HNF4

Overview
NameHNF4 (AFF18489.1)
Smed IDSMED30005748
Uniprot Best hitHepatocyte nuclear factor 4-alpha OS=Xenopus laevis GN=hnf4a PE=2 SV=2 (E=3.36704e-108)
Length (bp)3066
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HNF4 (SMED30005748) t-SNE clustered cells

Violin plots show distribution of expression levels for HNF4 (SMED30005748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HNF4 (SMED30005748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HNF4 (SMED30005748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of HNF4 vs. Ensembl Human
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:HGNC Symbol;Acc:HGNC:5026])

HSP 1 Score: 350.903 bits (899), Expect = 5.267e-109
Identity = 178/344 (51.74%), Postives = 244/344 (70.93%), Query Frame = -1
Query:  946 ASNASGPEGMEN------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1938
            +S++S PE   N      N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   28 SSDSSAPETSMNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 364          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:HGNC Symbol;Acc:HGNC:5026])

HSP 1 Score: 347.051 bits (889), Expect = 4.960e-108
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:HGNC Symbol;Acc:HGNC:5024])

HSP 1 Score: 345.895 bits (886), Expect = 3.378e-107
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   23 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 357          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:HGNC Symbol;Acc:HGNC:5024])

HSP 1 Score: 345.895 bits (886), Expect = 5.303e-107
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   23 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 357          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:HGNC Symbol;Acc:HGNC:5024])

HSP 1 Score: 345.895 bits (886), Expect = 6.467e-107
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   45 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 379          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-69 (Nuclear hormone receptor family member nhr-69 [Source:UniProtKB/Swiss-Prot;Acc:P91829])

HSP 1 Score: 226.483 bits (576), Expect = 3.116e-65
Identity = 129/344 (37.50%), Postives = 194/344 (56.40%), Query Frame = -1
Query:  934 QLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVI---LSISQLMQAEQRVAIQKPPNPQEY----------MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK--HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHK------PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPP 1899
            ++C IC+DK+TGKHYGA SCDGCKGFFRRS+RK+ +Y C++ +NC + K+KRN CR CRL+KC+  GMK  A+QNERD I  R+ +      ++I   ++   L Q  +   I+   +   Y            R A + D+ +S+  QL L + WAKSLP FS L  +DQ +LLK  A  I++LGV  RS  L  ++ + L N+ ++ +  + +      +   I+D++  P+R L +D  E+  LKAI+FF+P V E + +  V   RY     L     DK            R G+LLL +P L+ + Q +V+ V+  ++ GL  +DSL+ E +L D  P
Sbjct:    4 EICHICNDKSTGKHYGAISCDGCKGFFRRSIRKRYHYQCRFEQNCDVTKNKRNACRACRLQKCVKAGMKSNAIQNERDAIGKRKKTTGAEKEDLIDQLVAAETLCQQLRSSVIKNTSSLAPYDCGKVKWNYEDARAATLDDIGKSIHQQLVLFIEWAKSLPQFSFLAQADQAALLKGGAASIIVLGVAYRSICLTVENTICLANDTLLPKEHATQVGDINCVVGRIIDEIVNPMRRLNMDLIEYVALKAILFFNPVVREINDQSPVENARYAFLRSLQRRCTDKALENMEDESMDCRSGKLLLLLPSLQAIAQQLVEDVQLARLFGLVNVDSLMEELILNDMKP 347          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-64 (Nuclear hormone receptor family member nhr-64 [Source:UniProtKB/Swiss-Prot;Acc:O44960])

HSP 1 Score: 194.126 bits (492), Expect = 7.995e-54
Identity = 121/330 (36.67%), Postives = 180/330 (54.55%), Query Frame = -1
Query:  949 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRIS-----TRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR----VSESGKEFVRRCRYQIQMDLMNHMNDKQYHK--PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLL 1902
            N  C IC D+ATGKHYGA SCDGCKGFFRR++RK+++Y C++   C++DK KRN CR CR   C+  GM+R AVQ ERDRI      +  S+   +P + +L      +A  R              + A   DV +SM  QL L+V WAK L  F +++   Q++LL+  + + L++    RS  L   D + L N   + ++S        +A  I+D +  P+R L +++ E+  LKAI FFDP      SES  + V   R +I      H+     +K  P RF  LLL +P +  +++ +V+ V+  K+ GLA ID+L+ E +L
Sbjct:   24 NVFCAICGDRATGKHYGAMSCDGCKGFFRRTIRKRHSYVCRFGEKCQVDKAKRNSCRKCRFDVCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITKTAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAFRSIHL--SDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAFFDPLAKGITSESYSD-VEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRDLVEDVQLAKLFGLASIDNLMLELML 350          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-35 (Nuclear hormone receptor family member nhr-35 [Source:UniProtKB/Swiss-Prot;Acc:Q17771])

