENKHGLIYSSAELKVVASAPDFSRNPMKKMVQVQVGSLVILDCKPRASPRALSFWKKGDMMVR-------------EQARVSFLNDGGLKIMNVTKADAGTYTCTAENQFGKANGTTHLVVTEPTRIILAPSNMDVAVGESVILPCQVQHDPLLDIMFAWYFNGALTDFKK--------DGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAAEL-IVRGSPGPPENVKVDEITDTTAQLSWTEGTDSHSPVISYAVQ-ARTPFSVGWQSVRTVPEVIDGKTHTA---------TVVELNPWVEYEFRIVASNKIGGGEPSLPSEKVRTEEAAPEIAPSEVSGGGGSRSELVITWDPVPEELQNGGGFGYVVAFRPLGVTTWIQT---VVTSPDNPRY------VFRNESIVPFSPYEVKVGVYNNKGEGPFSPVTTVFSAEEEPTVAPSHISAHSLSSSEIEVSWNTIPWKLSNGHLLGYEVRYWNNGGE-----------EESSRKVKVAGNQTSAVLRGLKSNLAYYTAVRAYNSAGAGPFSATVNATTKKTPPSQPPGNVVWNATDT--KVLLNWEQVKAMENESEVTGYKVFY 942          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Match: sp|P28685|CNTN2_CHICK (Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 6.787e-87
Identity = 275/1010 (27.23%), Postives = 434/1010 (42.97%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFT-KDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWR-GLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   +QP   L+ P+ S  + VT TC    NP  T  W     +   GP           + +     G L I++P    D     C   N  GT +SR+  +  G L+ ++   R  +++ +  G M  C PP H P  ++ Y + +           + I +  R   F+S   G +  +     D G Y C           S  S    L + A +     P++  KFP    +    G  V  ECF +G    NP+    KW        +     E  + + N+ FEDEG Y C  E + GR +    +   I+A+P ++    +   D+GS +  +C A GKP+  ++W R+  P +S        R   + G +  + LV+      D+ M  C   N  G   A  EL   +L P+F   P+     A      IIPCQP  +P  T+ WTK G++L              + +R+    +  L ++N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + V  N+ L C A+  P +D+ + W  ++  +  D+ +   RR    + +       G L I N Q      YTC   T  +  S SA +  +  P    G  V   +G+ +  + W+ G+D+  PI  Y +E A+   + KW  ++         P+  + N    Q V   L    ++  R+ A+N  G+GEPS PS   +T    P  AP  + GGGG    L+I W P L   +NGD F Y + +++     W+TA     +SL +  YR  ++       Y  F+V+++A N  G GP S  + + SA + P  AP  V A +  S+ ++V W+    G   G + GY I YW      K +AA  DR+ T+       G +TS  + GL  +  Y + V+ +N AG    S   + TT K           ++ T T   + + W+ V    +E +V GY++ Y
Sbjct:   31 GPVFEEQPAHTLF-PEGSAEEKVTLTCRARANPPATYRWKMNGTELKMGP-----------DSRYRLVAGDLVISNPVKAKDAGSYQCVATNARGTVVSREASLRFGFLQEFSAEERDPVKITEGWGVMFTCSPPPHYP--ALSYRWLLNE-------FPNFIPADGRR--FVSQTTGNLYIAKTEASDLGNYSCFATSHIDFITKSVFSKFSQLSLAAEDARQYAPSIKAKFP--ADTYALTGQMVTLECFAFG----NPVPQI-KWRKLDGSQTSKWLSSEPLLHIQNVDFEDEGTYECEAENIKGRDTYQGRII--IHAQPDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLAS------QNRIEVSGGELRFSKLVLE-----DSGMYQCVAENKHGTVYASAELTVQALAPDFRLNPVKRLIPAARSGKVIIPCQPRAAPKATVLWTK-GTEL------------LTNSSRVTITADGTLILQNISKSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINVGENLTLQCHASHDPTMDLTFTWSLDDFPIDLDKSEGHYRRASVKEAV-------GDLAIVNAQLKHSGRYTCTAQTVVDSTSESATL-TVRGPPGPPGGVVVRDIGDTTVQLSWSRGFDNHSPIARYSIE-ARTLLSNKWKQMR-------TNPVNIEGNAETAQVV--NLIPWMDYEFRVLASNILGVGEPSLPSSKIRTKEAAPTVAPSGLGGGGGAPNELIINWTPTLRDYQNGDGFGYILSFRKKGTQGWLTARVPHAESL-HYVYRNESIG-----PYTPFEVKIKAYNRKGEGPESLTAIVYSAEEEPKVAPFRVTAKAVLSSEMDVSWEPVEQGDMTGVLLGYEIRYWK--DGDKEEAA--DRVRTA-------GLVTSAHVTGLNPNTKYHVSVRAYNRAGAGPPSPSTNITTTKP--PPRRPPGNISWTLTGSTVTIKWDPVVAQADESAVTGYKMLY 947          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q02246|CNTN2_HUMAN (Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 8.531e-87
Identity = 271/1013 (26.75%), Postives = 439/1013 (43.34%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQ---GPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMV-GWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   DQP   L+ P+ S  + V   C    +P  T  W       +   G +  L+             GG L I +P    D  +  C   N  GT +SR+  +  G L+ ++K  R  ++  +  G ML C PP H P   + Y + +           + I +  R+  F+S   G +  +  +  D G Y C+       +  S  S    L + A +T    P++  +FP    +   +G  V  ECF +G    NP+ +  W+  +  L P+   T  E  + + ++ FEDEG Y C  E   GR ++   +   + A+P ++    +   D+GS++   C A GKP+  ++W RN  P +S        R     G++  + L +      D+ M  C   N  G   A  EL   +L P+F   P+     A  G   +IPCQP  +P   + W+K    L             V+ +R+   P+  L I+N+  SD+G Y C A N +GKANS+  L V +A  +T  P    + +  N+ L C A+  P +D+ + W  ++  + FD+     RR +  + +       G L I N Q      YTC   T  +  S  A + ++  P    G  V   +G+ +  + W+ G+D+  PI  Y L+ A+     KW  +  R N  +I+   +   ++        L    ++  R+ A+N  G GEPSGPS   +T    P  AP  ++GGGG  G L++ W P+    +NGD F Y + ++      W TA       +     +       + + Y  F+V++R+ N  G GP S  + + SA + P  AP  V A   +S+ +NV W+ P      G + GY I YW        + A+ DR+ T+       G  TS  + GL  +  Y + V+ +N AG    S   + TT K PP+  P    ++ T +   + + W+ V     E +V GY++ Y
Sbjct:   36 GPVFEDQPLSVLF-PEESTEEQVLLACRARASPPATYRWKMNGTEMKLEPGSRHQLV-------------GGNLVIMNPTKAQDAGVYQCLASNPVGTVVSREAILRFGFLQEFSKEERDPVKAHEGWGVMLPCNPPAHYP--GLSYRWLLNE-------FPNFIPTDGRH--FVSQTTGNLYIARTNASDLGNYSCLATSHMDFSTKSVFSKFAQLNLAAEDTRLFAPSIKARFP--AETYALVGQQVTLECFAFG----NPVPRIKWRKVDGSLSPQ--WTTAEPTLQIPSVSFEDEGTYECEAENSKGRDTVQGRII--VQAQPEWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLAS------QNRVEVLAGDLRFSKLSLE-----DSGMYQCVAENKHGTIYASAELAVQALAPDFRLNPVRRLIPAARGGEILIPCQPRAAPKAVVLWSKGTEIL-------------VNSSRVTVTPDGTLIIRNISRSDEGKYTCFAENFMGKANSTGILSVRDATKITLAPSSADINLGDNLTLQCHASHDPTMDLTFTWTLDDFPIDFDKPGGHYRRTNVKETI-------GDLTILNAQLRHGGKYTCMAQTVVDSASKEATV-LVRGPPGPPGGVVVRDIGDTTIQLSWSRGFDNHSPIAKYTLQ-ARTPPAGKWKQV--RTNPANIEGNAETAQVL-------GLTPWMDYEFRVIASNILGTGEPSGPSSKIRTREAAPSVAPSGLSGGGGAPGELIVNWTPMSREYQNGDGFGYLLSFRRQGSTHWQTAR------VPGADAQYFVYSNESVRPYTPFEVKIRSYNRRGDGPESLTALVYSAEEEPRVAPTKVWAKGVSSSEMNVTWE-PVQQDMNGILLGYEIRYW----KAGDKEAAADRVRTA-------GLDTSARVSGLHPNTKYHVTVRAYNRAGTGPASPSANATTMKPPPRRPPG--NISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLY 951          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Match: Q1JUB4 (Contactin/TAG-1 cell adhesion molecule OS=Dugesia japonica OX=6161 GN=DjCTCAM PE=2 SV=1)

HSP 1 Score: 1805.8 bits (4676), Expect = 0.000e+0
Identity = 886/1156 (76.64%), Postives = 1007/1156 (87.11%), Query Frame = 1
Query:  553 MKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCT-RLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLSXXXXXXGMIVKKCIV 4017
            MKWM NLT  TD NYFICE+ K  I++TV++SRSADFGQSDLTN+ RGPCI++QPTDQLYAP V++   VTFTC+VYG+PFP VSWYFT DTAQGPQRTLID +SYTNGKVTQTGG+LTINDPDNTFDNKIDCQ  NDYG+ ISRQVQIIRGRL+ Y +NPRQ+ R+ DNTGFMLDCEPP H P D++VYTFYITRKNDKGE VDD+IQSQLRNNIFLS+NLGLIGFSI S+KDSG YKC V W+G+ GTSY SP+IPLEV+ASNT+YP P+++DKFPNFKPSNPFLGDT+ FECFGYGEIKQNPLKYFW WN K LP KAVI+DFERRV L NIQFEDEGVY C IETMDG++S  RSV L+INAKPTFVVKPKNQYPD+GS++TLTCQA+G+P V +QWYRN++P S WL KNPD RYN+TEGN++ AL  I G+KTTDNAMIGCNIYN FG+ESA+IEL  VSL PNFDKYPLLN E ++G   IIPC+PEGSP PTITW+ +G  L+L P+NF+Q++G + C   +C +PN NLFIK+V+ S  G Y CTA N LG A+SSAYLDVI  L ++N PVGRRVQVN+NVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKI+NIQFYDEANYTCRVTTPF V    ALIQV+GPPGVGGGITVTP+VG V++ VEWTDGYDHG PILWYRLEV++ +  Q+W  L ++INKT I PI KQNNL+RNQ  FS LPANTNFRLRLFAANSFG+GEPS  SEVFKT AIPPQK+P+NVTGGGGKVGTLVIRWEPLLPLEENGDNF YEI+YKE+KE++WI+   F+NKSLDN KY QVT DLPANKDY+ F+V+VRA NI G GPWS +S ITS+SKLPS+AP +++A+S NSTAINV W AP++G GEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTL+G  L  G+I+GL  D YYCIGVQMFNTAGDSLESSFVDQTTFK PPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG PVRTALDVDVGLK+TG IN+LQYDVRYNMR+FAYSRGGNGKLSNPMDQFML+P+SRCQ+ K+IEGPDVRYVF+C   +  +SILLL + +IV + ++
Sbjct:    1 MKWMFNLTADTDLNYFICEASKRTISETVTISRSADFGQSDLTNVYRGPCIINQPTDQLYAPAVTSVNTVTFTCDVYGDPFPKVSWYFTTDTAQGPQRTLIDPMSYTNGKVTQTGGILTINDPDNTFDNKIDCQADNDYGSVISRQVQIIRGRLDSYNRNPRQIKRIADNTGFMLDCEPPAHSPDDTLVYTFYITRKNDKGETVDDIIQSQLRNNIFLSHNLGLIGFSIASLKDSGLYKCRVAWKGIAGTSYNSPEIPLEVYASNTIYPVPSINDKFPNFKPSNPFLGDTIEFECFGYGEIKQNPLKYFWTWNGKALPSKAVISDFERRVRLENIQFEDEGVYGCTIETMDGKISQPRSVKLTINAKPTFVVKPKNQYPDIGSTITLTCQAIGRPLVTVQWYRNDLPLSKWLMKNPDARYNYTEGNITTALFTITGMKTTDNAMIGCNIYNTFGRESAYIELFAVSLKPNFDKYPLLNKEGLVGMDVIIPCKPEGSPAPTITWSFNGGTLTLGPTNFDQILGKISCAGDICIMPNRNLFIKSVKTSHIGMYTCTAVNVLGTASSSAYLDVIPKLEISNFPVGRRVQVNSNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIFNIQFYDEANYTCRVTTPFAVEVIPALIQVLGPPGVGGGITVTPVVGTVNHTVEWTDGYDHGSPILWYRLEVSRVNVQQEWIILLDKINKTSITPINKQNNLVRNQLSFSGLPANTNFRLRLFAANSFGLGEPSSQSEVFKTEAIPPQKSPQNVTGGGGKVGTLVIRWEPLLPLEENGDNFEYEIQYKEAKEVDWISYTGFLNKSLDNGKYLQVTRDLPANKDYLPFEVKVRAVNIKGAGPWSAISTITSSSKLPSFAPLNINADSLNSTAINVQWAAPSVGQGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLYGSDLVKGIIIGLQPDKYYCIGVQMFNTAGDSLESSFVDQTTFKMPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGGPVRTALDVDVGLKVTGYINDLQYDVRYNMRIFAYSRGGNGKLSNPMDQFMLIPKSRCQSNKVIEGPDVRYVFVCCSCKNTISILLLSLAVIVSRFVM 1156          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Match: A0A074Z3P4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10050 PE=4 SV=1)