HSP 1 Score: 196.052 bits (497), Expect = 2.243e-53
Identity = 126/385 (32.73%), Postives = 192/385 (49.87%), Query Frame = -1
Query:  931 VYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSS-------FDDIP---PNVILS---------ISQLMQAEQRVA---------------IQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSS---------DKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFD---PRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGEL-LLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPG 1944
             Y  ++      ++N +C ICSD ATG+HYGA +C+GCKGFFRR+VR+   Y C++   C++DK  R  CRYCR  KCI  GM+   VQ+ERD I  R           D  P   P + +S         +  L+++E  +                  K  N   + +R A + DV +SM +QL L++ WAK+LP F QL+ +DQ  LLK  AG+ + L V  RS  +  +D L L N+L I R S          D  +      ++D L  P+R L+LD+ EF  LKA V F+   P +S      V   R +I      ++   +  +  R G+L    +  L ++++ + + + F K++G+A ID L+ E +L +   G
Sbjct:    4 TYNGDSKAETDGKDNSICHICSDVATGRHYGAIACNGCKGFFRRTVRRNYEYHCRFESKCEIDKHNRAVCRYCRFMKCISSGMRDDQVQSERDVIGKREKKDNMKTYCQDPTPRTSPELTMSPVEDEYDQLLESLLKSEMTIQSLRDTVITQTGNVEYTTKSKNRLSHTDRTATLNDVLKSMHSQLLLVIEWAKTLPEFKQLSGADQAVLLKNFAGQHVTLCVAYRS--VGANDALKLLNDLYIPRASKTTPHLKEYVDGFYLRDCEKVMDQLVEPMRFLKLDNKEFVALKACVLFNPVAPGLSNHAVNLVLNARRKIFAAFEKYVRVNKPLETTRVGDLTFFILTPLSVLSKSISEDIMFTKVSGVARIDVLMEELILAETDYG 386          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-35 (Nuclear hormone receptor family member nhr-35 [Source:UniProtKB/Swiss-Prot;Acc:Q17771])

HSP 1 Score: 196.052 bits (497), Expect = 6.205e-53
Identity = 126/385 (32.73%), Postives = 192/385 (49.87%), Query Frame = -1
Query:  931 VYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSS-------FDDIP---PNVILS---------ISQLMQAEQRVA---------------IQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSS---------DKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFD---PRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGEL-LLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPG 1944
             Y  ++      ++N +C ICSD ATG+HYGA +C+GCKGFFRR+VR+   Y C++   C++DK  R  CRYCR  KCI  GM+   VQ+ERD I  R           D  P   P + +S         +  L+++E  +                  K  N   + +R A + DV +SM +QL L++ WAK+LP F QL+ +DQ  LLK  AG+ + L V  RS  +  +D L L N+L I R S          D  +      ++D L  P+R L+LD+ EF  LKA V F+   P +S      V   R +I      ++   +  +  R G+L    +  L ++++ + + + F K++G+A ID L+ E +L +   G
Sbjct:   60 TYNGDSKAETDGKDNSICHICSDVATGRHYGAIACNGCKGFFRRTVRRNYEYHCRFESKCEIDKHNRAVCRYCRFMKCISSGMRDDQVQSERDVIGKREKKDNMKTYCQDPTPRTSPELTMSPVEDEYDQLLESLLKSEMTIQSLRDTVITQTGNVEYTTKSKNRLSHTDRTATLNDVLKSMHSQLLLVIEWAKTLPEFKQLSGADQAVLLKNFAGQHVTLCVAYRS--VGANDALKLLNDLYIPRASKTTPHLKEYVDGFYLRDCEKVMDQLVEPMRFLKLDNKEFVALKACVLFNPVAPGLSNHAVNLVLNARRKIFAAFEKYVRVNKPLETTRVGDLTFFILTPLSVLSKSISEDIMFTKVSGVARIDVLMEELILAETDYG 442          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-49 (Nuclear hormone receptor family member nhr-49 [Source:UniProtKB/Swiss-Prot;Acc:O45666])

HSP 1 Score: 189.889 bits (481), Expect = 2.600e-51
Identity = 132/396 (33.33%), Postives = 188/396 (47.47%), Query Frame = -1
Query:  943 CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRIS--TRRSSFDDIP------------------------------PNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-------------------------------------ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAE-----IASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR---VSESGKEFVRRCRYQIQMDLMNHMNDKQY-HKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGD 1893
            C +C DK+TG HYG  SC+GCKGFFRR+V +   +TC++N+ C +DK+ R  CRYCR +KC+ VGMKR A+Q ERD +   T  +S +  P                              P     I  LM+ E RV        QE  NRY                                         D+ E  +  L L+V WAK++  F  L++ D+I LLK +A + LIL    RS   D   V L  N  +   N++D   FA      I   +LD++  P+R+LQ+ + EF CLKA+ F  P    +S S +  +R  R ++   L   + D+     P R+G +LL  P L+ +TQL+++ +   K  GLAE+DSLLSE +L D
Sbjct:   11 CAVCGDKSTGTHYGVISCNGCKGFFRRTVLRDQKFTCRFNKRCVIDKNFRCACRYCRFQKCVQVGMKREAIQFERDPVGSPTSGASLNGTPFKKDRSPGYENGNSNGVGSNGMGQENMRTVPQSSSVIDALMEMEARVN-------QEMCNRYRRSQIFANGSGGSNGNDTDIQQGSDSGASAFAPPNRPCTTEDLNEISRTTLLLMVEWAKTINPFMDLSMEDKIILLKNYAPQHLILMPAFRS--PDTTRVCLFNNTYMTRDNNTDLNGFAAFKTSNITPRVLDEIVWPMRQLQMREQEFVCLKALAFLHPEAKGLSNSSQIMIRDARNRVLKALYAFILDQMPDDAPTRYGNILLLAPALKALTQLLIENMTLTKFFGLAEVDSLLSEFILDD 397          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (Hepatocyte nuclear factor 4 [Source:FlyBase gene name;Acc:FBgn0004914])

HSP 1 Score: 340.502 bits (872), Expect = 1.087e-102
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  103 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 438          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (Hepatocyte nuclear factor 4 [Source:FlyBase gene name;Acc:FBgn0004914])

HSP 1 Score: 340.502 bits (872), Expect = 2.553e-102
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  141 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 476          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (Hepatocyte nuclear factor 4 [Source:FlyBase gene name;Acc:FBgn0004914])

HSP 1 Score: 340.502 bits (872), Expect = 2.553e-102
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  141 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 476          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (Hepatocyte nuclear factor 4 [Source:FlyBase gene name;Acc:FBgn0004914])

HSP 1 Score: 340.502 bits (872), Expect = 2.755e-102
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  145 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 480          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (Hepatocyte nuclear factor 4 [Source:FlyBase gene name;Acc:FBgn0004914])

HSP 1 Score: 340.887 bits (873), Expect = 3.698e-102
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  169 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 504          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-1077])

HSP 1 Score: 352.058 bits (902), Expect = 1.843e-109
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +   + +A  ILD+L +P ++LQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPQESANMNAANHLGA--GTLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKVAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMY--KDILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-1077])

HSP 1 Score: 352.058 bits (902), Expect = 1.843e-109
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +   + +A  ILD+L +P ++LQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPQESANMNAANHLGA--GTLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKVAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMY--KDILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 340.887 bits (873), Expect = 1.847e-105
Identity = 170/332 (51.20%), Postives = 236/332 (71.08%), Query Frame = -1
Query:  946 ASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1929
            + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RR+  D  D+PP   L+ ++ + ++Q++    P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +     +++ +LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   38 SQGENGVSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEAL-SQQQITAASPMGPADVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MSYKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 364          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 340.117 bits (871), Expect = 1.919e-105
Identity = 170/332 (51.20%), Postives = 234/332 (70.48%), Query Frame = -1
Query:  946 ASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1929
            + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RR+  D  D+PP   L+ ++ +   Q++    P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +     +++ +LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   19 SQGENGVSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEAL--SQQITAASPMGPADVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MSYKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 344          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 339.347 bits (869), Expect = 8.449e-105
Identity = 170/332 (51.20%), Postives = 234/332 (70.48%), Query Frame = -1
Query:  946 ASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1929
            + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RR+  D  D+PP   L+ ++ +   Q++    P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +     +++ +LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   52 SQGENGVSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEAL--SQQITAASPMGPADVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MSYKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 377          
BLAST of HNF4 vs. Ensembl Xenopus
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:Xenbase;Acc:XB-GENE-487527])