HSP 1 Score: 926.006 bits (2392), Expect = 0.000e+0
Identity = 530/1306 (40.58%), Postives = 765/1306 (58.58%), Query Frame = 1
Query:  154 CPSDD----AIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLL-----GARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLID-VPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYF----TKDTAQGP-----QRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGT----SYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNP-DP-RYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDC-TRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEV-AKEDGTQKWYPLKERINKT---DIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVR-TALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLS 3972
            CP D      + T CP GW+ +  NCY F  +   N++ ++  C +      GA LLRI+ L QH F S  L + AV R+++WYTAG M   S G +IW+G P   +    EL+ L +D +P +     +  DR++IVY     +W   L T      +IC++PK+V T+ +  ++S  +G+   T+ +RGPC L QP D LY  ++S+       C   GNP PT  WY     +K  A G      +RTLID     +G+++ + G L I+ PD++ D ++  C+  N+ G+ +SR  +I+ G+LE   K PR   R+  +    L C+PP H P+DS++YT Y+++      V+     +  R N+F+S   GLIGFS  +  D+G Y C+V  +   G     S K PD+P  V  SN     P ++D FP   PSNP  G  V  ECF  G  +   L Y W+     P+ P + + DF+R + L N+Q ED+G Y C++    G+ +  RSV L I AKP F     +   D+G+ VTLTC+A   P+    WYRN I  S  +++   DP RY     + + + L I  V+ +D++M  C  +N  G E++  EL+ +SL P F ++P++  E ++G S ++ C+PEG+P+    W  + + LS   S  +   G+  C T+ C+LPN NL I N+  +D G YAC ATNSLG+A SSA+L VI +L L  +PV R V  N+ V LPC+A+ +PYLDI+Y W+FE V++KFDR+DLDARRYD SQ +RPY RYFGTL+I NIQF +  NY+C   TP + IS+  LI+V GPPG   G+ V P +G     V WT G  H  PI  + +E  AK D  +KW  +   ++ T   ++ P+ ++   + N      L +N  +RLR+ A N+ GIG PS PS  F T A  P K P+N+TGGGGK GTLV +W PL P++ NG +F Y    +     E+     +  KSL+  K+ Q TL L  N  Y  +++++ A N MG GP +D   I SA+++P+ AP  V A + NS+AI V W  P    G+GP+ GY I+YW RVSDC+S+ +   R    QR T+  G +T GVI+GL AD YYCI VQ+FNTAGD LESSF +QTTFK  PQ++PT+V LN+T+ P+ I+V+W GV+  P+EES++GY IRYW  G+  + T  DVDVGL   G +  L+ + RY +RV+AYSRGG GK+S+P++QF ++P+++C  G   +GPD RY FIC G+  ++S
Sbjct:   25 CPDDKDFDPGMFTNCPDGWFGFDINCYTFFTTAPLNYLLAKKNCEVTLGKKHGALLLRIDTLEQHDFISKKLESIAVTRTMRWYTAGMMRPDSFGEFIWEGHPSSYQNVRAELMSLWLDRIPGVREKATFPADRTRIVYGSDGARWGWYLDTAVPARNYICQAPKAVATQLLPTAKSLTYGEYSTTSKRRGPCFLRQPEDVLYVQRLSSDTYAELMCEANGNPQPTFRWYSVSIESKTDASGVTVTWLKRTLIDPKKDMSGRISISAGSLVIHAPDSSTDAQLFQCEATNELGSVLSRTARIVFGQLEKAQKQPRNERRVLAHKSETLPCDPPPHSPQDSLLYTIYMSKDGQLEPVI-----TAYRPNLFISQAKGLIGFSEVTALDTGIYVCIVTMQ-FNGVRLFDSPKLPDMPFTVTQSNEPRQEPRIYDDFPAIWPSNPQRGQFVRLECFASGYSQFEGLTYTWRRREGLPIRPGS-LKDFDRVIELPNVQPEDQGEYECSVRDSLGKKATPRSVMLHITAKPYFPTPLHDTVADIGTDVTLTCEAAAIPEPEHAWYRNGIAVSDLISQGKLDPARYALISVSATRSNLRILKVQLSDSSMFTCLAWNNLGSEASSGELRVISLAPTFARHPVMPNEGMVGGSVVMECRPEGAPSMKTQWLHNAAVLSPGTSIMDPETGSATCPTKYCTLPNGNLLIVNLVNADAGEYACVATNSLGEARSSAFLTVIPSLQLQLSPVNRVVYENSTVLLPCRASSSPYLDINYAWFFEGVQIKFDRLDLDARRYDVSQLLRPYGRYFGTLRITNIQFENSGNYSCVAETPLSSISTGGLIRVAGPPGPCAGLMVDPQIGTHRVNVTWTVGNTHLSPITAFTIEANAKLDPPEKWTVVVSNLSLTATEELLPLGRRMAFVEN------LASNMAYRLRVRAINALGIGAPSPPSLWFTTLATAPTKMPQNITGGGGKHGTLVFQWVPLSPVDYNGPDFRYRAHIRAKGNNEYGIYELWNTKSLEGGKFLQYTLTLGENLYYKPYEIRMEAVNKMGVGPITDPVTIMSAARVPTNAPGGVTAGALNSSAITVWWTRPLPSEGQGPVGGYRILYWPRVSDCRSERSDIARYQLGQRQTVH-GDVTKGVIIGLDADTYYCIAVQLFNTAGDGLESSFTEQTTFKISPQDYPTMVILNATDMPNTIRVSWVGVQAKPDEESIEGYCIRYWPVGSQFKQTFTDVDVGLNTFGYVRGLETNKRYYLRVYAYSRGGVGKMSSPVNQFQIIPKAQCIPGATWDGPDFRYNFICKGASLRIS 1316          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Match: A0A4S2LKJ4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006513 PE=4 SV=1)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 527/1297 (40.63%), Postives = 760/1297 (58.60%), Query Frame = 1
Query:  154 CPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLID-VPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYF----TKDTAQGP-----QRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGT----SYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNP-DP-RYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDC-TRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEV-AKEDGTQKWYPLKERINKT---DIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVR-TALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLS 3972
            CP D      CP GW+ + TNCY F  +    ++ ++  C   GA LLRI+ L QH F S  L + AV R+++WYTAG M   S G +IW+G P   +    EL+ L +D VP +     +  DR++IVY     +W   L T      +IC++PK++  + +  ++S  +G+   T  +RGPC L QP D LY  ++S+       C   GNP P   WY     +K  A G      +RTLID     +G+++ + G L I+ PD++ D ++  C+  N+ G+ +SR  +++ G+LE   K PR   R+  +    L C+PP H P+DS++YT Y+++      V+     +  R N+F+S   GLIGFS  +  D+G Y CM+  +   G     S K PD+P  V  SN     P ++D FP   PSNP  G  V  ECF  G  +   L Y W+     P+ P + + DF+R + L N+Q ED+G Y C++    G+ +  RSV L I AKP F     +   D+G++VTLTC+A   P+    WYRN I  S  +++   DP RY+    + + + L I  V+ +D++M  C  +N  G E++  EL+ +SL P F ++P++  E ++G S ++ CQPEG+P+    W  + + LS S S  +   G+  C T+ C+LPN NL I N+  +D G YAC ATNSLG+A SSA+L VI +L L  +P+ R V  N+ V LPC+A+ +PYLDI+Y W+FE V++KFDR+DLDARRYD SQ +RPY RYFGTL+I NIQF +  NY+C   TP + IS+  LI+V GPPG  GG+ V P +G     V WT G  H  PI  + +E  AK D  +KW  +   ++ T   ++ P+ ++   + N      L +N  +RLR+ A N+ GIG PS PS  F T A  P K P+N+TGGGGK GTLV +W PL P++ NG +F Y    +     E+     +  K L+  K+ Q TL L  N  Y  +++++ A N MG GP +D   I SA+++P+ AP  V A + NS+AI V W  P    G+GPI GY I+YW RVSDC+S+ +   R    QR T+  G +T GVI+GL AD YYCI VQ+FNTAGD LESSF +QTTFK  PQ++PT+V LN+T+ P+ I+V+W GV+  P+EES++GY IRYW  G+  + T  DVDVGL   G +  L+ + RY +RV+AYSRGG GK+S+P++QF ++P+++C  G   +GPD RY FIC  +  + S
Sbjct:   39 CPHDKDFDPDCPDGWFGFDTNCYTFFTAIPLTYLLAKKTCEKHGALLLRIDTLEQHDFISKKLESIAVTRTMRWYTAGMMRPDSFGEFIWEGHPSRYQNVRAELMSLWLDQVPGVREKATFPADRTRIVYGSNGARWGWYLDTAIPARNYICQAPKAMANQLLPTAKSLTYGEYSTTPKRRGPCFLRQPEDVLYVQRLSSDTYAELMCEANGNPQPNFRWYSVSIESKTDASGVTVTWLKRTLIDPTKDMSGRISISAGSLVIHAPDSSTDAQLFQCEATNELGSVLSRTARVVFGQLETAQKQPRNERRVLAHKSETLPCDPPPHSPQDSLLYTVYMSKDGQLEPVI-----TAYRPNLFISQAKGLIGFSEVTALDTGIYVCMITMQ-FNGVRLFDSPKLPDMPFTVTQSNEPRQEPRIYDDFPAIWPSNPQRGQFVRLECFASGYSQFEGLTYTWRRREGLPIRPGS-LKDFDRVIELPNVQPEDQGEYECSVRDSLGKKATPRSVMLHITAKPYFPTPLHDTVADIGTNVTLTCEAAAIPEPEHAWYRNGIAVSDLISQGKLDPARYSLISVSATRSNLRIMKVQLSDSSMFTCLAWNNLGSEASSGELRVISLSPTFARHPVMPNEGMVGGSVVMECQPEGAPSMETQWLHNAAVLSPSTSIMDPETGSATCPTKYCTLPNGNLLIVNLVNADAGEYACVATNSLGEARSSAFLTVIPSLQLQLSPMNRVVYENSTVLLPCRASSSPYLDINYAWFFEGVQIKFDRLDLDARRYDVSQLLRPYGRYFGTLRITNIQFENSGNYSCVAETPLSSISTGGLIRVAGPPGPCGGLMVDPQIGTHRVNVSWTVGNTHLSPITAFTIEANAKLDPPEKWTVVVSNLSITATEELLPLGRRMAFVEN------LASNMAYRLRVRAINALGIGAPSPPSLWFTTLATAPTKMPQNITGGGGKHGTLVFQWVPLSPVDYNGPDFRYRAHIRAKGNNEYGIYELWNTKPLEGGKFLQYTLTLGENLYYKPYEIRMEAVNKMGAGPITDPVTIMSAARVPTNAPGGVTAGALNSSAITVWWTRPLPSEGQGPIGGYRILYWPRVSDCRSERSDIARYQLGQRQTVH-GDVTKGVIIGLDADTYYCIAVQLFNTAGDGLESSFTEQTTFKISPQDYPTMVILNATDIPNTIRVSWVGVQAKPDEESIEGYCIRYWPVGSQFKQTFTDVDVGLHTFGYVRGLETNKRYYLRVYAYSRGGVGKMSSPVNQFQIIPKAQCIPGATWDGPDFRYNFICKSAGLRSS 1321          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Match: A0A4V3SEE0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006513 PE=4 SV=1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 527/1297 (40.63%), Postives = 760/1297 (58.60%), Query Frame = 1
Query:  154 CPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLID-VPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYF----TKDTAQGP-----QRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGT----SYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNK-PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNP-DP-RYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDC-TRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEV-AKEDGTQKWYPLKERINKT---DIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVR-TALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLS 3972
            CP D      CP GW+ + TNCY F  +    ++ ++  C   GA LLRI+ L QH F S  L + AV R+++WYTAG M   S G +IW+G P   +    EL+ L +D VP +     +  DR++IVY     +W   L T      +IC++PK++  + +  ++S  +G+   T  +RGPC L QP D LY  ++S+       C   GNP P   WY     +K  A G      +RTLID     +G+++ + G L I+ PD++ D ++  C+  N+ G+ +SR  +++ G+LE   K PR   R+  +    L C+PP H P+DS++YT Y+++      V+     +  R N+F+S   GLIGFS  +  D+G Y CM+  +   G     S K PD+P  V  SN     P ++D FP   PSNP  G  V  ECF  G  +   L Y W+     P+ P + + DF+R + L N+Q ED+G Y C++    G+ +  RSV L I AKP F     +   D+G++VTLTC+A   P+    WYRN I  S  +++   DP RY+    + + + L I  V+ +D++M  C  +N  G E++  EL+ +SL P F ++P++  E ++G S ++ CQPEG+P+    W  + + LS S S  +   G+  C T+ C+LPN NL I N+  +D G YAC ATNSLG+A SSA+L VI +L L  +P+ R V  N+ V LPC+A+ +PYLDI+Y W+FE V++KFDR+DLDARRYD SQ +RPY RYFGTL+I NIQF +  NY+C   TP + IS+  LI+V GPPG  GG+ V P +G     V WT G  H  PI  + +E  AK D  +KW  +   ++ T   ++ P+ ++   + N      L +N  +RLR+ A N+ GIG PS PS  F T A  P K P+N+TGGGGK GTLV +W PL P++ NG +F Y    +     E+     +  K L+  K+ Q TL L  N  Y  +++++ A N MG GP +D   I SA+++P+ AP  V A + NS+AI V W  P    G+GPI GY I+YW RVSDC+S+ +   R    QR T+  G +T GVI+GL AD YYCI VQ+FNTAGD LESSF +QTTFK  PQ++PT+V LN+T+ P+ I+V+W GV+  P+EES++GY IRYW  G+  + T  DVDVGL   G +  L+ + RY +RV+AYSRGG GK+S+P++QF ++P+++C  G   +GPD RY FIC  +  + S
Sbjct:   25 CPHDKDFDPDCPDGWFGFDTNCYTFFTAIPLTYLLAKKTCEKHGALLLRIDTLEQHDFISKKLESIAVTRTMRWYTAGMMRPDSFGEFIWEGHPSRYQNVRAELMSLWLDQVPGVREKATFPADRTRIVYGSNGARWGWYLDTAIPARNYICQAPKAMANQLLPTAKSLTYGEYSTTPKRRGPCFLRQPEDVLYVQRLSSDTYAELMCEANGNPQPNFRWYSVSIESKTDASGVTVTWLKRTLIDPTKDMSGRISISAGSLVIHAPDSSTDAQLFQCEATNELGSVLSRTARVVFGQLETAQKQPRNERRVLAHKSETLPCDPPPHSPQDSLLYTVYMSKDGQLEPVI-----TAYRPNLFISQAKGLIGFSEVTALDTGIYVCMITMQ-FNGVRLFDSPKLPDMPFTVTQSNEPRQEPRIYDDFPAIWPSNPQRGQFVRLECFASGYSQFEGLTYTWRRREGLPIRPGS-LKDFDRVIELPNVQPEDQGEYECSVRDSLGKKATPRSVMLHITAKPYFPTPLHDTVADIGTNVTLTCEAAAIPEPEHAWYRNGIAVSDLISQGKLDPARYSLISVSATRSNLRIMKVQLSDSSMFTCLAWNNLGSEASSGELRVISLSPTFARHPVMPNEGMVGGSVVMECQPEGAPSMETQWLHNAAVLSPSTSIMDPETGSATCPTKYCTLPNGNLLIVNLVNADAGEYACVATNSLGEARSSAFLTVIPSLQLQLSPMNRVVYENSTVLLPCRASSSPYLDINYAWFFEGVQIKFDRLDLDARRYDVSQLLRPYGRYFGTLRITNIQFENSGNYSCVAETPLSSISTGGLIRVAGPPGPCGGLMVDPQIGTHRVNVSWTVGNTHLSPITAFTIEANAKLDPPEKWTVVVSNLSITATEELLPLGRRMAFVEN------LASNMAYRLRVRAINALGIGAPSPPSLWFTTLATAPTKMPQNITGGGGKHGTLVFQWVPLSPVDYNGPDFRYRAHIRAKGNNEYGIYELWNTKPLEGGKFLQYTLTLGENLYYKPYEIRMEAVNKMGAGPITDPVTIMSAARVPTNAPGGVTAGALNSSAITVWWTRPLPSEGQGPIGGYRILYWPRVSDCRSERSDIARYQLGQRQTVH-GDVTKGVIIGLDADTYYCIAVQLFNTAGDGLESSFTEQTTFKISPQDYPTMVILNATDIPNTIRVSWVGVQAKPDEESIEGYCIRYWPVGSQFKQTFTDVDVGLHTFGYVRGLETNKRYYLRVYAYSRGGVGKMSSPVNQFQIIPKAQCIPGATWDGPDFRYNFICKSAGLRSS 1307          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Match: A0A3Q0KTI2 (Septate junction protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 524/1297 (40.40%), Postives = 753/1297 (58.06%), Query Frame = 1
Query:  154 CPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLID-VPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYF---------TKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSP---DIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWK-WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAK---NPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDC-TRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEV-AKEDGTQKWYPLKERINKTD---IKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPV-RTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLS 3972
            CP DD   T CP GW+++  NCY F     SN++ +R  C   G  LLRI+ L +HQF +D LN+ AVNRS++WYTAG M   S G ++W+G P   ++  +EL+ L +D +P       + K R+++VY     +W   L TPT +   IC +P +   + + +S+S  +G      + RGPC +  P D LY   +S  K     C   GNP PT  WY+         T DT     RTLIDA +  +G+++ + G L I++PD + D+++  C+ +N YG+ +SR  +II G+LE   K PR    +  +    L CEPP H P DS++YT Y+   N  GE+  + +  + R N+F+S   GLIGFS  +V DSG Y CM+  +      Y SP   D+P  V  SN     P ++D FP   P+NP  G  V  ECF  G  + + LKY W+  +  PL   + + D++R + L N+Q ED+G Y CN+E   G+++  +++ L I AKP F    +N   D+ S V LTC+A G P    +WYRN+I  S  +A    NP  +Y       + + L I  VK +D+ M  C  +N  G E++  E++ + L P F K+P++  E ++G++ ++ CQPEG+P  T+ W  DG+ L+ S S  +   G  +C T+ C LP+ NL I ++  SD G Y C A N+LG+A SSA L +I  L ++  P+ R V  N+ V LPC+   + YLD++Y WYFE V LKFDR+DLDARRY+ +Q  RPY  YFGTLKI N+QF +  NYTC   TP N  SSS +I++ GPPG  GG+ V P VG     V W  G  H   IL++++E  A  D   +W  +   ++ +    +KP  ++  ++RN      L AN  +R+R+ A N+ G+GEPS PS  F T    P   P+NVTGGGGK GTLV +W PL  + ENG NF Y    K  +  E+   + +  K  D+ K+ Q TL L  N  Y  + V V+A N  G GP S+   + SA+++P+ AP  V A +FN ++I V W  P    GEGP  GY I+YW R+SDC+S  +   R    QR T+  G +T G+I+GL AD YYCI VQ+FN+AGD  ESSF +QTTFK  P+ FPT+V LN+T  P+ I+V+W G++  P EESV+GY IRYW +G+   RT  D++VGL+  G +++L+ DVRYN+RV+ YSRGG G +S+P++QF ++ + +C  G   +GPD RY FIC G   ++S
Sbjct:   26 CPQDDIWDTNCPDGWFNFEANCYSFFVQDPSNYLAARKNCETHGGLLLRIDTLEEHQFVADRLNDIAVNRSLRWYTAGVMRPDSFGEFMWEGHPLSYQSVRSELLHLWLDTIPKPAERPTFPKVRTRLVYGTDRNRWGWYLDTPTAHRGHICRAPVANANQLLPLSKSLAYGSDFPNRMARGPCFIAHPKDVLYVHHMSTEKYAELRCEANGNPQPTYKWYYVSTEMRTNSTGDTITILHRTLIDAAAEPSGRISISAGSLVIHNPDTSTDSQMFQCEAKNIYGSILSRTARIIFGQLETAPKQPRNERIVMSHQSETLPCEPPAHSPPDSLLYTVYM---NKNGEL--EPVLPEYRRNLFISQAKGLIGFSEVTVVDSGVYVCMITMQFDGHRMYDSPKLPDMPFTVRYSNEPRQDPRIYDDFPAVWPTNPQRGQLVRLECFAAGYSQLDGLKYSWRRLDGAPLRTDS-LKDYDRVIELPNVQPEDQGEYECNVEDSLGKMARPKTLNLKITAKPYFTTPLQNTVVDINSDVFLTCEASGIPNPTHEWYRNDITVSQLIATGKLNPT-QYTIIRDGPTRSTLRIQKVKLSDSGMFTCLAWNSLGSEASSAEVRVLELAPTFRKHPVMPNEGMVGSTAVMECQPEGAPAMTVEWLHDGTVLTTSDSWLDPETGTANCATKYCKLPSKNLLIVDLVESDAGQYTCIAKNTLGQAESSALLTIIPQLKMSLTPISRVVYRNSTVLLPCRVQSSSYLDVNYAWYFEGVNLKFDRLDLDARRYELAQLYRPYGNYFGTLKIVNVQFENSGNYTCAAETPLNSQSSSGVIRIAGPPGPCGGVVVDPHVGVDRVNVSWAVGTSHLFQILYFQIEANAMYDPPNQWMIMASNVSISSTKLLKPSDRRMTVVRN------LAANMAYRIRVRAGNALGLGEPSPPSLSFTTLPTKPTLIPQNVTGGGGKHGTLVFKWIPLKRVNENGPNFHYRAHIKAKENAEYSIHDLWTAKMSDDGKFMQYTLTLGDNLFYKPYDVMVQAVNSEGAGPLSEPVTVMSATRVPTNAPSGVTAGAFNCSSIRVWWYPPLPSEGEGPTWGYRILYWPRISDCRSLESDRARHQLGQRQTVH-GDVTEGLIIGLDADTYYCIAVQIFNSAGDGPESSFTEQTTFKTAPREFPTMVTLNATGIPNTIRVSWVGIQARPNEESVEGYCIRYWPTGSQFKRTFKDINVGLQTFGYVSDLKTDVRYNLRVYGYSRGGVGTMSSPVNQFQIITKEKCIPGATWDGPDFRYNFICKGHPIRIS 1308          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:103023464])