HSP 1 Score: 355.525 bits (911), Expect = 6.040e-111
Identity = 180/346 (52.02%), Postives = 241/346 (69.65%), Query Frame = -1
Query:  946 VYASNASGPEGMEN--------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE----QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1944
            +Y  + S PEG  N        N +C IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTR+S+F+    ++I SI+ L QAE    Q  A     N +    + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LGV +RS      D+L LGNN +I RN S+   + +AS +LD+L +P +E+Q+DD E+ACLKAIVFFDP     S    ++  RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++V+F+K+ G+ +ID+LL E LLG
Sbjct:   34 LYNDSDSSPEGSANMNSLDNGINSMCAICGDRATGKHYGASSCDGCKGFFRRSIRKCHVYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRKSAFEG---SIIPSINTLSQAEVLSRQITASSPDANTEINTKKIASISDVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGVTKRSMVF--KDILFLGNNYVIHRNCSEMEISRVASRVLDELVLPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPIKIKTMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQVQFVKLFGMVKIDNLLQEMLLG 374          
BLAST of HNF4 vs. Ensembl Xenopus
Match: hnf4b (hepatocyte nuclear factor 4, beta [Source:Xenbase;Acc:XB-GENE-485826])

HSP 1 Score: 353.214 bits (905), Expect = 5.569e-110
Identity = 183/362 (50.55%), Postives = 244/362 (67.40%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQL---CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQE----YMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            S  + ++  I  +  +++ H       + P G+ NN +   C IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RRSS++D   N  LSIS L QAE  V    P +P       M + A + DVCESMK QL LLV WAK +P F +L L DQ++LL+AHAG  L+LGV +RS  L   D LLLGN+ I+  +  +   A +A  ILD+L  PLRE+Q+DD E+ACLKAI+FFDP     S +  V+  R+Q+Q++L +++ND+QY   GRF ++LL +P L+ +T  M+++V+F K+ G+A IDSLL E LLG
Sbjct:   22 SYTMLEFDSIRVLPSNTEAHSEEGIETASP-GLLNNGISAFCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYACRFSRQCIVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISMRRSSYED---NGSLSISVLTQAEAMVLQYSPLSPAHSSDISMKKVASISDVCESMKQQLLLLVEWAKYIPAFCELPLDDQVALLRAHAGAHLLLGVAKRS--LPYKDFLLLGNDFIMPMHCPELEVARVACRILDELVKPLREIQIDDNEYACLKAIIFFDPDCKGLSDQTKVKNMRFQVQVNLEDYINDRQYDSRGRFSDILLLLPPLQSITWQMIEQVQFAKLFGVARIDSLLQEMLLG 377          
BLAST of HNF4 vs. Ensembl Xenopus
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:Xenbase;Acc:XB-GENE-482419])

HSP 1 Score: 275.018 bits (702), Expect = 1.867e-82
Identity = 145/288 (50.35%), Postives = 202/288 (70.14%), Query Frame = -1
Query:  946 CQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQ-ISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1785
            C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +    +N      + A + DVC+SMK QL +LV WAK +P F +L L DQ ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAI+FFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:    1 CRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINVLIQAE--VLSQQITSSVGVLNTDIRGKKIASITDVCDSMKQQLLVLVEWAKYIPAFCELPLDDQVVALLRAHAGEHLLLGATKRSMMY--KDILLLGNDRVIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 281          
BLAST of HNF4 vs. Ensembl Xenopus
Match: rxra (retinoid X receptor, alpha [Source:Xenbase;Acc:XB-GENE-478718])

HSP 1 Score: 229.95 bits (585), Expect = 1.154e-65
Identity = 127/341 (37.24%), Postives = 193/341 (56.60%), Query Frame = -1
Query:  952 SNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDR--------ISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYAD-VPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS---HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1935
            ++ SGP       +C IC D+++GKHYG +SC+GCKGFF+R+VRK   YTC+ +++C +DK +RN+C+YCR +KC+ +GMKR AVQ ER R        + +  S+ +D+P   IL     ++ +    I+   N     N  +D V ++C++   QLF LV WAK +P FS+L L DQ+ LL+A   E+LI     RS  +   D +LL   L + RNS+  H A + +    +L +L   +R++Q+D  E  CL+AIV F+P     S    V   R ++   L  +   K   +PGRF +LLL +P LR +    ++ + F K+ G   ID+ L E L
Sbjct:  119 AHPSGPMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDSKDCMIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKERNENEVESSSSANEDMPVEKILDAEHAVEPKTETYIEA--NMGLAPNSPSDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV--KDGILLATGLHVHRNSA--HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPSEVEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEML 453          
BLAST of HNF4 vs. Ensembl Xenopus
Match: rxrb (retinoid X receptor, beta [Source:Xenbase;Acc:XB-GENE-480167])

HSP 1 Score: 220.32 bits (560), Expect = 2.286e-62
Identity = 126/336 (37.50%), Postives = 192/336 (57.14%), Query Frame = -1
Query:  952 SNASGPEG--MENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD-DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYAD-VPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS---HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1935
            S +S P G  +   +LC IC D+++GKHYG +SC+GCKGFF+R++RK   YTC+ N++C +DK +RN+C+YCR +KC+  GMKR AVQ ER R   R    +     N  + + ++++AE  V  QK     E     +D V ++C++   QLF LV WAK +P FS+L L DQ+ LL+A   E+LI     RS  +   D +LL   L + RNS+  H A + +    +L +L   +R++++D  E  CL+AI+ F+P     S    V   R ++   L ++   K   + GRF +LLL +P LR +    ++ + F K+ G   ID+ L E L
Sbjct:  112 SMSSHPNGGAVSGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYTCRDNKDCIVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKERDGEAEFSGAINEEMPVEKILEAELAVE-QKSDQSLEGGGSPSDPVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSISV--KDGILLATGLHVHRNSA--HSAGVGAIFDRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPGDVEVLREKVYASLESYCKQKYPDQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEML 442          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4g (hepatocyte nuclear factor 4, gamma [Source:MGI Symbol;Acc:MGI:1353604])

HSP 1 Score: 344.739 bits (883), Expect = 3.456e-107
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   19 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 337          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4g (hepatocyte nuclear factor 4, gamma [Source:MGI Symbol;Acc:MGI:1353604])

HSP 1 Score: 345.125 bits (884), Expect = 9.485e-107
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   63 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 381          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4a (hepatic nuclear factor 4, alpha [Source:MGI Symbol;Acc:MGI:109128])

HSP 1 Score: 344.739 bits (883), Expect = 1.128e-106
Identity = 176/327 (53.82%), Postives = 240/327 (73.39%), Query Frame = -1
Query:  946 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1896
            LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +P   +N      + A++ DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+ACLKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   50 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLG 367          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4a (hepatic nuclear factor 4, alpha [Source:MGI Symbol;Acc:MGI:109128])

HSP 1 Score: 344.739 bits (883), Expect = 1.674e-106
Identity = 176/327 (53.82%), Postives = 240/327 (73.39%), Query Frame = -1
Query:  946 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1896
            LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +P   +N      + A++ DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+ACLKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   59 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLG 376          
BLAST of HNF4 vs. Ensembl Mouse
Match: Rxra (retinoid X receptor alpha [Source:MGI Symbol;Acc:MGI:98214])