HSP 1 Score: 287.73 bits (735), Expect = 3.067e-80
Identity = 292/1071 (27.26%), Postives = 440/1071 (41.08%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNT-FDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTE-AIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGT-LKIYNIQFYDEANYTCRVTTPF-NVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLD---LPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG---APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            GP   +QP D +Y P+ S    +  +C    +P  T  W   K   +  Q    D  S       Q GG L I++PD +       C   N++GT ISR+  +  G L++++   R+ + + +  G +L C PP H P D     ++  F I    DK   V     SQ   N+++S   G          DSG Y C V        S  S  IPL       +   P ++  KFP+   +   +G  +  ECF  G    NP+ +  W+  +  LP    I+     + L N+Q+EDEGVY C  E ++ +        L + A P +V    +   D+GS  T++C A GKP+  +++ +N               Y   E       L    + + D+ M  C   N  G   A  EL+     P+F+  P+   +        +I C+P  +P PT TW+K    LS             + +R+    + +L I+NV  SD+G Y C A N  G+ANS+    V +A  +T  P    V V  N  + C A+    LD+ + W      L  + +DLD  R      M        + L I N Q      YTC   TP  NV +S+ L+    P   GG +       +V  V  W+ G D+  PI  Y ++  +    ++ + L      T   P  + N           L   T +  R+ A N+ G GE S PS   +T    P  AP +V GGGG    L I W P+ P    G NF Y I +K     EW           D    R V  D   LPA K    F+V+V+A N  G GP+S  + I SA  +PS AP  V A + ++T   + W    I   +  ++GY + YW +  + ++ A      +   RL              +  D +Y I V+ FN AG    S   +  T K PP   P I+     ++   + + W  VR +  E SV+ Y++ Y   G     + T     + L        +  D  Y + V A+S GG+G ++ 
Sbjct:   38 GPVFQEQPVDTIY-PEESPEDKIIMSCRAQASPPATYKWRLNKWEIE-IQEGSDDHYSL------QLGGNLVISNPDKSKHAGNYSCLATNEFGTVISREAFVQFGYLDMFSTEEREAVYVKEGQGVVLLCAPPPHFPDDLSFRWMLNEFPIFIPLDKRRFV-----SQTTGNLYISKVEG---------SDSGNYSCFVT-SSSISKSVFSKFIPLVPLVERPIRKYPADIRVKFPD---TYALVGQNITLECFALG----NPIPQIRWRKVDGALPVHHDISMAGGLLHLFNVQYEDEGVYEC--EALNSKGKDWHKAHLYVEASPEWVEHISSSERDIGSDYTMSCLASGKPKPHVRFLKN------------GQMYGMHE-------LSFTDLTSDDSGMYQCIAENRHGVIYANAELRVFVGAPSFELNPVKQRQLGAKNGRVVIECKPRAAPRPTFTWSKGTEMLS-------------NSSRIFIWEDGSLEIRNVTKSDEGKYTCFAENDRGRANSTGSFLVTDATKITLAPTNADVSVGENARMQCAASHDSSLDLTFIW-----SLNGNPVDLDKDREYYQHVMDGQAGMSSSELLIKNTQLKLAGRYTCTAQTPVDNVTASAELVVRGPPGPPGGLLVKDIGPKSVRLV--WSQGSDNLSPISRYTIQYREVRTPEEDWKL-----ATTSPPNVEGNA---EAATVDGLIPWTEYEFRVTATNTLGTGEHSNPSPKIQTLDAVPVVAPSDVGGGGGMSRELTITWTPVQPQYYYGSNFGYIIAFKPEGGFEWRKVT-----VADPQARRYVHKDSSILPATK----FEVKVKAFNSKGEGPYSLTAVIYSAQDVPSEAPTIVEARTLSATEAVIWW----IPVPQQTVEGYQVRYWRKSMENEALAMRISSKDNQTRLD------------NMKPDSHYVIEVRAFNGAGYGPASQRYEIHTKKAPPSRLPKIISKKMHSSGATVNIAWEPVRPLANESSVECYKVLYRQDGQNTGTLYTTTKQSIDLP-------MHKDGDYLVEVRAHSEGGDGAVAQ 997          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Match: CNTN1 (contactin 1 [Source:NCBI gene;Acc:103023464])

HSP 1 Score: 287.345 bits (734), Expect = 1.219e-79
Identity = 292/1071 (27.26%), Postives = 440/1071 (41.08%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNT-FDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS----IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTE-AIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGT-LKIYNIQFYDEANYTCRVTTPF-NVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLD---LPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSG---APVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            GP   +QP D +Y P+ S    +  +C    +P  T  W   K   +  Q    D  S       Q GG L I++PD +       C   N++GT ISR+  +  G L++++   R+ + + +  G +L C PP H P D     ++  F I    DK   V     SQ   N+++S   G          DSG Y C V        S  S  IPL       +   P ++  KFP+   +   +G  +  ECF  G    NP+ +  W+  +  LP    I+     + L N+Q+EDEGVY C  E ++ +        L + A P +V    +   D+GS  T++C A GKP+  +++ +N               Y   E       L    + + D+ M  C   N  G   A  EL+     P+F+  P+   +        +I C+P  +P PT TW+K    LS             + +R+    + +L I+NV  SD+G Y C A N  G+ANS+    V +A  +T  P    V V  N  + C A+    LD+ + W      L  + +DLD  R      M        + L I N Q      YTC   TP  NV +S+ L+    P   GG +       +V  V  W+ G D+  PI  Y ++  +    ++ + L      T   P  + N           L   T +  R+ A N+ G GE S PS   +T    P  AP +V GGGG    L I W P+ P    G NF Y I +K     EW           D    R V  D   LPA K    F+V+V+A N  G GP+S  + I SA  +PS AP  V A + ++T   + W    I   +  ++GY + YW +  + ++ A      +   RL              +  D +Y I V+ FN AG    S   +  T K PP   P I+     ++   + + W  VR +  E SV+ Y++ Y   G     + T     + L        +  D  Y + V A+S GG+G ++ 
Sbjct:  111 GPVFQEQPVDTIY-PEESPEDKIIMSCRAQASPPATYKWRLNKWEIE-IQEGSDDHYSL------QLGGNLVISNPDKSKHAGNYSCLATNEFGTVISREAFVQFGYLDMFSTEEREAVYVKEGQGVVLLCAPPPHFPDDLSFRWMLNEFPIFIPLDKRRFV-----SQTTGNLYISKVEG---------SDSGNYSCFVT-SSSISKSVFSKFIPLVPLVERPIRKYPADIRVKFPD---TYALVGQNITLECFALG----NPIPQIRWRKVDGALPVHHDISMAGGLLHLFNVQYEDEGVYEC--EALNSKGKDWHKAHLYVEASPEWVEHISSSERDIGSDYTMSCLASGKPKPHVRFLKN------------GQMYGMHE-------LSFTDLTSDDSGMYQCIAENRHGVIYANAELRVFVGAPSFELNPVKQRQLGAKNGRVVIECKPRAAPRPTFTWSKGTEMLS-------------NSSRIFIWEDGSLEIRNVTKSDEGKYTCFAENDRGRANSTGSFLVTDATKITLAPTNADVSVGENARMQCAASHDSSLDLTFIW-----SLNGNPVDLDKDREYYQHVMDGQAGMSSSELLIKNTQLKLAGRYTCTAQTPVDNVTASAELVVRGPPGPPGGLLVKDIGPKSVRLV--WSQGSDNLSPISRYTIQYREVRTPEEDWKL-----ATTSPPNVEGNA---EAATVDGLIPWTEYEFRVTATNTLGTGEHSNPSPKIQTLDAVPVVAPSDVGGGGGMSRELTITWTPVQPQYYYGSNFGYIIAFKPEGGFEWRKVT-----VADPQARRYVHKDSSILPATK----FEVKVKAFNSKGEGPYSLTAVIYSAQDVPSEAPTIVEARTLSATEAVIWW----IPVPQQTVEGYQVRYWRKSMENEALAMRISSKDNQTRLD------------NMKPDSHYVIEVRAFNGAGYGPASQRYEIHTKKAPPSRLPKIISKKMHSSGATVNIAWEPVRPLANESSVECYKVLYRQDGQNTGTLYTTTKQSIDLP-------MHKDGDYLVEVRAHSEGGDGAVAQ 1070          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Match: cntn2 (contactin 2 [Source:ZFIN;Acc:ZDB-GENE-990630-12])

HSP 1 Score: 281.567 bits (719), Expect = 2.459e-78
Identity = 264/1037 (25.46%), Postives = 437/1037 (42.14%), Query Frame = 1
Query:  664 GQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDN-KIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDS---IVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWR-GLTGTSYKSPDIPLEVFASNT-LYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFN-VISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALD 3747
            G+  ++    GP   +QP+  +Y   +   K VT  C    +P  +  W               + L   +   T   G L IN+P +  D+    C   N  GT +SR   +  G L  +    R      + TG  L C+ P H P  S   I+  F    + D G        SQ+  N++L+              D+G Y C+      ++  S  S  + L V    T     PN+  +FP+   +    G T   ECF YG    NP  K  W+  +  LP K   +     +TL ++ F+DEGVY C   + +GR +    V  S+ A+P ++    +   ++ S +  +C A GKP+  ++W RN +P S             T+  V V            N ++  +  N  G   +  EL+     P+F   P+     A  G    + C+P  +P PT+ W++ G++L              + +R+  +P+  L+I N+  +D+G Y C A N LGKANS+ +L V +A  +T  P    +    NV L C A+  P +D+ + W    V L  +  +    R +  + +       G L I N Q      YTC   T  +  ++S  L+    P   GG +  +     V   + W+ GYD+  PI  Y + + + + +  W   K R +  +I+   +   +I       +L    ++  ++ A+N  G GEPS PS+  +T    P  AP  + GGGG    L+I W P+    +NGD F Y + +++     W         S+++ +Y      L     Y  F+V+++A N  G GP+S ++ + SA + P+ +P+ ++A +  +  I V W+     S  G ++GY I YW +      + A+ DR+ T+       G   +  + GL  +  Y + V  +N+AG    S      T K PP   P  V   +      + + W+ V+ M  E +V GY++ Y   G      LD
Sbjct:    6 GEVCVSGHDSGPVFEEQPSSLIYPEGLPEGK-VTLNCQARASPAASYRWRVNGS----------EVLIGEDSHYTLVAGNLVINNPQHGRDSGSYQCLAVNRCGTIVSRAANLKFGYLRDFPLEGRSPQTAYEGTGTFLACQAPAHYPALSYRWILNEFPSFVQPDGGRW----FVSQVTGNLYLAN---------ARTNDTGNYFCLTTINMDISTKSTFSKAVQLTVQPEATPRKSAPNIRVRFPS--ETYALAGHTTQLECFAYG----NPTPKLRWRKVDGILPSKVGASADGPILTLPDLSFDDEGVYECEAYSSEGRDTHQGRV--SVQAQPEWLQVMSDSEVEISSELHWSCVAAGKPRPSIRWLRNGLPLS-------------TQDRVEVT-----------NGLLKISNLNKHGTIYSNAELRVQVQAPDFRLNPVRKLVPAARGGQVKMECKPRAAPKPTLFWSR-GTEL------------LTNSSRVTVMPDGVLWIYNISRADEGKYTCFAENYLGKANSTGHLSVRDATKITLAPSNADINQGENVTLQCHASHDPTMDLTFTWSLNGVLLDLEEPNGHYHRIEGKENI-------GDLAIVNTQLSQAGIYTCSAQTVVDSAVASGRLVVRGPPGPPGGLVVKSVNETAVE--LRWSRGYDNHSPIGKYVI-MGRSEHSHDWK--KMRTDPANIEGNAESARVI-------DLRPWMDYEFQVIASNILGSGEPSMPSQPVRTKQAAPTVAPSGLGGGGGDRNELIITWTPMAREYQNGDGFGYILAFRKLDAPAWTVVR---VPSVESSRYVYTNQSL---SPYCPFEVKIKAYNRKGEGPFSQIAVVHSAEEEPTVSPRKINATALTAFEILVSWEPVQHLSTNGVLRGYEIRYWRQ----HEREAAADRVRTA-------GLENTARVSGLRPNTLYHVTVLAYNSAGTGQPSPRTTVITKKPPPNRPPGNVSWKTDGA--WVTLRWDHVKSMDNESTVQGYKVLYKHEGQSALKVLD 935          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Match: cntn3b (contactin-3-like [Source:NCBI gene;Acc:103046198])

HSP 1 Score: 280.796 bits (717), Expect = 6.109e-78
Identity = 289/1083 (26.69%), Postives = 452/1083 (41.74%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYF--TKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTF----YITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKW-NNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNG 3906
             GP   ++P+D L  P  S ++    TC   G P P   W    T    +G +R L+            +GG L I   D   D+ +  C   N +G+ +S++  +    LE +   PR  + + +  G +L C  P H  + +  + F    Y  +++ +                F+S   G +  +     D G Y C+V    +T     S   PL +     +    P +   FP   P+    G +V  ECF  G    NP+ +  W+  ++ P P K  + +    + +   Q ED G Y C  E   G+ + AR   LS +AKP ++    +    +  ++   C+A GKP+    W +N  P        P+ R     G +S++ L++     +D  M  C   N  G   +  EL  ++  P+F + PL N  +A  GT   + C+P+ SP     W +    L  +              R    PN  L I NV   D G Y C A N  G A+++  L +     +T  P    + V  ++ LPCQ    P L++ + W F    + F +        D   F R   R  G L I NIQ +    Y C V T    +S  A++ V GPPG    + V  +  + +  + W+ G D+G PI  Y ++ A+   T  W          D  P     N +    V  +L A   +  R+ A+NS G+GEPS PS   +T    P  AP +V GGGG    LVI WEP+    +NG++F Y I ++    + W  A      S+    YR  +L       +  + V+V A N  G GP+S ++ + SA ++PS AP+ + A S  ++ I V W+   + S    + GY +VYW    D K       R+N         G  T+  + GL  +  Y + V  FNTAG   +SS V+ TT K PP   P  V  +   +  Q+ + W+ V  +  E  V GY + Y       R      +    T +  NL  +  Y +++ + S GG G+   P+    L   +R   G
Sbjct:   27 HGPSWRNEPSD-LILPINSPNQEAVLTCQASGVPSPQYRWSLNGTLIDLRGDERRLV------------SGGNLIIRGLDRDQDSGVYQCSASNTHGSILSQRASLQFAYLENFKTQPRSAVNVREGQGVVLLCGTPLHSGELTFAWVFNEYPYFVQQDSRR---------------FVSQETGNLYIAKVEPSDVGNYTCVVN-NSITKDKVLSSPTPLVLRNDGAMGEYEPKIEVHFPETVPAAK--GSSVKLECFALG----NPVPRISWRRTSDVPFPSKVKLKNSNAILEIPRFQQEDTGTYECVAENSRGK-NAARG-RLSFHAKPHWLQTMTDTALSIEENLFWECKASGKPKPSYSWLKNGEPLM------PEGRVLIENGALSISSLIL-----SDGGMYQCVAENKHGIVYSSAELMVLASPPSFSQSPLRNILKARAGTEVTLECRPQASPRAMSLWKRGSEMLQKN-------------ERFSFFPNGTLKISNVTKRDGGIYTCIAKNQFGSASTAGRLLITEPTRITQAPGSLEIIVGESIVLPCQVTLDPALEVIFTWTFNGQTIDFLQ--------DSDHFERVGGRNAGDLMIRNIQLHHGGKYVCVVDTDVESLSVDAVLIVKGPPGPPDTVLVEEITDSTAQ-LSWSPGRDNGSPITGYIVQ-ARTPFTVGW-------QAVDTVPEVINGNTLTATVV--DLNAWVEYEFRVVASNSVGMGEPSPPSPKTRTEDSIPDTAPTDVGGGGGTKSELVITWEPVPEELQNGESFGYIIAFRPMGTVTWTRA-VISAPSVARYVYRNDSL-----PPFSPYDVKVGAFNKRGEGPFSSIATVYSAEEVPSVAPERLTARSLTASDIQVTWE--PVQSSPERVLGYEVVYWE--DDTKPDTVGRVRIN---------GNSTAANVSGLDGNTLYFLAVCAFNTAGTGPQSSPVNATTKKPPPSQPPQGVEWSLIGS--QLTLQWDPVIALDTESEVTGYVVLYRRH----RNNDMYTITTNKTSVELNLSPNDNYVIQIKSLSEGGLGEGCEPIHIHQLSMGARGSGG 1004          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Match: cntn3a.2 (contactin-3 [Source:NCBI gene;Acc:103045683])