HSP 1 Score: 226.098 bits (575), Expect = 4.062e-64
Identity = 123/335 (36.72%), Postives = 188/335 (56.12%), Query Frame = -1
Query:  952 NNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDR--------ISTRRSSFDDIPPNVILSISQLMQAEQRVAIQK-----PPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS---HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1905
               +C IC D+++GKHYG +SC+GCKGFF+R+VRK   YTC+ N++C +DK +RN+C+YCR +KC+ +GMKR AVQ ER R        + +  S+ +D+P   IL     ++ +    ++      P +P +       V ++C++   QLF LV WAK +P FS+L L DQ+ LL+A   E+LI     RS  +   D +LL   L + RNS+  H A + +    +L +L   +R++Q+D  E  CL+AIV F+P     S    V   R ++   L  +   K   +PGRF +LLL +P LR +    ++ + F K+ G   ID+ L E L
Sbjct:  108 TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPND------PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV--KDGILLATGLHVHRNSA--HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEML 432          
BLAST of HNF4 vs. UniProt
Match: sp|Q91766|HNF4A_XENLA (Hepatocyte nuclear factor 4-alpha OS=Xenopus laevis GN=hnf4a PE=2 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 3.367e-108
Identity = 180/357 (50.42%), Postives = 250/357 (70.03%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            ++  Q++ +   +   +V + +AS   G+  N LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +    +N      + A + DVC+SMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAI+FFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   28 FENMQVLSIGTDTSTSDVTSLSASNSIGI--NSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINVLIQAE--VLSQQITSSVGVLNTDIRGKKIACIIDVCDSMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMF--KDILLLGNDRLIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. UniProt
Match: sp|Q14541|HNF4G_HUMAN (Hepatocyte nuclear factor 4-gamma OS=Homo sapiens GN=HNF4G PE=1 SV=3)

HSP 1 Score: 347.051 bits (889), Expect = 2.548e-107
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. UniProt
Match: sp|P79926|HNF4B_XENLA (Hepatocyte nuclear factor 4-beta OS=Xenopus laevis GN=hnf4b PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 1.168e-106
Identity = 178/357 (49.86%), Postives = 236/357 (66.11%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMEN--NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQE----YMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            Y   +   + V     E+     + P  + N  N  C IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RRSS++D   N  LSI+ L QAE  V    P +P       M + A + DVCESMK QL LLV WAK +P F +L L DQ++LL+AHAG  L+LGV +RS  L   D LLLGN+ I+  +  +   A +   ILD+L  PLRE+Q+DD E+ CLKAI+FFDP     S +  V+  R+Q+Q++L +++ND+Q+   GRF ++LL +P L+ +T  M+++V+F K+ G+A IDSLL E LLG
Sbjct:   14 YTMLEFDSIRVLPSNTEIITVETASPGLLNNGINSFCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYACRFSRQCIVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISMRRSSYED---NGSLSINVLTQAEAMVHQYSPVSPVHSSDISMKKVASISDVCESMKQQLLLLVEWAKYIPAFCELPLDDQVALLRAHAGAHLLLGVAKRS--LPYKDFLLLGNDFIMPMHCPELEIARVPCRILDELVKPLREIQIDDNEYVCLKAIIFFDPDCKGLSDQTKVKNMRFQVQVNLEDYINDRQFDSRGRFSDILLLLPPLQSITWQMIEQVQFAKLFGVARIDSLLQELLLG 365          
BLAST of HNF4 vs. UniProt
Match: sp|Q9WUU6|HNF4G_MOUSE (Hepatocyte nuclear factor 4-gamma OS=Mus musculus GN=Hnf4g PE=2 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 4.111e-106
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. UniProt
Match: sp|P41235|HNF4A_HUMAN (Hepatocyte nuclear factor 4-alpha OS=Homo sapiens GN=HNF4A PE=1 SV=3)

HSP 1 Score: 345.51 bits (885), Expect = 6.518e-106
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   45 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 379          
BLAST of HNF4 vs. TrEMBL
Match: tr|H8YS99|H8YS99_SCHMD (HNF4 OS=Schmidtea mediterranea GN=hnf4 PE=2 SV=1)

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 612/614 (99.67%), Postives = 613/614 (99.84%), Query Frame = -1
Query:  124 VSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGXXXXXXNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYXXXXXXXXXXXXXXXDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 1965
            +SSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYN DANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY
Sbjct:   42 MSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNGDANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 655          