HSP 1 Score: 274.633 bits (701), Expect = 7.603e-76
Identity = 300/1076 (27.88%), Postives = 444/1076 (41.26%), Query Frame = 1
Query:  691 RGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWK-WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNT-EAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGT-----LKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINN---LQYDVRYNMRVFAYSRGGNGKLSNPMDQFML 3879
             GP    +P+D L  P     +  T TC+  G P P   W            TLID  +    +++  GG L I   D   D  I  C   N  G  +SR+  +    L   T+  R  + + +  G +L C  P +    S  + F     N+    V      Q  N  F+S   G +  +     D G Y C+V  R   G    SP  PL +     +    P +   FP+  P+    G  V  ECF  G    NP+ +  W+  N  P P K  + +    + + + Q ED G Y C  E   G+ ++     LS +AKP +V   K+    +   +   C+A GKP+    W RN    ++      + R     G +++A      V  +D  M  C   N  G      EL  ++  P+F + PL    +A  G++  + C+P+  P    TW K    L  S              R+  LP+  L I NV  +D G Y C A N  G A+++  L V +    T  PV   + V  ++ LPCQ A  P LD+ + W F    L  +++D             P+Y + G      L I NIQ      Y C V T    +S +A++ V GPPG   G+TV  +  + +  + W  G D+G PI+ Y ++  K   T  W          +  P     N +    V  +L A   +  R+ A NS G+GEPS  S   +T    P  AP NV GGGG    LVI WEP+    +NGD F Y I  +   E+ W  A   +  +     YR  +  +PA   +  F V+V A N  G GP+S V+ + SA + PS  P  V A S +++   V W+   +      + GY +VYW    D K +     R++ +Q             I GL     Y + V  FNTAG    +  ++ TT K PP   P  V  N   +  ++ V W+ V  M  E  V GY++ Y       R     ++ L  T L +    L  D  Y +++ A S GG G  + P++   L
Sbjct:   27 HGPKWRMEPSD-LMVPVDLPEEEATLTCDAKGLPAPQYRWSLNG--------TLIDLRADPRRRLS--GGNLVIRSLDRAQDAGIYQCTAFNPLGAILSRRASLQFAYLNFKTQT-RSAVSVREGQGVVLLCGTPTYAGDLSFAWVF-----NEYPYFV------QQDNRRFVSQETGNLYIAKVEPSDVGNYTCVVVNRITKGKVLSSP-TPLVLRTDGAMGEYEPKIEVHFPDTVPAAK--GSVVTLECFALG----NPVPEITWRRANGVPFPSKVKMKNSNVVLEIPSFQQEDAGGYECVAENKMGKNTVKGR--LSFHAKPQWVQTMKDSALSIEERLFWECKANGKPKPSYSWLRNGELLTT------EDRIQIDSGALTIA-----SVNLSDAGMYQCVAENKHGIIYFSAELVVLASPPDFSRNPLRGLLKAKTGSAVSMACKPQAYPAAISTWRKGSEVLQQS------------SERVSLLPDGTLRIVNVTKTDGGIYTCLARNQFGTASTTGRLLVTDPTRFTQGPVDMEIIVGESIVLPCQIACDPALDVSFSWAFNGQIL--NKLD-------------PHYEHVGGSTAGDLMIRNIQLKHAGKYVCVVDTDVESLSVAAILIVKGPPGAPDGVTVEEITDSTAQ-LSWRPGQDNGSPIISYIIQT-KTAFTVGW-------QAVNTVPEVIDGNTLTATVV--DLNAWVEYEFRVLARNSVGVGEPSPSSLKTRTEDSVPDTAPANVGGGGGSKSELVITWEPVPEELQNGDGFGYIIALRPLGELTWTHA---VTSAPGRYVYRNES--IPA---FSPFNVKVGAYNAKGQGPFSPVTTVFSAEEEPSGVPGGVWAQSISASEFEVSWQ--TLSDSPERVLGYEVVYWE--DDTKPETMGKVRVSANQYTV---------NISGLKGYTQYFLTVSAFNTAGTGPRTPTINVTTRKSPPGQPPLNVEWNLIGS--KLTVHWDPVVTMEMESEVTGYQVSY-------RRNRHKEINLVTTNLTSVEILLPADDDYIIQICALSEGGEGIPTEPINIHKL 991          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 310.842 bits (795), Expect = 9.381e-89
Identity = 287/1075 (26.70%), Postives = 459/1075 (42.70%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTF---YITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYF-WKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYI----------QFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRV-SDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPM 3864
            GP  L++P D  Y  + S+ K V+F C   G+P P   W   K+  + P            G  +  GG L + +P    D  +  C V N  G+ IS + ++    LE +   PR  + +    G +L C PP +  + + V+ F   Y   ++D    V     SQ+  N++++              D G+Y CMV    +T T   SP  PL + +  ++    P +   F     ++  LG TV  ECF  G    NP+    W+  +  LP KA + +    + + N Q ED G Y CN E + G+ S    +T  + A P ++    N    +G  ++  C+A GKP    +W RN +P  S      + R++     ++   L++  ++  D  M  C   N  G+  +  EL+  +  P+F   PL   T A  G   +I C+P+  P P+ TWTK  + +             +D  R+    N +L+I++V   D GTY CT  N LG ANS+  L +  +  +T  P  + V V  ++  PCQA+  P LDI + W     R+    M+ DA  Y   Q  +        +K   +Q     NYTC   T  +  S+ A++ V GPPG  G +           +  W  G ++  PI+ Y+++      +  W  L    +   I   ++Q  ++        L    ++   + A N+ G  E S PS + KT +  P+ AP+ + GGGG    LVI W+P+ P  + G +  Y + ++E+    W                RQVT+    +  Y+           F+V+++  N  G GP+S+ + + SA   P  AP +V A S  S    V W+AP + S    I GY IVYW +   +  +++A  D L             +S V+  L     Y + V+ +N+ G    S      T K PP   P  + L    T  ++ + W+ V  M  E +V GY++ Y      +    D  +    TG+   L     Y+  V A S GG G  S+ M
Sbjct:    7 GPLFLEEPEDVTYLVE-SSEKKVSFRCRASGHPPPLYRWL--KNGTEVP----------ITGHYSLAGGSLIVRNPSEGRDGGVFQCLVTNSVGSIISVEARLQFAYLESFRSKPRGTVAVRQGQGVVLICAPPPYSGELTFVWLFNEMYDYMRSDGRRFV-----SQVTGNLYIAKV---------EATDVGSYTCMVH-NTVTNTRVASPPTPLLIKSGRSMGEYEPRIEVGFS--PKTHTLLGHTVRLECFALG----NPVPVISWRKIDGQLPSKAYLMEANAVLEIPNFQHEDGGNYECNAENVAGKNSAQGKIT--VYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVPLPS------ESRFSV----MANGELILQELQPWDRGMYQCLAENKHGRIYSHGELRVKASAPDFRSNPLKRVTPAARGGQAVIKCEPKAWPRPSFTWTKGNAMV-------------MDNERMSITQNGSLWIRSVTDEDAGTYTCTVENHLGSANSTGRLILKESTRITVVPSLKMVSVGESIVWPCQASHDPSLDIVFVWSLNGQRID---MEKDAEHYQLLQGSKSQTSDLALIK--RLQLRHRGNYTCTAQTSVDNTSAWAMLMVRGPPGPPGAVVAEEATSTTVRLT-WKRGSNNHSPIISYKIQARAPVASTGW--LNVHTSPDIISGDSEQATVV-------GLTPWMDYEFTVLAINALGESEASRPSRMIKTQSAGPELAPERLGGGGGHQHELVITWQPVAPQFQYGPDVGYTLAFRENGTKAW----------------RQVTIPKAESYRYVYRSDNLAPYAPFEVKIKMYNFNGEGPFSNNTIVYSAENAPKVAPSNVTARSLTSAEAEVSWRAPPLTSSTERITGYEIVYWKKFEGELTAESARTDGLE------------SSAVLQSLTGSTDYQLVVKAYNSGGTGPPSHIAQLVTKKPPPSKPPKNIDLKQDGT--KVTLHWDPVIAMENESAVTGYKVSY----VSLDRGTDKAIITNGTGVEVVLPDGGVYSFEVQAQSDGGLGASSSQM 973          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 219.55 bits (558), Expect = 4.178e-59
Identity = 245/939 (26.09%), Postives = 376/939 (40.04%), Query Frame = 1
Query: 1060 NTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGL-TGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINA----KPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAII-GTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQA-AGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGV-ILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLS--GAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNG 3846
            + G +L C PP H P   + + +              ++Q   R   ++S   G +  +     D G Y C V    + + TS  S  + L +     L P  +V    P    +    G  V  ECF  G    NP+        +    KA    F R    N I+   +    C    +  R     S  L++ A     P++V        D+G  ++  C+A G P    +W R+        A  P       +       L I+ V  + + M  C   N  G   +  EL+ +   P+F   P   T  ++ G +  + C+P  SP  TI+W + G+ +  S   F +        R  SL    L +   E +D G Y C A N+ G+AN +  L V     ++  P      V+ +V LPCQA A    ++I Y W      L   R   DA ++    ++       G L I  ++  D   YTC   TP + +S+SA ++V GPPG    + V  +  N S ++ W  G  +  PI  YR+E A+   +++W  +     + +   +T          V   L   T +  R+ A +  G  E S PS   +T A PP   P  V+GGGG+   L I W P+ P    GD+F Y + ++ +    W  A   +  +       ++  D+P    Y  F V+V   N  G GP      + SA  LPS  P+ V A   +++ ++V W         G + GY + YW         AA+ + L+   R      G  +GV I GL A   Y + V++ N AG    S   + TT K PP   P  V    T       + W+ V     E +V GY++ YWL   G  V+  L+ +     T    NL  D  Y + V A S GG+G
Sbjct:   28 HAGLVLVCAPPPHSPGLGLRFRWLFNE-------FPALVQQDARR--YVSQATGDLYVARAEAGDGGRYSCYVTASIMGSHTSVLSSFVSLGLKKDGELAP--HVELSLPPV--TRVLAGHDVRLECFALG----NPVPGDTHKKRRYTFKKAT---FSRTHESNAIEVIVKNRQLCVRSCLGKRWRARPSPRLALVALSPEPPSWVRGIPPAELDIGDRLSWACEARGHPAPFYRWLRDG------EALRPGGPVELGDDGT----LTISAVDLSHSGMYQCEARNGNGTIYSAAELRVLEYAPHFGSSPDPGTAHVVRGGAATLLCRPRASPHATISWERHGAPILNSSRVFVR-------ERDSSL----LILNATEDADGGAYTCVAENARGRANLTVQLHVQEPTRMSRPPTDVTANVSDSVLLPCQASAAAAGMNIAYTWEALGRTLDPGR---DAEKF----WIASQSEDSGDLTIVKVRLADSGRYTCTARTPIDSVSASATLRVKGPPGPPASVRVMKVT-NTSAMLSWKQGTVNNSPIRRYRVE-ARTPQSRQWASVSTAPAEIEGSAVTA---------VCEGLVPWTEYEFRVAAVSDVGTSEQSAPSRRIRTNAAPPTVVPVAVSGGGGRPRELTITWNPVHPELRYGDDFGYVVSFRPNSSSCWTQA--VVPHAETALYVAELPPDVP---PYAAFLVRVGTFNSAGEGPRGPAVIVHSAEALPSAVPESVAAVGASASELDVSWLPVPQEGLHGRLLGYSVSYW--------PAAAANELSAGTRQNARVSGEATGVRIAGLSATTTYSLTVRVLNGAGAGPPSRTANGTTLKPPPSQVPHNVSAQVTPG-SGTTLHWDPVEATENESAVTGYKVLYWLESNGPGVQAVLESER----TSAWLNLTSDGVYTVEVRARSPGGDG 889          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Match: nfasca (neurofascin homolog (chicken) a [Source:ZFIN;Acc:ZDB-GENE-080229-6])

HSP 1 Score: 180.259 bits (456), Expect = 1.985e-46
Identity = 224/982 (22.81%), Postives = 383/982 (39.00%), Query Frame = 1
Query:  685 IKRGPCILDQ-PTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTG--GLLTIN----DPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSP-DIPLEVFASNTLYPPPNVHDKF--PNFKPSNPFL--GDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVK-PKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--ESAFIELKTVS---LVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRL-KFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAK---EDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEI--RYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTL-FGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESS 3555
            +K+ P I  Q P + +  P+ +    +   C   GNP P+  W  TKD         +D     + +V   G  G L ++         ++ +  C+  N  GTA+S ++ +   R  ++ K     +++ + +  +L C PP   P   I +  ++ ++  +    D+ +   L  +++ S        ++ +      Y C   +        K P  + ++  +   LYPP     +F  P    S   +  GD +  EC   G +    +++F      P   +A + +F + + L N+   D+G Y C      G      +V +   A P ++   P+++    G   T+ C+A G P+  ++W  N  P     A N DP        V    ++++ +    +A+  C   N  G    +AF+ +  V    L P    Y      A++  +  I C+   SP PT  W    +Q  +S + F+            S  ++ L +  V+  D G Y C   N L K  S A L + +   +   P   R Q        C A   P L ++  W+ +   L +  R +L+                   L I N+   D  +Y CR +T  +   + A +  +                ++S  + W  G ++  PI  + +E  +   E G   W+ L                   RN  +   L    ++R R+ A NS G  EPS P+E   T +  PQ  P  V G G     ++I W P+  +++NG  F Y +  R + S + EW T    +N+S          + +     +  ++++VRA N +G GP  DV    S   +P  +P++V     NST I V W+   + S  G I GY + YW        +A    R   S R  L F    T GV+ GL     Y + V +FN   D   S+
Sbjct:    5 VKQPPAITAQSPKNYIVDPRDN----IEIKCEAKGNPPPSFHW--TKDG--------VDFHPEADERVQMRGDSGTLVVDVVGGGRAERYEGEYQCRASNSGGTALSDRITVQLSRSPLWPKEVIDPVQVKEGSSAVLPCNPPPGIPLPVIFWMDHVLQRLSQ----DERVSQGLNGDLYFS--------NVRASDARDDYICYARFVYTQTIQQKQPIKLTVQPGSRVDLYPP-----RFLSPVGASSTKMVLKGDVLSLECIAAG-LPTPRIQWFKSGAEMPWE-RAKLLNFNKTLILANVTEGDDGNYVCLASNRLGVQRHTTTVAIEDTAAPYWLTGGPESRVVQPGEQTTIMCRATGNPKPSIRWLLNGGPIEE--AGN-DPNRK-----VDGDTIILSNLPEGTSAVYQCEATNKHGSILGNAFVNVLAVPPRILSPMNKVY-----SAVVNQTVHIECKVFASPQPTFMWYVPNTQTCISINGFD------------SAASDTLVVPRVQKGDAGVYTCHVQNYLNKNQSLARLLIKDPTRIVQPPSELRAQRFGVATFECHATHDPSLSLNISWFHDGYPLPESPRHELEG----------------SGLTIVNVTEEDVGHYKCRASTELDHAEAEARL-TVIDRPDSPMDLELTNRQDLSVRLTWNPGSENNDPIKEFVVEYEEDWFEPGV--WHRLSSFPGS-------------RNSVLLDSLSPYVSYRFRVVAVNSVGPSEPSLPTERCLTVSASPQINPSGVKGEGTNPTNMIISWTPMRGVDQNGPGFGYRVSWRLQSSGDAEW-TTETVLNRS---------HVVVSGTPTFSPYEIRVRAVNNIGLGPEPDVVIGYSGEDVPLESPKNVRVEVLNSTIIKVTWEPVPLESVRGHILGYTVHYW------HVRALGDRRRRRSNREVLEFQPVRTHGVVPGLRPYSLYQLEVCVFNRKSDGPAST 880          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005094.1 (pep scaffold:Pmarinus_7.0:GL476871:314859:363619:1 gene:ENSPMAG00000004631.1 transcript:ENSPMAT00000005094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.553 bits (301), Expect = 3.366e-29
Identity = 110/416 (26.44%), Postives = 182/416 (43.75%), Query Frame = 1
Query: 2641 VVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLP----------ANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYW-LSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            V+ W+ G ++  PI  Y++   +   T  W  +K     TD + I   + ++    +   L    ++  +  A N  G  +PS PS   +T A  P+  P N+ GGGG    LVI W P+      G +F Y + ++E+  + W                R+VT+ L           + K Y  FQVQ+RA N+ G   +SD++ + SA   P+  P  V A S +S  + V W+   + +    +QGY IV+W           S +R + ++R+ + G   T+  I GL  +  Y +  + +N+AG    S     TT K PP   P+ ++L       ++ + W  V    +E +V GYRI Y  L G   +  +     +++T           Y ++V A+S  G G  S
Sbjct:   20 VLSWSPGLNNHSPITAYKVR-GRTPFTADWQDVK-----TDPENIAGDSEMV----MVVGLTPWMDYEFQTIATNLLGDSDPSAPSRRVRTLASAPRTPPSNIGGGGGHAHELVITWTPVERTHRYGPDFGYIVAFRENGTMPW----------------RKVTIPLAESFRYIYRNESTKPYTAFQVQIRAYNMNGESAFSDITIVHSAENEPNVPPSSVTARSLSSKEVEVMWRPVPLNASLERVQGYEIVFW----------KSGEREDMAERIRVAGSD-TAARISGLKCNTQYEVAARAYNSAGVGPPSEVTTVTTKKSPPSRPPSGLQLRRDG--GKVTLDWENVVAREDESAVTGYRITYHSLEGTAQKEIVTNQTYVELT-----FPDSETYVIQVRAHSEDGEGPAS 391          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010567.1 (pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1 gene:ENSPMAG00000009565.1 transcript:ENSPMAT00000010567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 1.133e-28
Identity = 136/549 (24.77%), Postives = 214/549 (38.98%), Query Frame = 1
Query:  697 PCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQG------PQRTLIDA-----LSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKC----MVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSN-PFLGDT-VIFECFGYGEIKQNPLKYFWKWNNKPLPPKA---VITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYR---NEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--ESAFIELKTV---SLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            P I + P+D +    VS  +  T  C   G P PTV WY   +  +         R L+       L   +G+ T+T             +    C  +N  G A+SR   +    +    ++    +++      +++C PP   P+ ++ +        DK E V              +   G +  S     D+G Y C    MVG R        S    L VF   T              KP N   L D+   F C  +G+    P    W+  +  LP  +   +  D+  RV    +   DEG Y+C  E   G+     S +L ++A P FVV+P++Q    G S T  C+  G P   + W R     + F +  ++ P  R++ ++       L I  V+ +D+    C   ++ G     A +E+      S  P   + P   T A+ G+  ++ CQ  G PTP++ W KDGS+LSL               RL       L IK+V+  D G Y C A +  G+   SA++DV
Sbjct:   30 PRIAEHPSDLI----VSRGEPATLNCKAEGRPAPTVEWYKDGERVETDRDDPRSHRMLLPTGSLFFLRIVHGRRTKTD------------EGSYVCVARNYLGEAVSRNASLEVANIRRNYRSSPSAVKVAAREPAVMECRPPRGHPEPTVSWKRNGVALTDKDERV--------------TIRGGKLMISNTQKADAGMYVCVGTNMVGER-------DSEPAELAVFERPTFA-----------RKPMNLVMLADSDAEFRCEVHGD---PPPTVRWRKEDGDLPKGSRFEIQDDYTLRV--ERVGGTDEGTYTCVGENRVGKAEA--SASLVVHAPPQFVVRPRDQIVAQGQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQ-PSSRFSVSQ----TGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGPANQTLAV-GSVALLACQAMGMPTPSVHWLKDGSKLSLG------------SARLGLQSGGTLSIKDVQLMDAGLYTCVAVSPSGETTWSAFMDV 505          

HSP 2 Score: 103.219 bits (256), Expect = 2.186e-22
Identity = 127/514 (24.71%), Postives = 191/514 (37.16%), Query Frame = 1
Query: 1480 WKWNNKPLPPKAVITDFERRVTL-------NNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYR--NEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALT------LTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSAL-------IQXXXXXXXXXXXXXXXXXXNVSNV------VEWTDGYDHG-QPILWYRLEVAKEDG--TQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPP 2928
            WK N         +TD + RVT+       +N Q  D G+Y C    M G    +    L++  +PTF  KP N      S     C+  G P   ++W +   ++P  S      D    +T        L +  V  TD     C   N  GK  A   L  V   P F   P     A  G S    C+  G+P P + W ++GSQ  L P+  +Q       +R       +L I +V+ SD G Y C A +  G   + A L+V +AL       +   P  + + V +   L CQA G P   +   W  +  +L      L               +  GTL I ++Q  D   YTC   +P    + SA        +     P     +   P    V++V      + W      G  PIL+Y +E  ++    +  W               T   ++ R+ F    L  NT +   + AAN+ G+ +PS  S+  +T  I P
Sbjct:  166 WKRNG------VALTDKDERVTIRGGKLMISNTQKADAGMYVCVGTNMVGERD-SEPAELAVFERPTFARKPMNLVMLADSDAEFRCEVHGDPPPTVRWRKEDGDLPKGSRFEIQDD----YT--------LRVERVGGTDEGTYTCVGENRVGKAEASASL-VVHAPPQFVVRPRDQIVAQ-GQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQ-----PSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGPANQTLAVGSVALLACQAMGMPTPSV--HWLKDGSKLSLGSARLG-------------LQSGGTLSIKDVQLMDAGLYTCVAVSPSGETTWSAFMDVQENGVPSQPQPPEPSSLAAPPSKPRVTDVTKNTVTLSWQLPEPSGPSPILYYIIEAFRDSQSVSTSWQ--------------TVATHVTRDAFTLRGLRPNTIYLFIVRAANAHGLSDPSPVSDPVRTQDISP 624          

HSP 3 Score: 73.1738 bits (178), Expect = 3.806e-13
Identity = 67/301 (22.26%), Postives = 120/301 (39.87%), Query Frame = 1
Query: 1645 NAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYN---FTEGNVSVALLVINGVKT-TDNAMIGCNIYNIFGKE-SAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQ-PEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSS-AYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTC 2526
            +A P     P +     G   TL C+A G+P   ++WY++     +      DPR +      G++   L +++G +T TD     C   N  G+  S    L+  ++  N+   P    +       ++ C+ P G P PT++W ++G  L+             D     ++    L I N + +D G Y C  TN +G+ +S  A L V    T    P+   +  +++    C+  G P   +           ++ + D D  +  + +    Y     TL++  +   DE  YTC
Sbjct:   27 DAPPRIAEHPSDLIVSRGEPATLNCKAEGRPAPTVEWYKDGERVET---DRDDPRSHRMLLPTGSL-FFLRIVHGRRTKTDEGSYVCVARNYLGEAVSRNASLEVANIRRNYRSSPSA-VKVAAREPAVMECRPPRGHPEPTVSWKRNGVALT-------------DKDERVTIRGGKLMISNTQKADAGMYVCVGTNMVGERDSEPAELAVFERPTFARKPMNLVMLADSDAEFRCEVHGDPPPTV-----------RWRKEDGDLPKGSRFEIQDDY-----TLRVERVGGTDEGTYTC 293          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Match: EDO45343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT95])

HSP 1 Score: 114.39 bits (285), Expect = 2.117e-25
Identity = 169/698 (24.21%), Postives = 261/698 (37.39%), Query Frame = 1
Query: 1564 EDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKP--KNQYPDVGSSVTLTCQAVGKPQVIMQWYRN--EIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMI-GCNIYNIFGKESAFIELKTVSLVPN---FDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTN-VYLPCQAAGTPYLD--IDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISS---SALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEV--FKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLT-----------SGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTF 3576
            + EGVY C +E   G+     S  L +   P ++VKP  K   P  G +V L C+A G P     WY N  +I  S  L              V+   L    V+  ++A I  C   N +G   +   ++  +  P    F  + +        T   I C    +P     W+KD   LS+S              R    P N+L I  V+ +D+G Y C ATN LG    S    V     +T  P      +        CQA   P L   + Y W  +   L++     +   +  +Q           LK+      D A YTC   T   +  S   ++ I  +                N++ V+ W  G   G+PI  Y++E   E     W  LK+     D K  + Q           +L      R R+ A NS G    S P+ V   +T    P   PKN  G  GK   L   W PL  LE+N     Y ++Y++S   +W         ++DN    + ++  P   +  +F   + ATN +G GP SD+    S    P   P+++      +  +++ W    +  G   + GY   +W +  + ++   +  R  T +R  +  G  T           SG + GL     Y + ++ FN+ G+  ES   D  TF
Sbjct:  384 QHEGVYQCIVENNQGKTESQLS-QLKVFVPPGWIVKPPPKMNIPMYGGAVLL-CEAFGDPTPAYGWYVNGSKIVNSQHLI-------------VTNNKLTFKAVELYEHAGIYQCVAENDYGMVVSTTVVEIDARKPGIIGFGPFYIFKD-----TKGEIKCDSNAAPAANHVWSKDDQVLSIS-------------GRYSLGPGNSLVITPVQQNDEGKYTCKATNLLGTDTKSNDATVYERTKITVRPDASVELIKGKPTDFRCQATADPRLMNILKYKWLKDGTELQY----TENINWIPNQLR---------LKLSEADIDDGAVYTCVAYTDDKLKYSEDRASSIANVQGVPFPPSNLTITNCYNLTTVITWVPGSSTGKPITHYQIEQESEFEAGVWQILKKV---DDPKSTSLQ----------LQLTPWAKLRFRMRAVNSVGPSRASLPTPVGACETKVSRPTMVPKNFRGVPGKANELDAAWTPLTKLEQNAPGCKYVLKYRKSGAKDWQKV------TIDNPSTAKYSILNPGYYELWEF--MIYATNDIGDGPQSDIIKSRSGQDAPKDKPKNLKKGVVTARTVSLTWDRVTVDRGS--VDGYISYHWFKTIETQNDQETPVR--TRRRREIPVGAQTYKLNATSQPSQSGTVRGLTPFSSYTLVLKAFNSGGEGPES---DAITF 1007          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Match: EDO46946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL2])

HSP 1 Score: 100.908 bits (250), Expect = 2.205e-23
Identity = 72/282 (25.53%), Postives = 116/282 (41.13%), Query Frame = 1
Query: 1414 GDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            G+  + EC  YG     P+                +T   RR  +        G Y C      GR   + ++ + + AKP ++ +P++    V S+ TL C A G P+V  QWY N  P  +        R+   +G+     L++  ++ +D  M  C + N  G+  A  EL          + P  +  A++ ++  + CQP G+P P + W K    LS  P             R   L + +L I NV + D G Y C  +N LG A+ +  L+V
Sbjct:   14 GERFVLECIVYGM----PVPKITLRKKGVHMILGQVTGNARRHYIPKFTANHAGKYKCKATDTSGRTDTSTTI-VRMEAKPEWITRPQDTIAGVNSNTTLRCHASGAPRVFYQWYCNGQPLVT------SQRHILHQGD-----LILKELRYSDGGMYQCVVTNTHGQLIASAELTVAG-----TRAPEASKNALVDSTVTLHCQPSGNPKPMVRWRKGSVYLSSGP-------------RYQFLTSGDLKISNVTSLDSGRYTCEVSNRLGSASRTGRLNV 261          

HSP 2 Score: 52.373 bits (124), Expect = 4.453e-7
Identity = 50/199 (25.13%), Postives = 76/199 (38.19%), Query Frame = 1
Query: 1984 NTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNP-VGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYF--GTLKIYNIQFYDEANYTCRVTTPFNVISSSALI 2571
            +T A + ++T + C   G+P     W  +G  L  S  +               L   +L +K +  SD G Y C  TN+ G+  +SA L V      T  P   +   V++ V L CQ +G P   +   W   +V L                   P Y++   G LKI N+   D   YTC V+      S +  +
Sbjct:   97 DTIAGVNSNTTLRCHASGAPRVFYQWYCNGQPLVTSQRHI--------------LHQGDLILKELRYSDGGMYQCVVTNTHGQLIASAELTVAG----TRAPEASKNALVDSTVTLHCQPSGNPKPMVR--WRKGSVYLSSG----------------PRYQFLTSGDLKISNVTSLDSGRYTCEVSNRLGSASRTGRL 259          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 94.3597 bits (233), Expect = 3.062e-19
Identity = 174/754 (23.08%), Postives = 289/754 (38.33%), Query Frame = 1
Query: 1657 TFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTT-DNAMIGCNIYNIFG---KESAFIELKTVSL----VPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPN-NNLFIKNVEASDKGTYACTATNSLGKANSS----AYLDVINALTL-------TNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSN 3858
            T  + PK+        V + C   G P   + WY+N     S +  +    +    G     L+ I  ++     A   C   N  G   ++S+ + + T S      P   K+P    +   G      C   G+PTP ITW KD   + L+              R+  L +   L I ++  SD G Y+C A N+LG   SS    A L +   L++       T  P  + V  +T+V L C A G+P   I +              ++D  R              G L I  IQ     NY+C   +    + + A +           +   P   N +++   +D       I W+          +  Y LK    KT+ + IT    +     V S L   +++  R+FA NS G   PS  +E + T+   P  AP+N+   G    +    W P  P+  NG    Y + Y     +E I+   F+  S ++     +T      +    F  ++ A NI G GP S+V  + +   +P   P+ V  +  +STAI V W  P    G+G I GY + Y     D  +   ++ ++NT +             I+GL     Y + V   +  G    S  +   T +  P + P  ++  S ++   ++++W+  R       +  + I+Y   G      L VD   K + +++NL     Y + V A ++ G+G  S+
Sbjct:    2 TVTLTPKDFAGVTRGFVYMICNVTGSPMPTLTWYKN----GSVIRNSRIQIFTMPYG----GLIRIGPLRAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKHPSFK-QRRSGDDVTFTCAAVGTPTPNITWFKDRLPIVLNDP------------RVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVW--------------EVDGSRISGQN---------GELIIRGIQ--RSGNYSCIADSNMGRVQAYAYV-------TVRLLPFAPSRPNAASIT--SDAIK----ITWHPRGAHVVTSYEVQYRLK---GKTEWQEITNVRGM--QSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAE-YTTSETKPGSAPRNIEAMGVSDTSFKAGWLP--PISANGRIRGYRLYYSLDL-LEDISQWRFMASSTNSTTVTGLT------RQTTHF-FRILAYNIAGDGPLSEVVAVKTQKGVPG-QPRSVQLSVLSSTAIRVTWSPPRY-PGDG-IFGYDVYYNKSKQDMDTVIGAF-QMNTKE-------------IMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDST-TLEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKYLTVD-ATKTSVVLHNLDKFTNYFIWVQASTKQGDGPFSD 661          

HSP 2 Score: 67.0106 bits (162), Expect = 5.960e-11
Identity = 62/252 (24.60%), Postives = 101/252 (40.08%), Query Frame = 1
Query: 1537 RVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYN-FTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--------ESAFIELKTVSLVPNFDKYPLLNTEAIIG--TSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            R  ++   +E E          D    I  + +      P     P  +    G  VT TC AVG P   + W+++ +P    +  N DPR +  ++G      L I  ++ +DN    C   N  G            FI L T+S+V +  ++ L   +  +   T   + C   GSPTP+I W  DGS++S                      N  L I+ ++ S  G Y+C A +++G+  + AY+ V
Sbjct:   63 RAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKHPSFKQRRSGDDVTFTCAAVGTPTPNITWFKDRLP----IVLN-DPRVSVLSDGR----KLRITDLRESDNGKYSCVARNALGMVFSSQAMPARLFIYL-TLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEVDGSRISGQ--------------------NGELIIRGIQRS--GNYSCIADSNMGRVQAYAYVTV 282          

HSP 3 Score: 63.5438 bits (153), Expect = 6.319e-10
Identity = 64/242 (26.45%), Postives = 107/242 (44.21%), Query Frame = 1
Query: 2833 TNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENG--DNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLES 3552
            T +++ + A +  G+G P       +T    P  AP+N+ G      TL I W+P  P   NG   +F  + R K  +  +++T        +D  K   V  +L    +Y    + V+A+   G GP+SD   +++A  +P+ AP+DV     NST + V W  P     +G I GY +V++ RV D  +Q     +  +   ++     +    + GL  +  Y I V  +   GD   S
Sbjct:  543 TVYKVAVAAKSDKGVG-PMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKYLT--------VDATKTSVVLHNLDKFTNYF---IWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHNSTTMTVKWNPPTTKQ-DGKILGY-MVFYTRVDDQGNQLRPPAQPESKDSMSEENHKVH---LTGLAPETTYQIEVAAYTIKGDGARS 767          

HSP 4 Score: 51.6026 bits (122), Expect = 2.970e-6
Identity = 79/325 (24.31%), Postives = 125/325 (38.46%), Query Frame = 1
Query: 2683 LWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWN 3657
            L+Y L++  ED +Q W  +    N T +  +T+Q                T+F  R+ A N  G G  S    V     +P Q  P++V         + + W P  P       F Y++ Y +SK+      +  I        ++  T ++     Y  ++V V A +  G GP S V    +    PS APQ++   S +ST + + W  P      G I  + I Y  +      + A Y  ++ ++         TS V+  L     Y I VQ     GD   S     +T +  P   P  VR+   N+   + V WN
Sbjct:  416 LYYSLDLL-EDISQ-WRFMASSTNSTTVTGLTRQT---------------THF-FRILAYNIAGDGPLSEVVAVKTQKGVPGQ--PRSVQLSVLSSTAIRVTWSP--PRYPGDGIFGYDVYYNKSKQ----DMDTVIGA------FQMNTKEIMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAK----GQRGAKYLTVDATK---------TSVVLHNLDKFTNYFIWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHNST-TMTVKWN 694          

HSP 5 Score: 50.0618 bits (118), Expect = 7.895e-6
Identity = 58/235 (24.68%), Postives = 95/235 (40.43%), Query Frame = 1
Query: 1378 KFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLP-----PKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARS--------VTLS-INAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGS 2040
            K P+FK      GD V F C   G    N       W    LP     P+  +    R++ + +++  D G YSC      G V  +++        +TLS + +KP F ++P+++  D  + V L C A G P   + W   E+  S    +N +              L+I G++ + N    C   +  G+  A+  + TV L+P     P  N  +I   +  I   P G+
Sbjct:  106 KHPSFKQRRS--GDDVTFTCAAVGTPTPN-----ITWFKDRLPIVLNDPRVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVW---EVDGSRISGQNGE--------------LIIRGIQRSGN--YSCIADSNMGRVQAYAYV-TVRLLPFAPSRP--NAASITSDAIKITWHPRGA 311          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Match: EDO49553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL7])

HSP 1 Score: 83.1889 bits (204), Expect = 2.903e-16
Identity = 116/525 (22.10%), Postives = 207/525 (39.43%), Query Frame = 1
Query:  709 DQPT--DQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSI----GSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKY--PLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDV 2259
            D PT   +L   +++       +CNV G P P V W F  +    P R      SY +G V+     LT+ + +   D    C V N++G+  S+    +   L+ + +  R    + +   F+   EP +   +  +  ++++ R   K  V       +LR+   +    G    ++       +D+G+YKC+   R   G++ +  ++ +E   S T Y   N ++  P+ +    F G+T                                      ++ L +I+ +D G Y C      G+      +T++    P FV K +  +   G +V+  C+  G P+  ++WYR+  P  +      D R+   + +  V  L ++     D  +  C I N  G   +  EL+ V    N  K    + + + + GT      +  G P P +TW ++    S+   N ++   + D  R       +L I + +  D GTY C ATN  GK  S   LDV
Sbjct:   14 DTPTFMSKLEPIEITEGDDFQLSCNVTGRPQPEVQW-FRDEVLIKPSRRF--KASY-DGNVS----ALTVKEAELDDDGVYKCVVTNNFGSVSSKADVTV---LKKHLRPERDYAPIFEEKQFL---EPLEIQVRQPVEVSYHV-RGRPKPTVTWWKNGKELRDGKHVEIRSGGTYHTLYILRSEEEDAGSYKCLA--RNDVGSAERLFEVQVEE-PSVTWYR--NKNEIVPDGRSRTTFDGETY-------------------------------------KLILQDIKIKDAGQYECIASNPIGKAFCTAEMTVNKREAPVFVSKLRPLFVTEGDNVSWMCKVAGMPRPTVEWYRDNQPLRA------DTRWKM-DFDGRVCSLFLSEADCKDKGVYNCVITNSAGSAFSSAELQ-VDKKANKPKVIEKMNDVQTVEGTEARFDVRFSGLPRPEVTWYRN----SIKVRNESRFHLSEDGDRY------SLTITDTKLVDTGTYKCVATNEGGKITSRGDLDV 463          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Match: EDO32297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH5])

HSP 1 Score: 78.1814 bits (191), Expect = 8.646e-16
Identity = 67/230 (29.13%), Postives = 99/230 (43.04%), Query Frame = 1
Query: 1705 VTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPS-NFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVI------NALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYD 2373
            +TL C+A G P+  + W R     S WLA     R + + GNV+     I   +  D  M  C   N+ G  SA   L    +   FD   LL++   +       C   G P P+ITW KDG  L  S +   N + G              L++ ++     G Y C ATNSLG A ++  L+V+      +ALT+ +N       ++T+V + C A G P   I + 
Sbjct:    1 MTLVCKARGLPKPSVSWTRAGDKLSHWLASMG--RVSTSNGNVT-----ITQAEPNDAGMYLCTARNLLGVASARSTLYFKGMFHPFDVITLLSSNVEV------TCPVRGFPLPSITWLKDGQPLKQSMTVKVNNLTG-------------TLYLLSILERRAGLYMCVATNSLGAATATTTLNVLHYDSLSHALTIGDN---LNTLISTSVSIHCNATGNPVPSITWS 201          

HSP 2 Score: 55.8398 bits (133), Expect = 3.333e-8
Identity = 63/244 (25.82%), Postives = 101/244 (41.39%), Query Frame = 1
Query: 1540 VTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTV---SLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVI 2262
            VT+   +  D G+Y C    + G V+ ARS   ++  K  F   P +    + S+V +TC   G P   + W ++  P    L ++   + N   G      L +  +      +  C   N  G  +A   L  +   SL         LNT  +I TS  I C   G+P P+ITW++ G+   + PS   +++G+             L I     SD G+Y C A+N  G    S++L  +
Sbjct:   41 VTITQAEPNDAGMYLCTARNLLG-VASARS---TLYFKGMF--HPFDVITLLSSNVEVTCPVRGFPLPSITWLKDGQP----LKQSMTVKVNNLTGT-----LYLLSILERRAGLYMCVATNSLGAATATTTLNVLHYDSLSHALTIGDNLNT--LISTSVSIHCNATGNPVPSITWSRSGAL--IEPSKRIKIMGS------------TLVIVGTLWSDTGSYECVASNGAGTDRKSSFLKFV 253          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Match: cntn3a.1 (contactin-4 [Source:NCBI gene;Acc:101159916])

HSP 1 Score: 305.064 bits (780), Expect = 4.626e-86
Identity = 291/1085 (26.82%), Postives = 462/1085 (42.58%), Query Frame = 1
Query:  664 GQSDLTNIKRGPCILDQPTDQLYAPQVSNS-KLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTN--GKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPN-FKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWK-WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPL-LNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRS 3891
            G S  + I   P    QP   ++  Q   S K V F+C   G P P   W             L D+  + N   + +  GG L I   +   D  +  C   N +GT +SR+  +    LE +    R  +R+ +  G +L C PP H  + +  + F     +D   +V D         +F+S   G +  +     D G Y C+V    +T +S + P  PL + A   +    P +  +FP     +N     TV  ECF  G    NP+ K  W+  ++ P   K  + +    + +   Q E+ G+Y C  E   GR S+   +T    A P  +VKP++    +  +V   C+A GKP+   +W +N         ++ DP  +  E N  V  L I  +   D  M  C   N +G+     +L+ +++ P+F +  +   T A  G   ++ C+P  SP   I+W K    +              +  R+  L N +L + NV  +D G Y C A N  G A+S+  L V +A  +T+      V +  ++ LPCQ +  P LD+ + W+F    + F            + F +   R  G + I NIQ      YTC V T  + IS +  + V+  P           +   +  + W  G D+  PIL Y ++ A+   +  W  +      T +  + K   L  + F   EL     +  R+ A NS G GEPS PS+  +T    P+  P  V GGGG    LVI WEP+    ++G  F Y + ++      W+ A      S D  KY      +P    +  +QV+V   N  G GP+S V+ + SA + P+ AP  + A S ++  I+V WK     +    I GY + YW      K  AA+  R           G  TS VI  L     Y I ++ +N+AG   +SS V+ TT K PP   P  +R N++N+  ++ + W+ V  +  E  V GY++ Y    +  + +    V  K T L  +L  +  Y +++  +S GG G  S+ +     +PRS
Sbjct:   15 GSSSGSGILLRPIFTKQPGSVVFPIQPGESRKEVVFSCEAQGQPAPFYRW------------KLNDSYIHPNPGSRFSLMGGNLHIRHLNKEEDTGVYQCLASNSFGTIVSREANLHVAYLENFKTQRRSPVRVREGQGVVLLCGPPPHSGELTFRWIF----NDDPSSIVQD-------TRLFVSQKTGNLYIAKVEPSDVGNYTCVVT-NTVTKSSVRGPPTPLVLRADGVMGEYEPKIEVQFPEVIHVAN---SSTVKLECFALG----NPVPKISWRRLDDAPFGRKVKVNEAFGVLEIPYFQQENAGIYECLAENSRGRNSVRGKLTF--YASPQLIVKPQDVQKTIDDTVVWECKASGKPKPSYRWLKN--------GESLDPMEDRIEVNDGV--LTIRSLNLVDVGMYQCVAENKYGRIFCNAQLRVLAIAPDFSQNLVKAQTLARQGGDVLMECKPRMSPRGVISWRKGEEAIR-------------ESHRVTVLDNGSLRLSNVTKADAGVYTCVARNQFGVASSAGSLSVKDATVITSPAGHLDVTLGESIVLPCQVSHDPTLDLKFTWFFNEQLIHFGGRG--------AYFEKAGGRSDGGIMIRNIQLKHAGKYTCAVQTKVDSISIATDV-VVRGPPGPPLDCQVIEMTETTATLSWRPGTDNHSPILSYTIQ-ARTPFSLGWQAV------TTVPELPKGKKLSASVF---ELSPWVEYEFRVLATNSIGTGEPSKPSKKARTKETSPRVTPARVNGGGGGRSELVITWEPVPEELQSGPGFGYVVAFRPLGAPGWMQA---AVTSPDASKYVFKNESIPP---FSPYQVKVGVYNNKGEGPFSPVTILYSAEEEPTRAPTRLRARSISAAEIDVSWKPLPWSNNRRRILGYELWYWRE--KQKQDAATVIRTV---------GNKTSVVIRDLEGSSTYYISLRAYNSAGVGPQSSIVNVTTKKPPPSQAPVKIRWNTSNS--KVILRWDQVHALENESEVTGYKVLY----SQDKHSRPSVVETKNTTLELSLPVNEDYVIQIKPFSEGGEGISSHQIT----IPRS 997          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Match: cntn3a.1 (contactin-4 [Source:NCBI gene;Acc:101159916])

HSP 1 Score: 299.671 bits (766), Expect = 3.255e-84
Identity = 286/1074 (26.63%), Postives = 457/1074 (42.55%), Query Frame = 1
Query:  697 PCILDQPTDQLYAPQVSNS-KLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTN--GKVTQTGGLLTINDPDNTFDNKI-DCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPN-FKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWK-WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPL-LNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRS 3891
            P    QP   ++  Q   S K V F+C   G P P   W             L D+  + N   + +  GG L I   +   D  +  C   N +GT +SR+  +    LE +    R  +R+ +  G +L C PP H  + +  + F     +D   +V D         +F+S   G +  +     D G Y C+V    +T +S + P  PL + A   +    P +  +FP     +N     TV  ECF  G    NP+ K  W+  ++ P   K  + +    + +   Q E+ G+Y C  E   GR S+   +T    A P  +VKP++    +  +V   C+A GKP+   +W +N         ++ DP        V+  +L I  +   D  M  C   N +G+     +L+ +++ P+F +  +   T A  G   ++ C+P  SP   I+W K    +              +  R+  L N +L + NV  +D G Y C A N  G A+S+  L V +A  +T+      V +  ++ LPCQ +  P LD+ + W+F    + F            + F +   R  G + I NIQ      YTC V T  + IS +  + V+  P           +   +  + W  G D+  PIL Y ++ A+   +  W  +      T +  + K   L  + F   EL     +  R+ A NS G GEPS PS+  +T    P+  P  V GGGG    LVI WEP+    ++G  F Y + ++      W+ A      S D  KY      +P    +  +QV+V   N  G GP+S V+ + SA + P+ AP  + A S ++  I+V WK     +    I GY + YW      K  AA+  R           G  TS VI  L     Y I ++ +N+AG   +SS V+ TT K PP   P  +R N++N+  ++ + W+ V  +  E  V GY++ Y    +  + +    V  K T L  +L  +  Y +++  +S GG G  S+ +     +PRS
Sbjct:   26 PIFTKQPGSVVFPIQPGESRKEVVFSCEAQGQPAPFYRW------------KLNDSYIHPNPGSRFSLMGGNLHIRHLNKEEDTGVYQCLASNSFGTIVSREANLHVAYLENFKTQRRSPVRVREGQGVVLLCGPPPHSGELTFRWIF----NDDPSSIVQD-------TRLFVSQKTGNLYIAKVEPSDVGNYTCVVT-NTVTKSSVRGPPTPLVLRADGVMGEYEPKIEVQFPEVIHVAN---SSTVKLECFALG----NPVPKISWRRLDDAPFGRKVKVNEAFGVLEIPYFQQENAGIYECLAENSRGRNSVRGKLTF--YASPQLIVKPQDVQKTIDDTVVWECKASGKPKPSYRWLKN--------GESLDPMEQ-DRIEVNDGVLTIRSLNLVDVGMYQCVAENKYGRIFCNAQLRVLAIAPDFSQNLVKAQTLARQGGDVLMECKPRMSPRGVISWRKGEEAIR-------------ESHRVTVLDNGSLRLSNVTKADAGVYTCVARNQFGVASSAGSLSVKDATVITSPAGHLDVTLGESIVLPCQVSHDPTLDLKFTWFFNEQLIHFGGRG--------AYFEKAGGRSDGGIMIRNIQLKHAGKYTCAVQTKVDSISIATDV-VVRGPPGPPLDCQVIEMTETTATLSWRPGTDNHSPILSYTIQ-ARTPFSLGWQAV------TTVPELPKGKKLSASVF---ELSPWVEYEFRVLATNSIGTGEPSKPSKKARTKETSPRVTPARVNGGGGGRSELVITWEPVPEELQSGPGFGYVVAFRPLGAPGWMQA---AVTSPDASKYVFKNESIPP---FSPYQVKVGVYNNKGEGPFSPVTILYSAEEEPTRAPTRLRARSISAAEIDVSWKPLPWSNNRRRILGYELWYWRE--KQKQDAATVIRTV---------GNKTSVVIRDLEGSSTYYISLRAYNSAGVGPQSSIVNVTTKKPPPSQAPVKIRWNTSNS--KVILRWDQVHALENESEVTGYKVLY----SQDKHSRPSVVETKNTTLELSLPVNEDYVIQIKPFSEGGEGISSHQIT----IPRS 998          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Match: cntn4 (contactin-4-like [Source:NCBI gene;Acc:101167031])

HSP 1 Score: 295.434 bits (755), Expect = 8.020e-83
Identity = 274/1065 (25.73%), Postives = 438/1065 (41.13%), Query Frame = 1
Query:  679 TNIKRGPCILDQPTDQLYAPQ-VSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVA--LLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAI-IGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            +++ + P    QP   +Y  + V N + V F+C   G+P P   W               + L       + +GG L I+  +   D     C   N +GT +SR+  +    LE +    R  + + +  G +L C PP H     +V+++               +Q + R   F+S   G +  +     D G Y C+V    +T T  + P  PL + +   +    P +  +FP     +   G TV  ECF  G     P   + + +  P P K         + +   Q +D G Y C  E   G   +     LS  A P  + KP++    +  S+   C+A GKP+   +W +N     S            TE  + VA  +L I+ +  +D  M  C   N  G+  +  EL+ ++  P+F    L +   + +G   ++ C+P+ SP   I+W K    L  S              R+  L N +L I NV  SD G Y C A N  G A+S+  + V  A  +T  P      V  +V LPCQ +  P L++ + W+F    + F   D          F +      G + I NIQ      YTC V T  + I S AL  ++  P           + + +  + W  G D+  PI  Y ++ A+   +  W  +      T +  +     L     V  +L     +  R+ A+N  G GEPS PS+  +T +  P+  P NV+GGGG    LVI WEP+    +NG  F Y + ++      W+ A      ++ + +  +      + + +  F V+V   N  G GP+  V  I SA + P  AP  V A S ++  I V WKA    + +  + GY + YW +    +   AS  R   +Q         TS +I GL     Y I V+ +NTAG    S  V+ TT K PP   P  V  N++N+  +I V W  V+ +  E  V GY++ Y  +     + ++ +     T +   L  D  Y +++  +  GG+G  S
Sbjct:   23 SSVLQSPVFTKQPGSIVYPVETVENGREVVFSCEARGSPAPAYRWKLNG----------TEILPKAGSHFSLSGGNLRISRLNRDRDAGTYQCLASNSFGTIVSREASLTFAYLESFKTQRRSPVSVREGQGMVLLCGPPPHS--GDLVFSWIFNESTT-------FVQQETRR--FISQETGNLYIAKVEPSDVGNYTCVVT-NTVTKTRVQGPSTPLVLRSDGVMGEYEPKIEVQFPEI--VHVAKGSTVKLECFALG--NPAPSITWRREDGAPFPRKVDTRKTNGVLEIPYFQQDDVGTYECVAENSRGMNKVKGK--LSFYAPPHLIEKPQDVQKLIDDSLVWECKATGKPKPSYRWMKNGENLES------------TEERIQVANGVLSISRLTLSDTGMYQCVAGNKHGEVYSNAELRVIAAAPDFSHNQLRSQTMVKVGGDMLVECRPKMSPWGVISWRKGSEPLQQS-------------NRIVILDNGSLRIWNVTKSDAGLYTCVARNQFGMASSTGSVTVKEASVITTQPSTLDATVGESVVLPCQVSHDPSLELKFTWFFNEQLIHFGSHD--------GFFEKVGGHSAGDIMIRNIQLKHAGKYTCAVQTKVDSI-SVALDLIVRGPPAPPTHIQVEEITDTTASLSWRPGPDNHSPITAYTIQ-ARTPFSLGWQAV------TTVPEVVGGRQLTA---VVIDLNPWVEYEFRVLASNRIGTGEPSKPSKQARTKSTSPKVTPANVSGGGGSRSELVITWEPVPEELQNGPGFGYVVAFRPHGATGWMQA------AVPSPEASRYVFKNESIQPFSPFHVKVGVYNNEGEGPFGPVITIYSAEEEPGRAPTRVRARSLSAAEIEVSWKALPWNASKRRVLGYELRYWSKSE--REDTASVQRTVGNQ---------TSSIIRGLRGSTSYYISVRAYNTAGTGPPSGTVNVTTKKPPPSQPPDKVMWNTSNS--KIIVNWEQVKALENESEVTGYKVLYKKNRHSRPSVMETNT----TSVELALPTDEDYIIQIKPFGEGGDGSSS 992          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Match: cntn4 (contactin-4-like [Source:NCBI gene;Acc:101167031])

HSP 1 Score: 294.278 bits (752), Expect = 2.466e-82
Identity = 274/1071 (25.58%), Postives = 438/1071 (40.90%), Query Frame = 1
Query:  661 FGQSDLTNIKRGPCILDQPTDQLYAPQ-VSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYP-PPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVA--LLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAI-IGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
             G    +++ + P    QP   +Y  + V N + V F+C   G+P P   W               + L       + +GG L I+  +   D     C   N +GT +SR+  +    LE +    R  + + +  G +L C PP H     +V+++               +Q + R   F+S   G +  +     D G Y C+V    +T T  + P  PL + +   +    P +  +FP     +   G TV  ECF  G     P   + + +  P P K         + +   Q +D G Y C  E   G   +     LS  A P  + KP++    +  S+   C+A GKP+   +W +N     S            TE  + VA  +L I+ +  +D  M  C   N  G+  +  EL+ ++  P+F    L +   + +G   ++ C+P+ SP   I+W K    L  S              R+  L N +L I NV  SD G Y C A N  G A+S+  + V  A  +T  P      V  +V LPCQ +  P L++ + W+F    + F   D    +              G + I NIQ      YTC V T  + I S AL  ++  P           + + +  + W  G D+  PI  Y ++ A+   +  W  +      T +  +     L     V  +L     +  R+ A+N  G GEPS PS+  +T +  P+  P NV+GGGG    LVI WEP+    +NG  F Y + ++      W+ A      ++ + +  +      + + +  F V+V   N  G GP+  V  I SA + P  AP  V A S ++  I V WKA    + +  + GY + YW +    +   AS  R   +Q         TS +I GL     Y I V+ +NTAG    S  V+ TT K PP   P  V  N++N+  +I V W  V+ +  E  V GY++ Y  +     + ++ +     T +   L  D  Y +++  +  GG+G  S
Sbjct:   14 MGSLAESSVLQSPVFTKQPGSIVYPVETVENGREVVFSCEARGSPAPAYRWKLNG----------TEILPKAGSHFSLSGGNLRISRLNRDRDAGTYQCLASNSFGTIVSREASLTFAYLESFKTQRRSPVSVREGQGMVLLCGPPPHS--GDLVFSWIFNESTT-------FVQQETRR--FISQETGNLYIAKVEPSDVGNYTCVVT-NTVTKTRVQGPSTPLVLRSDGVMGEYEPKIEVQFPEI--VHVAKGSTVKLECFALG--NPAPSITWRREDGAPFPRKVDTRKTNGVLEIPYFQQDDVGTYECVAENSRGMNKVKGK--LSFYAPPHLIEKPQDVQKLIDDSLVWECKATGKPKPSYRWMKNGENLES------------TEERIQVANGVLSISRLTLSDTGMYQCVAGNKHGEVYSNAELRVIAAAPDFSHNQLRSQTMVKVGGDMLVECRPKMSPWGVISWRKGSEPLQQS-------------NRIVILDNGSLRIWNVTKSDAGLYTCVARNQFGMASSTGSVTVKEASVITTQPSTLDATVGESVVLPCQVSHDPSLELKFTWFFNEQLIHFGSHDGFFEKVGGQHSA-------GDIMIRNIQLKHAGKYTCAVQTKVDSI-SVALDLIVRGPPAPPTHIQVEEITDTTASLSWRPGPDNHSPITAYTIQ-ARTPFSLGWQAV------TTVPEVVGGRQLT---AVVIDLNPWVEYEFRVLASNRIGTGEPSKPSKQARTKSTSPKVTPANVSGGGGSRSELVITWEPVPEELQNGPGFGYVVAFRPHGATGWMQA------AVPSPEASRYVFKNESIQPFSPFHVKVGVYNNEGEGPFGPVITIYSAEEEPGRAPTRVRARSLSAAEIEVSWKALPWNASKRRVLGYELRYWSKSE--REDTASVQRTVGNQ---------TSSIIRGLRGSTSYYISVRAYNTAGTGPPSGTVNVTTKKPPPSQPPDKVMWNTSNS--KIIVNWEQVKALENESEVTGYKVLYKKNRHSRPSVMETNT----TSVELALPTDEDYIIQIKPFGEGGDGSSS 990          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Match: cntn2 (contactin 2 [Source:NCBI gene;Acc:101161878])

HSP 1 Score: 293.123 bits (749), Expect = 6.580e-82
Identity = 271/1020 (26.57%), Postives = 436/1020 (42.75%), Query Frame = 1
Query:  694 GPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFT-KDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFD-NKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITR-----KNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCM--VGWRGLTGTSYKSPDIPLEVFA-SNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPL-KYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSV--ALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLN-TEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRY 3711
            GP   ++P+  +Y   ++  K VT +C    NP  +  W     +   G +R             T   G L I+ P+ + D     C V N  GT ISR   +  G L  ++ + R      +  G  L C+PP H P  ++ Y + I       + D G        SQ+  N+FL+              D+  Y C   +     T +++  P IPL V   +N     P +  +FP    +    G TV  ECF YG    NP+ K  W+  +  +P K   +     + L ++ F+DEGVY C     +GR +      +S+ A+P +V    +   ++ S +  +C + GKP+  ++W RN  P               T+  V V  A L I+ +   D+ M  C   N  G   A  EL+     P+F   P+     A  G   +I C+P  +P P + W++ G++L              + +R+   P+  L+I+NV  +D+G Y C A N LGKANS+ +L V +A  +T  P    +    NV L C A+  P +D+ + W  + V L  +     A RY + Q         G L I N Q      +TC   T  +  S+SA + V+  P    G  +  +V + S  + W+ G+D+  PI  Y + + +   + +W        K   +P   + N    + +   L A  ++R ++ A+N  G GEPS PS   +T    P  AP  + GGGG    L++ W P+    +NGD F Y + ++      W        +S  +  Y Q      +   Y  F+V+++A N  G GP+S    + SA + P+  P  ++A + ++  I V W+     S  G ++GY I YW +      + A+ DR+ T+       G   +  + GL     Y + V  +N+AG    S     TT K PP   P  V      +  Q+ V W+ V  +  E +V GY++ Y
Sbjct:   32 GPVFEEEPSSLIYPEGLTEGK-VTLSCQARANPAASYRWLLNGTEVPLGSERH------------TLVAGNLVISSPEPSRDTGSYQCLVINRCGTIISRAANLKFGYLHDFSPDSRSPQTAYEGVGTFLACQPPPHYP--ALSYRWLINEFPNFIRADDGRW----FVSQVSGNLFLAK---------AEPNDTANYFCFTTINLDISTKSTFSKP-IPLSVLPNANPRKSAPTIKVRFP--AETYALTGHTVTLECFAYG----NPVPKLRWRKVDGLMPSKTGSSAEGPTLILPDLSFDDEGVYECEAYNSEGRDT--HQGRISVQAQPDWVQVMSDSEVEISSELLWSCLSSGKPRPSVRWLRNGQPV-------------ITQDRVEVNGANLKISSLALDDSGMYQCVAENKHGTIYASAELRVQVQAPDFRLNPVRRLIPAARGGQVMIECRPRAAPKPILFWSR-GTEL------------LANSSRITVAPDGTLWIRNVSRADEGKYTCFAENYLGKANSTGHLSVRDATKITLAPSNADINQGENVTLQCHASHDPTMDLTFTWALKGVLLDLED---PAGRYFRIQGQ----ENIGDLLIVNAQLSQAGIFTCTAQTVVDSASASARL-VVRAPPGPPGGILVKMVTDTSVELWWSHGHDNHSPIGKYII-MGQSSLSSEW-------KKMRTEPANIEGNAESARVI--GLMAWMDYRFQVIASNILGKGEPSQPSARIRTQPAAPTVAPSGLGGGGGDHHELIVTWTPMAREYQNGDGFGYILAFRRKGTAAWSEVRIPHVESSRHVYYNQ------SLAPYTPFEVKIQAYNRKGVGPFSQTVEVHSAEEEPTVGPASINATALSAFEIQVSWEPVQQLSANGILRGYEIRYWRQ----HEREAAADRVRTA-------GLEPTARVSGLRPSTRYHVAVFAYNSAGTGPSSPRTTVTTRKPPPNRPPGNVSWKIQGS--QVAVRWDHVTALHNESAVLGYKVLY 951          

HSP 2 Score: 54.6842 bits (130), Expect = 8.865e-7
Identity = 58/247 (23.48%), Postives = 100/247 (40.49%), Query Frame = 1
Query: 3157 YIQFQVQVRATNIMGPG-PWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVY-------WMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYW------LSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLS 3855
            ++ ++ QV A+NI+G G P    + I +    P+ AP  +     +   + V W   A     G   GY + +       W  V     +++ +   N S                 L     + + +Q +N  G    S  V+  + ++ P   P  +   + +   +IQV+W  V+ +     + GY IRYW       +   VRTA     GL+ T  ++ L+   RY++ VFAY+  G G  S
Sbjct:  677 WMDYRFQVIASNILGKGEPSQPSARIRTQPAAPTVAPSGLGGGGGDHHELIVTWTPMAREYQNGDGFGYILAFRRKGTAAWSEVRIPHVESSRHVYYNQS-----------------LAPYTPFEVKIQAYNRKGVGPFSQTVEVHSAEEEPTVGPASINATALSA-FEIQVSWEPVQQLSANGILRGYEIRYWRQHEREAAADRVRTA-----GLEPTARVSGLRPSTRYHVAVFAYNSAGTGPSS 900          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Match: SMESG000036495.1 (SMESG000036495.1)

HSP 1 Score: 2575.82 bits (6675), Expect = 0.000e+0
Identity = 1290/1295 (99.61%), Postives = 1294/1295 (99.92%), Query Frame = 1
Query:  133 GQTNTPMCPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLIDVPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLSXXXXXXGMIVKKCIV 4017
            GQTNTPMCPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLIDVPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEV+ASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNN PLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGT+TIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQVIGPPGVGGGITVTPLVGNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPKNVTGGGGKVGTLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITA+NFINKSL+NDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLSILLLIIGMIVKKCIV
Sbjct:   18 GQTNTPMCPSDDAIATGCPSGWYSYLTNCYQFNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQWYTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLIDVPDINNLVAWNKDRSKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSDLTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVYASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNNPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTNTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQVIGPPGVGGGITVTPLVGNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQKAPKNVTGGGGKVGTLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWITASNFINKSLENDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYWMRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMFNTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMPEEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFAYSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLSILLLIIGMIVKKCIV 1312          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Match: SMESG000025433.1 (SMESG000025433.1)

HSP 1 Score: 134.806 bits (338), Expect = 2.016e-31
Identity = 190/845 (22.49%), Postives = 308/845 (36.45%), Query Frame = 1
Query:  748 NSKLVTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQ--TGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNKP-----LPPKAVITDFERRV-TLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYR-----YFGTLKIYNIQFYDEANYTCRVTT--PFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIPPQ---KAPXXXXXXXXXXXXLVIRWEPLLPLEENGDNFAYEIRYK--ESKEIEWITANNFINKSLD-------NDKYRQVTLDLPANKDYIQFQVQVRATNIMG 3201
            N + +   C   GNP PT +WY                +S   G+ T+    G L    P++  D    C   NDYG A S +  + R  ++ +     + L + +     L C+ P   P   + +       N     V ++++   +    +  NL + G S+    D   + C      +  T    P   + V  S +  P   V   F   +P    +G+ +I  C   G    NP   + +WN K      L      TD    +  +N +   D+G Y C  E             + + + P   +K  +     G S   TC A G P+  + W  N     ++L  N   +     GN      +++G    D A+  CN  N  G + +   +  +   P F   P         T+  I CQ   +P   +TWTKDG         FN     ++  R     N +L I  +  +D GTY+C+A N  G  + ++ L V     L   P+   V     V   C A              +  RL+   + +   + +    M  Y R        +L I   Q  D   Y+C  T    F+V  ++ ++Q      +G       L      +V W  G D+  PI+ Y +E + +   + WY ++  +  T     T    +    F+         +  R+ A N  G+ EPS P++ +   A+PP      PKNV   G     LVI+W P+  +E+ G    YEI       K I     N       D       N +   ++ D+   + +  FQV +RA N +G
Sbjct:   40 NLEALMLRCVATGNPSPTYTWYKNNKKFD---------MSINVGRYTRWPNEGTLIFALPNDDDDGIYQCVASNDYGKAFSIKSNVRRAEIQDFKSKDVEKLSLNNGASVKLQCQVPVSFPPPIVAW-------NKIKYGVPELLKESSKYVTDVDGNLYITGISMDD--DRAQFTCTAFNERMRITKTDHP-YEITVIPSQSNIP---VSLLFRTLQPIKGRVGEKLILRCIMGG----NPAPTY-QWNAKGQTSNILERPNFNTDAGGAILIINPVTAADKGTYQCRAENAVSTTPTFVDFAVDVESTPILTMKLSDANVPYGGSQVFTCDATGDPKPQITWTVNGEGLDTYLNGNNKKK----TGNTIFLTNLVSG----DQAVFQCNASNTVGYDYSNGYINVLRDKPEFINGPQPTLTKAENTAVTINCQTFSAPKAIVTWTKDG---------FN-----INGGRYLIQDNGDLLISKLITADSGTYSCSAANLYGSVSGTSVLYVRQRTELMIRPINTWVYFGQEVKFVCTA--------------KTDRLETKNLKIIWNKDNNPITMGSYERTNTNPQDNSLIISGSQTTDTGIYSCNATNGLDFDVAYATLIVQGKPHTPIGITADCARLATLSQALVSWNPGADNYAPIIMYLVEYSTQFDRKGWYEVERVVQPTGSTGDTVDVKVTMRPFI--------QYWFRVRAMNRVGVSEPSDPTQNY--CALPPAIPYSNPKNVFVYGTAKDNLVIQWTPMTYVEQCGPKLGYEISVMCITCKSIPQNRTNTTFISDWDQNIVTYYNFRLGSISYDM---ESFQLFQVNIRAKNEIG 808          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Match: SMESG000005684.1 (SMESG000005684.1)

HSP 1 Score: 104.375 bits (259), Expect = 4.204e-22
Identity = 157/699 (22.46%), Postives = 279/699 (39.91%), Query Frame = 1
Query:  850 LIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEV----FASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFEC-FGYGEIKQNPLKYFWKWN-NKPLPPKAVITDFERRVTL--NNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--ESAFIEL---KTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAG--TPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTT--PFNVISSSALIQXXXXXXXXXXXXXXXXXXNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELP-ANTNFRLRLFAANSFGIGEPSG 2892
            L +  S  N  V Q  G L I       +    C   N  G AIS + ++    +  Y+    + + +  +   +L+C+ P+  P  SI +        D G +    I  +  N   L  N  L    I    D   Y C +       T  +  D  +++     +S+ L P   +++   N + +   L  TV+  C F  G ++     +F + + N  + PK       +  TL  +NI+ +D G Y C  E ++ + ++    T+++  KP F+ +P ++   + SS    CQA G+P+  ++W  N      +L  N D  +    GN     L +N + T D  +I CN  NI+G    +AFI +   K + LVP     P    + ++  +  I C     P P I W KD   L+L  +N           +     N NL IKN+ ++D G Y C A+N  G+  + + + +     + +    +R Q+  +V L C A        ++  +W+ +N  LK  +    A                  LK+ ++   D   Y C  +    +++      ++    P     +       +   ++ W DG+ +   I  +  E   +   + W  +   +N+T  + I + NN I+N    +  P    NFR+R  + N  G  +PS 
Sbjct:   50 LKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWV----NVKDYGRL----ISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSC-ISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYNS--NLE-NTVLLNTTVLLSCIFSRGSVR-----WFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC--EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYL--NGDRIH--LHGNK----LYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVP-----PQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTN-----------KYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAA-------------ILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILP-VNET-FQTIIRPNNKIKNNTWVTIHPYIKYNFRIR--SVNKLGTSQPSS 688          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Match: SMESG000018028.1 (SMESG000018028.1)

HSP 1 Score: 100.138 bits (248), Expect = 2.630e-21
Identity = 86/366 (23.50%), Postives = 153/366 (41.80%), Query Frame = 1
Query: 1486 WNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTC---QAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQ 2574
            + +KP     ++ D E  +   ++  +DEGVY CN   + G  +I+ + ++ I      ++ P+++   VG +V + C   + V KP VI ++  N I  +  +            GN     L I+     D+    C   N   +  +   L TV   P F   P  N E  +  + + PC  +G P PTI W +D  +              +  +R   + N  + I  V+ +D G Y C A+NS G   + A L V++       P  ++V+V       C+  G+P   I +    ++    F   + ++RR ++ Q  +      G+L I  ++  D   Y C+ ++    I SSA + 
Sbjct:   69 YRDKPATSNRLVKDNE--LLFMHLDTQDEGVYYCNASNIHGW-TISNNASVLIAFLNKDIIGPESKTASVGETVLMECKPPKGVPKPTVIWKFNGNAIEVNKRIKI-------LDNGN-----LRIDKATRKDSGRYNCLAKNFADERDSTSALLTVRQKPQFKIAP-SNIEVKVNEAAVFPCVADGDPKPTIVWRRDNQK-------------KIPSSRATLIDNKGMQISKVQLTDMGNYICHASNSAGHLEAYAKLSVVSTPGFIETPDNQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDH----FIADEENSRRSERIQVDK-----LGSLTINPVKISDSGKYECKASSYIGKIQSSASLH 396          

HSP 2 Score: 96.6709 bits (239), Expect = 2.960e-20
Identity = 113/490 (23.06%), Postives = 186/490 (37.96%), Query Frame = 1
Query:  760 VTFTCNVYGNPFPTVSWYFTKDTAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFK--PSN--PFLGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSL---VPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYAC 2208
            V+  C+  G+P P + WY      +  +         T+ ++ +   LL ++  D   +    C   N +G  IS    ++   L      P         T  +++C+PP   PK ++++ F             + I+   R  I  + NL +      + KDSG Y C+            + +   E  +++ L     V  K P FK  PSN    + +  +F C   G+ K  P   + + N K +P         + + ++ +Q  D G Y C+     G +       LS+ + P F+  P NQ   VG +    C+  G PQ  + W  N   F   +A   + R +       +  L IN VK +D+    C   +  GK  +   L  +     VP   +    N    IG +    CQP+     T+ W K+G QL+L           V   R+ +L    L I  +  SD G Y C
Sbjct:   43 VSLRCSAKGDPMPNIIWYKDGQVVESYRDK-----PATSNRLVKDNELLFMH-LDTQDEGVYYCNASNIHGWTISNNASVLIAFLNKDIIGPESKTASVGET-VLMECKPPKGVPKPTVIWKFN-----------GNAIEVNKRIKILDNGNLRI---DKATRKDSGRYNCL------------AKNFADERDSTSALL---TVRQK-PQFKIAPSNIEVKVNEAAVFPCVADGDPK--PTIVWRRDNQKKIPSSRATLIDNKGMQISKVQLTDMGNYICHASNSAGHLEAY--AKLSVVSTPGFIETPDNQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDHF---IADEENSRRSERIQVDKLGSLTINPVKISDSGKYECKASSYIGKIQSSASLHVIDAQKYVPPVIEVGPQNQTLRIGLTATFNCQPKQQDDVTVHWLKNGHQLNL-----------VSDPRIITLTTGKLKINLLRMSDAGNYTC 477          

HSP 3 Score: 90.8929 bits (224), Expect = 2.093e-18
Identity = 96/381 (25.20%), Postives = 151/381 (39.63%), Query Frame = 1
Query: 1411 LGDTVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFER-RVTLNNIQFEDEGVYSCNIETM-DGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINAL-----TLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRV 2532
            +G+TV+ EC     + +  +   WK+N   +     I   +   + ++    +D G Y+C  +   D R S   S  L++  KP F + P N    V  +    C A G P+  + W R+         K P  R    +       + I+ V+ TD     C+  N  G   A+ +L  VS  P F + P  N +  +G + I  C+  GSP PTI W+ +G        N  +    +   +L SL      I  V+ SD G Y C A++ +GK  SSA L VI+A       +   P  + +++       CQ       D+   W     +L                  R      G LKI  ++  D  NYTC++
Sbjct:  135 VGETVLMECKPPKGVPKPTV--IWKFNGNAIEVNKRIKILDNGNLRIDKATRKDSGRYNCLAKNFADERDST--SALLTVRQKPQFKIAPSNIEVKVNEAAVFPCVADGDPKPTIVWRRDN------QKKIPSSRATLIDNKG----MQISKVQLTDMGNYICHASNSAGHLEAYAKLSVVS-TPGFIETPD-NQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDHFIADEENSRRS-ERIQVDKLGSLT-----INPVKISDSGKYECKASSYIGKIQSSASLHVIDAQKYVPPVIEVGPQNQTLRIGLTATFNCQPKQQD--DVTVHWLKNGHQLNL------------VSDPRIITLTTGKLKINLLRMSDAGNYTCKI 479          

HSP 4 Score: 61.6178 bits (148), Expect = 3.169e-9
Identity = 73/300 (24.33%), Postives = 111/300 (37.00%), Query Frame = 1
Query: 1651 KPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTE---AIIGTSTIIPCQ-PEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANS-SAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVT 2535
            KP     P + +      V+L C A G P   + WY++     S+  K P       + N     L+   + T D  +  CN  NI G    +      S++  F    ++  E   A +G + ++ C+ P+G P PT+ W  +G+ + ++              R+  L N NL I      D G Y C A N   + +S SA L V         P    V+VN     PC A G P   I   W  +N +              K    R        ++I  +Q  D  NY C  +
Sbjct:   25 KPIISEHPASTHGLSLQRVSLRCSAKGDPMPNIIWYKDGQVVESYRDK-PATSNRLVKDNE----LLFMHLDTQDEGVYYCNASNIHG----WTISNNASVLIAFLNKDIIGPESKTASVGETVLMECKPPKGVPKPTVIWKFNGNAIEVN-------------KRIKILDNGNLRIDKATRKDSGRYNCLAKNFADERDSTSALLTVRQKPQFKIAPSNIEVKVNEAAVFPCVADGDPKPTI--VWRRDNQK--------------KIPSSRATLIDNKGMQISKVQLTDMGNYICHAS 286          
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Match: SMESG000064665.1 (SMESG000064665.1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.388e-18
Identity = 97/388 (25.00%), Postives = 158/388 (40.72%), Query Frame = 1
Query: 1420 TVIFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYR-----NEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVN------TNVYLPCQAAGTPYLDIDYDWYFENVRL-----KFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVT 2535
            TV+ +C     + +  ++  WK N     P+  + D    + ++NIQ  D G+Y C  + +      +  + L +  KP F + PK+    V S +   C  +G   + +QWY+     N+I  S     N          N S   ++IN VK  D+    C   N  G      +L  +S  P+F + P  N    +G    + C   G P P + W            N N++I            N  L I +V + D G Y C A++ +G + S A L  ++A      P+  +V  N      +NV L CQ  G+ +  I+  WY  ++++       +R++L                  G LKI N++  D A YTCR+T
Sbjct:  112 TVLLQCLEPDGLPKPKIE--WKSNLSINNPRFKL-DSNNNLRIDNIQRSDAGLYWCEAKNL-AFTRTSSYIELIVFQKPIFHILPKHLQVMVSSHILFPCLVIGDSPMFIQWYKLGSGKNDISLSRTALSN----------NCS---MIINNVKLEDSGAYVCRARNSGGITEIIYKLSVISF-PSFIETPE-NIRTTVGEKVALRCSASGVPAPKVFWWHTNQYFLSDIDNNNRII---------VFENGTLSISSVRSKDSGKYYCYASSFVGVSRSEATL-FVDAPKGMFPPIISKVPQNITTIEGSNVILTCQVFGS-FTSIN--WYKLSLKIVGNIPSSNRLELLKN---------------GDLKITNVKIKDSAAYTCRIT 452          

HSP 2 Score: 68.5514 bits (166), Expect = 3.825e-11
Identity = 89/342 (26.02%), Postives = 138/342 (40.35%), Query Frame = 1
Query: 1570 EGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAV---GKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNI-FGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPCQPEGSPTPTITWTKDGS---QLSLSPSNFNQVIGAVDCTRLCSLPNN-NLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALI 2571
            EG Y CNI    G  +++    + I     F+ +  N    V  S T+  Q +   G P+  ++W  N       L+ N +PR+     N     L I+ ++ +D  +  C   N+ F + S++IEL  V   P F   P  + + ++ +  + PC   G     I W K GS    +SLS +               +L NN ++ I NV+  D G Y C A NS G       L VI+  +    P   R  V   V L C A+G P   +   W+  N   ++   D+D          R      GTL I +++  D   Y C  ++   V  S A +
Sbjct:   68 EGFYQCNISNSYG-FTLSEKSAVRIAYLHNFL-ESNNSRKFVSPSTTVLLQCLEPDGLPKPKIEWKSN-------LSIN-NPRFKLDSNNN----LRIDNIQRSDAGLYWCEAKNLAFTRTSSYIEL-IVFQKPIFHILPK-HLQVMVSSHILFPCLVIGDSPMFIQWYKLGSGKNDISLSRT---------------ALSNNCSMIINNVKLEDSGAYVCRARNSGGITEIIYKLSVISFPSFIETPENIRTTVGEKVALRCSASGVPAPKV--FWWHTN---QYFLSDIDNNN-------RIIVFENGTLSISSVRSKDSGKYYCYASSFVGVSRSEATL 366          
The following BLAST results are available for this feature:
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTN21.776e-8726.75contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172][more]
CNTN21.776e-8726.75contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172][more]
CNTN21.776e-8726.75contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172][more]
CNTN21.776e-8726.75contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172][more]
CNTN28.366e-8726.75contactin 2 [Source:HGNC Symbol;Acc:HGNC:2172][more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lad-21.638e-3523.79L1 CAM ADhesion molecule homolog [Source:UniProtK... [more]
rig-42.266e-3523.00pep chromosome:WBcel235:IV:7991410:8004136:-1 gene... [more]
rig-42.266e-3523.00pep chromosome:WBcel235:IV:7991410:8004119:-1 gene... [more]
sax-37.746e-2724.09pep chromosome:WBcel235:X:3451945:3465925:-1 gene:... [more]
sax-37.896e-2724.09pep chromosome:WBcel235:X:3451945:3465925:-1 gene:... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cont1.578e-11728.33gene:FBgn0037240 transcript:FBtr0078917[more]
sdk3.062e-4725.86gene:FBgn0021764 transcript:FBtr0302259[more]
sdk3.062e-4725.86gene:FBgn0021764 transcript:FBtr0070132[more]
sdk3.062e-4725.86gene:FBgn0021764 transcript:FBtr0070130[more]
sdk3.062e-4725.86gene:FBgn0021764 transcript:FBtr0070133[more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cntn3a.14.957e-8126.51contactin 3a, tandem duplicate 1 [Source:ZFIN;Acc:... [more]
cntn3a.11.438e-8026.51contactin 3a, tandem duplicate 1 [Source:ZFIN;Acc:... [more]
cntn59.893e-8026.78contactin 5 [Source:NCBI gene;Acc:327429][more]
cntn47.240e-7526.74contactin 4 [Source:ZFIN;Acc:ZDB-GENE-060929-776][more]
cntn3a.22.808e-7227.88contactin 3a, tandem duplicate 2 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTN12.469e-8427.05contactin 1 [Source:NCBI gene;Acc:100487602][more]
CNTN15.258e-8427.11contactin 1 [Source:NCBI gene;Acc:100487602][more]
CNTN15.340e-8427.11contactin 1 [Source:NCBI gene;Acc:100487602][more]
CNTN12.007e-8227.03contactin 1 [Source:NCBI gene;Acc:100487602][more]
cep1319.405e-8227.57centrosomal protein 131kDa [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cntn31.374e-8927.71contactin 3 [Source:MGI Symbol;Acc:MGI:99534][more]
Cntn31.374e-8927.71contactin 3 [Source:MGI Symbol;Acc:MGI:99534][more]
Cntn11.483e-8527.34contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
Cntn11.483e-8527.34contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
Cntn11.483e-8527.34contactin 1 [Source:MGI Symbol;Acc:MGI:105980][more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VN14|CONT_DROME1.582e-11628.33Contactin OS=Drosophila melanogaster OX=7227 GN=Co... [more]
sp|P14781|CNTN1_CHICK1.321e-9127.23Contactin-1 OS=Gallus gallus OX=9031 GN=CNTN1 PE=1... [more]
sp|Q07409|CNTN3_MOUSE9.611e-8927.71Contactin-3 OS=Mus musculus OX=10090 GN=Cntn3 PE=1... [more]
sp|P28685|CNTN2_CHICK6.787e-8727.23Contactin-2 OS=Gallus gallus OX=9031 GN=CNTN2 PE=1... [more]
sp|Q02246|CNTN2_HUMAN8.531e-8726.75Contactin-2 OS=Homo sapiens OX=9606 GN=CNTN2 PE=1 ... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1JUB40.000e+076.64Contactin/TAG-1 cell adhesion molecule OS=Dugesia ... [more]
A0A074Z3P40.000e+040.58Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A4S2LKJ40.000e+040.63Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SEE00.000e+040.63Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3Q0KTI20.000e+040.40Septate junction protein OS=Schistosoma mansoni OX... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNTN13.067e-8027.26contactin 1 [Source:NCBI gene;Acc:103023464][more]
CNTN11.219e-7927.26contactin 1 [Source:NCBI gene;Acc:103023464][more]
cntn22.459e-7825.46contactin 2 [Source:ZFIN;Acc:ZDB-GENE-990630-12][more]
cntn3b6.109e-7826.69contactin-3-like [Source:NCBI gene;Acc:103046198][more]
cntn3a.27.603e-7627.88contactin-3 [Source:NCBI gene;Acc:103045683][more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cntn3b9.381e-8926.70contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
cntn3b4.178e-5926.09contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
nfasca1.985e-4622.81neurofascin homolog (chicken) a [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000005094.13.366e-2926.44pep scaffold:Pmarinus_7.0:GL476871:314859:363619:1... [more]
ENSPMAT00000010567.11.133e-2824.77pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453432.117e-2524.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469462.205e-2325.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469613.062e-1923.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495532.903e-1622.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322978.646e-1629.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cntn3a.14.626e-8626.82contactin-4 [Source:NCBI gene;Acc:101159916][more]
cntn3a.13.255e-8426.63contactin-4 [Source:NCBI gene;Acc:101159916][more]
cntn48.020e-8325.73contactin-4-like [Source:NCBI gene;Acc:101167031][more]
cntn42.466e-8225.58contactin-4-like [Source:NCBI gene;Acc:101167031][more]
cntn26.580e-8226.57contactin 2 [Source:NCBI gene;Acc:101161878][more]
back to top
BLAST of Contactin/TAG-1 cell adhesion molecule vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036495.10.000e+099.61SMESG000036495.1[more]
SMESG000025433.12.016e-3122.49SMESG000025433.1[more]
SMESG000005684.14.204e-2222.46SMESG000005684.1[more]
SMESG000018028.12.630e-2123.50SMESG000018028.1[more]
SMESG000064665.13.388e-1825.00SMESG000064665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005762 ID=SMED30005762|Name=Contactin/TAG-1 cell adhesion molecule|organism=Schmidtea mediterranea sexual|type=transcript|length=4197bp
TTTAATTTTCTTAAATTTAAATTGTTTAAAATTTAAATTAAATTCTGAAA
GGAAGAAATATTTGAAATATAGTAGATGCAAATGGAATATTTGTATTTTT
TTTTAAATATACTATTTTTTACATTTATCAATGGTCAAACTAATACTCCA
ATGTGCCCATCAGACGATGCAATTGCAACTGGTTGTCCAAGTGGATGGTA
CAGCTATTTAACCAATTGCTATCAATTTAATTATTCACCAGTATCAAATT
TTGTACAAAGTCGAGATGCTTGCAATCTTCTGGGCGCTCGATTATTAAGA
ATAAATGACCTTATTCAACATCAATTTTTTTCTGATTTGCTAAATAACAA
TGCAGTTAATCGATCAATTCAGTGGTACACTGCAGGGGCAATGGACTCTC
AGAGCACGGGTAGATATATTTGGGATGGGTTTCCACCAGATTTGAAAACA
TTCAACACGGAACTGATCCCATTATTGATCGATGTACCTGATATTAATAA
TTTGGTTGCTTGGAACAAAGACAGATCAAAAATCGTCTATATTTACTACA
ACATGAAATGGATGTTAAATCTTACAACGCCTACTGATAACAACTATTTT
ATATGTGAATCACCGAAATCGGTCATTACTAAAACAGTTTCAATGTCAAG
ATCAGCCGATTTCGGTCAAAGTGATTTGACCAACATTAAAAGGGGCCCAT
GTATCCTCGATCAACCCACCGATCAGTTATATGCACCACAAGTTTCTAAC
TCCAAACTTGTTACCTTTACCTGCAACGTTTATGGGAATCCATTTCCAAC
AGTCTCTTGGTATTTCACAAAGGATACTGCTCAGGGACCGCAGCGTACTT
TAATCGATGCATTATCCTATACCAATGGAAAGGTTACGCAAACTGGGGGT
CTTTTAACAATAAATGATCCCGACAATACTTTTGACAACAAAATAGACTG
TCAAGTTCAGAATGATTATGGGACTGCCATATCTAGGCAAGTTCAAATTA
TTCGAGGACGTCTGGAAATCTACACCAAGAATCCTCGTCAATTATTGCGT
ATGCCAGACAATACTGGATTTATGCTTGATTGTGAACCTCCTGATCACGA
TCCAAAAGATAGCATCGTTTATACATTTTATATAACTCGTAAAAATGATA
AAGGAGAGGTTGTCGATGACGTTATTCAAAGCCAACTGAGAAATAATATT
TTCTTATCGTACAATCTTGGTTTAATAGGATTTTCTATTGGCAGTGTGAA
AGATTCTGGAACTTACAAATGCATGGTTGGATGGAGAGGTCTCACCGGAA
CATCATATAAATCTCCTGATATTCCACTTGAAGTGTTTGCTTCCAATACG
CTTTATCCACCTCCAAATGTCCATGATAAATTTCCGAATTTTAAGCCCTC
TAATCCGTTTCTTGGTGATACAGTGATTTTTGAATGTTTCGGTTATGGGG
AAATCAAACAGAATCCTTTGAAATATTTCTGGAAATGGAACAACAAGCCG
TTGCCACCGAAAGCTGTAATTACCGATTTTGAAAGAAGAGTAACATTGAA
TAATATTCAATTCGAAGATGAAGGCGTTTATTCGTGTAACATCGAAACAA
TGGACGGTAGAGTGTCTATTGCACGATCTGTCACACTGAGCATTAATGCC
AAACCGACCTTCGTTGTCAAACCGAAAAATCAATATCCAGACGTCGGTTC
ATCAGTAACCCTAACCTGCCAAGCCGTTGGCAAACCACAAGTCATCATGC
AATGGTACAGAAATGAAATACCTTTCAGCAGTTGGCTCGCTAAAAATCCC
GATCCACGTTACAATTTCACAGAAGGAAACGTTTCGGTCGCTTTGCTCGT
AATCAACGGTGTCAAAACCACAGACAACGCGATGATTGGCTGTAACATTT
ACAACATATTTGGCAAGGAATCGGCATTTATTGAATTAAAAACGGTTTCA
CTAGTTCCGAACTTTGATAAATATCCTCTCCTCAACACGGAGGCCATTAT
CGGGACGAGTACAATAATTCCATGCCAGCCAGAAGGGTCCCCAACGCCTA
CGATTACATGGACCAAAGATGGATCACAGCTGTCTTTATCACCATCGAAT
TTCAATCAGGTTATCGGCGCAGTTGATTGCACTCGTTTATGTTCTTTACC
GAACAATAATCTATTCATCAAAAATGTTGAAGCGTCTGACAAGGGTACAT
ATGCATGCACTGCCACTAATTCACTAGGAAAGGCAAACAGTTCAGCATAT
TTGGATGTAATTAATGCACTTACTCTGACCAATAATCCTGTCGGCCGCAG
AGTACAAGTAAATACGAATGTCTATTTGCCTTGCCAAGCTGCCGGAACTC
CATATCTCGATATTGATTACGATTGGTACTTTGAGAATGTACGACTGAAA
TTCGATAGAATGGACCTAGATGCCCGTAGATATGACAAATCGCAATTTAT
GCGACCATATTATCGATATTTTGGCACACTGAAAATATACAACATTCAAT
TTTACGATGAAGCAAATTATACATGCCGAGTCACCACGCCTTTCAATGTC
ATCTCAAGCAGTGCACTTATTCAAGTTATTGGGCCACCTGGAGTAGGAGG
AGGAATTACAGTGACACCTCTCGTAGGAAATGTCAGTAATGTAGTTGAAT
GGACTGATGGCTATGATCATGGTCAACCAATTCTCTGGTATCGATTAGAA
GTTGCTAAAGAAGATGGAACACAAAAATGGTATCCTCTGAAGGAAAGAAT
TAATAAAACAGATATTAAACCAATTACAAAACAAAATAATCTGATCAGAA
ATCAATTTGTATTTTCTGAGTTACCAGCTAATACTAATTTTCGATTGAGG
CTATTTGCTGCTAATAGCTTTGGAATAGGTGAACCTAGTGGTCCAAGTGA
AGTGTTCAAAACTGCAGCTATTCCACCGCAAAAAGCACCGAAAAATGTTA
CCGGCGGTGGTGGCAAAGTTGGGACACTTGTCATCCGATGGGAACCTTTA
TTACCTCTCGAGGAAAATGGAGATAATTTTGCGTATGAAATTAGATACAA
AGAATCCAAAGAAATTGAATGGATTACTGCAAACAATTTTATAAATAAAT
CTCTGGACAATGATAAATATCGTCAAGTAACCTTGGATTTACCCGCCAAC
AAGGATTACATTCAATTTCAAGTCCAAGTTCGAGCAACAAATATAATGGG
CCCTGGACCGTGGTCGGATGTTTCGAATATTACTTCCGCGTCCAAATTAC
CAAGTTATGCGCCTCAAGATGTTCATGCCAACTCATTCAATTCCACAGCT
ATAAATGTGGATTGGAAGGCACCTGCTATTGGATCTGGAGAAGGTCCGAT
TCAAGGTTATCACATTGTTTATTGGATGAGAGTATCCGATTGCAAATCGC
AAGCAGCAAGCTACGATCGACTGAATACTTCTCAACGTTTGACATTATTC
GGAGGTGGCCTCACAAGTGGAGTTATACTTGGTCTTGTAGCTGATCATTA
TTATTGCATTGGTGTTCAGATGTTCAACACTGCTGGTGACAGTCTTGAAT
CAAGTTTCGTTGATCAAACCACTTTCAAGAAACCTCCACAAAATTTCCCG
ACTATTGTCCGATTGAATAGTACTAACACTCCTCATCAGATTCAAGTGAC
CTGGAATGGGGTTCGTGTCATGCCTGAAGAAGAGTCAGTAGACGGATATA
GAATACGATATTGGCTATCTGGTGCTCCAGTTCGCACAGCGTTGGATGTT
GATGTAGGACTCAAGATTACTGGACTGATTAATAATCTCCAATATGATGT
CAGATATAATATGCGAGTCTTCGCTTACAGCCGGGGTGGAAATGGTAAAC
TTAGTAATCCCATGGATCAATTCATGCTTGTGCCTCGATCCAGGTGCCAG
AACGGCAAAATTATCGAGGGACCTGACGTCAGATATGTGTTTATCTGCAG
TGGCAGTCAACAGAAGCTATCCATCCTCTTACTGATTATCGGAATGATTG
TAAAGAAATGCATTGTATGATTTGAAATTCAAGTTGCATTATTTTCGGAA
AGGCTGTGAAATTTATTTTGTATTTTTGTGGAAAGTGATTTTTTATATAT
TAGTGACATATCATCATCTTCAATCTTTGTATTTATTATTTATGATTGTT
TCATAGTAAATAAATTTTCAAATAAACTTTCATTGTTTGAAAAAAAA
back to top

protein sequence of SMED30005762-orf-1

>SMED30005762-orf-1 ID=SMED30005762-orf-1|Name=SMED30005762-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1315bp
MQMEYLYFFLNILFFTFINGQTNTPMCPSDDAIATGCPSGWYSYLTNCYQ
FNYSPVSNFVQSRDACNLLGARLLRINDLIQHQFFSDLLNNNAVNRSIQW
YTAGAMDSQSTGRYIWDGFPPDLKTFNTELIPLLIDVPDINNLVAWNKDR
SKIVYIYYNMKWMLNLTTPTDNNYFICESPKSVITKTVSMSRSADFGQSD
LTNIKRGPCILDQPTDQLYAPQVSNSKLVTFTCNVYGNPFPTVSWYFTKD
TAQGPQRTLIDALSYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGT
AISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYT
FYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCM
VGWRGLTGTSYKSPDIPLEVFASNTLYPPPNVHDKFPNFKPSNPFLGDTV
IFECFGYGEIKQNPLKYFWKWNNKPLPPKAVITDFERRVTLNNIQFEDEG
VYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQA
VGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTD
NAMIGCNIYNIFGKESAFIELKTVSLVPNFDKYPLLNTEAIIGTSTIIPC
QPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKN
VEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVY
LPCQAAGTPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFG
TLKIYNIQFYDEANYTCRVTTPFNVISSSALIQVIGPPGVGGGITVTPLV
GNVSNVVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPI
TKQNNLIRNQFVFSELPANTNFRLRLFAANSFGIGEPSGPSEVFKTAAIP
PQKAPKNVTGGGGKVGTLVIRWEPLLPLEENGDNFAYEIRYKESKEIEWI
TANNFINKSLDNDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVS
NITSASKLPSYAPQDVHANSFNSTAINVDWKAPAIGSGEGPIQGYHIVYW
MRVSDCKSQAASYDRLNTSQRLTLFGGGLTSGVILGLVADHYYCIGVQMF
NTAGDSLESSFVDQTTFKKPPQNFPTIVRLNSTNTPHQIQVTWNGVRVMP
EEESVDGYRIRYWLSGAPVRTALDVDVGLKITGLINNLQYDVRYNMRVFA
YSRGGNGKLSNPMDQFMLVPRSRCQNGKIIEGPDVRYVFICSGSQQKLSI
LLLIIGMIVKKCIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR036179Ig-like_dom_sf
IPR007110Ig-like_dom
IPR016187CTDL_fold
IPR003599Ig_sub
IPR003961FN3_dom
IPR001304C-type_lectin-like
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR016186C-type_lectin-like/link_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007399nervous system development
GO:0031175neuron projection development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 1060..1156
e-value: 0.05
score: 22.7
coord: 1171..1257
e-value: 0.22
score: 20.6
coord: 952..1044
e-value: 12.0
score: 10.7
coord: 837..935
e-value: 0.29
score: 20.2
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 1175..1260
e-value: 2.1E-7
score: 31.2
coord: 1062..1158
e-value: 2.3E-6
score: 27.8
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1174..1272
score: 13.042
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 840..949
score: 12.963
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 954..1057
score: 12.876
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1062..1172
score: 14.359
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1062..1166
e-value: 2.00888E-8
score: 50.9579
IPR003961Fibronectin type IIICDDcd00063FN3coord: 856..946
e-value: 2.97054E-6
score: 44.7947
IPR003961Fibronectin type IIICDDcd00063FN3coord: 968..1053
e-value: 7.64757E-9
score: 52.1135
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1175..1262
e-value: 3.75083E-8
score: 50.1875
IPR001304C-type lectin-likeSMARTSM00034CLECT_2coord: 37..178
e-value: 0.0021
score: 27.3
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 539..613
e-value: 0.073
score: 18.0
coord: 744..824
e-value: 0.078
score: 17.8
coord: 445..511
e-value: 0.085
score: 17.4
coord: 641..718
e-value: 2.6E-14
score: 63.6
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 635..729
e-value: 1.3E-8
score: 44.6
coord: 218..421
e-value: 0.045
score: 22.9
coord: 439..524
e-value: 0.0018
score: 27.6
coord: 738..835
e-value: 3.5E-7
score: 39.9
coord: 533..624
e-value: 2.9E-4
score: 30.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 527..628
e-value: 8.8E-15
score: 56.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1168..1267
e-value: 6.7E-10
score: 41.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1054..1167
e-value: 2.8E-17
score: 64.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 438..526
e-value: 2.6E-8
score: 35.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 629..729
e-value: 1.1E-19
score: 72.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 830..950
e-value: 1.9E-12
score: 49.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 204..309
e-value: 7.1E-10
score: 40.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 730..829
e-value: 1.7E-10
score: 43.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 951..1053
e-value: 3.3E-14
score: 54.9
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 28..192
e-value: 7.1E-14
score: 53.9
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 740..834
e-value: 2.3E-5
score: 24.4
coord: 634..728
e-value: 5.2E-15
score: 55.3
coord: 527..622
e-value: 6.3E-11
score: 42.2
NoneNo IPR availablePANTHERPTHR13817:SF81CONTACTIN-2coord: 180..1177
NoneNo IPR availablePANTHERPTHR13817TITINcoord: 180..1177
NoneNo IPR availableCDDcd00037CLECTcoord: 47..178
e-value: 3.18306E-8
score: 51.0814
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.685
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 628..727
score: 14.002
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 527..625
score: 11.515
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 740..833
score: 8.629
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 208..307
score: 8.375
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 430..522
score: 9.99
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 854..1059
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1062..1263
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 445..533
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 742..838
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 520..622
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 224..302
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 627..728
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 35..183