HSP 2 Score: 55.0694 bits (131), Expect = 3.423e-4
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = -2
Query: 2346 MTSTQHPNLNPAFSYQLLTXXXXXXXXXXXXXSMQYPLESE 2468
            MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESE
Sbjct:    1 MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESE 41          
BLAST of HNF4 vs. TrEMBL
Match: tr|K1QT78|K1QT78_CRAGI (Hepatocyte nuclear factor 4-alpha OS=Crassostrea gigas GN=CGI_10027058 PE=3 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 1.598e-112
Identity = 180/338 (53.25%), Postives = 241/338 (71.30%), Query Frame = -1
Query:  934 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNR--YADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPP 1938
            A + S  +GM  +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NRNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S++D+     LS+S L+ AE        P     ++    A   DVCESMK QL +LV WAK +PCF +L + DQ++LL+AHAGE LI+GV RRS  L   DVLLLGN+ II RN+ +     +AS ILD+L  P++++Q+D++EFACLKAIVFFDP     +  + ++  RYQ+Q++L +++ND+QY   GRFGE+LL +P L+ +T  M+++V+F K+ G+A ID+LL E LLG   P
Sbjct:   42 AGSTSPTQGM--SQFCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYSCRFNRNCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISVRRTSYEDVNQTNSLSVSTLLNAEILSRQMTSPAVGTDLSHKLVATANDVCESMKQQLLILVEWAKYIPCFCELTIDDQVALLRAHAGEHLIMGVARRS--LGVKDVLLLGNDAIIPRNTPEVEIGRVASRILDELVQPMKDVQMDESEFACLKAIVFFDPDAKGLTDPQKIKSFRYQVQVNLEDYINDRQYDTRGRFGEILLMLPPLQSITWQMIEQVQFAKLFGMARIDNLLQEMLLGGAAP 375          
BLAST of HNF4 vs. TrEMBL
Match: tr|V5I8N9|V5I8N9_ANOGL (Transcription factor HNF-4 protein (Fragment) OS=Anoplophora glabripennis GN=HNF4 PE=3 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 1.761e-111
Identity = 192/375 (51.20%), Postives = 258/375 (68.80%), Query Frame = -1
Query:  838 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQ-----RVAIQK----PPNPQEYMNR-YADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR---VSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSID-------PETDGXXXXXXNDSMDIINSHRISSP 1902
            +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCR+CRLKKC   GMK+ AVQNERDRIS RR S+++   N  LS+  L+ AE        A+++    P N  +  NR  A + DVC+SMK QL +LV WAK +P F+ L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLLGNN II++   D   A + S I+D+L  P+ E+Q+DD EFACLKAIVFFDP    +SE  +  ++  RYQIQ++L ++++D+QY   GRFGELLLT+P L+ +T  M+++++F K+ G+A IDSLL E LLGD+  G  S+D       P  + N+  + +DS D   +  I++P
Sbjct:   58 SQQCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHLYTCRFSRNCVVDKDKRNQCRFCRLKKCFKAGMKKEAVQNERDRISCRRPSYEENNQNNGLSVGSLLNAEMLSRQVGAALEQIGSTPVNDYDLSNRQLASINDVCDSMKQQLLILVEWAKYIPAFTDLQLDDQVALLRAHAGEHLLLGLARRSMHL--KDVLLLGNNCIITKQCPDLSIARVGSRIMDELVKPMTEVQIDDTEFACLKAIVFFDPNAKGLSEPAR--IKALRYQIQINLEDYISDRQYDSRGRFGELLLTLPALQSITWQMIEQIQFAKLFGVAHIDSLLQEMLLGDSILGA-SVDSTPTLVVPNNNANSYQSTSDSADSPITSPITTP 427          
BLAST of HNF4 vs. TrEMBL
Match: tr|D2CPV5|D2CPV5_CALMS (Putative hepatocyte nuclear factor 4 nuclear hormone receptor OS=Callosobruchus maculatus GN=HNF-4 PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 5.317e-110
Identity = 186/363 (51.24%), Postives = 248/363 (68.32%), Query Frame = -1
Query:  904 VYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQ-----RVAIQK----PPNPQEYMNR-YADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR---VSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDN---PPGVFSIDPETD 1944
            V A  A+   G   +Q C IC D+ATGKHYGA SCDGCKGFFRRS RK + YTC++NRNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR S+++   N  LS+  L+ AE        A+++    P N  +  NR  A + DVC+SMK QL +LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLLGNN II++   D   A + + I+D+L  P+ E+Q+DD EFACLKAIVFFDP    +SE  +  ++  RYQIQ++L ++++D+QY   G FGELLLT+P L+ +T  M+++++F K+ G+A IDSLL E LLG     P    ++ P T+
Sbjct:   66 VSAPGATLLNGTGLSQQCAICGDRATGKHYGAASCDGCKGFFRRSARKNHLYTCRFNRNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRPSYEESNQNNGLSVGSLLNAEMLSRQVGAALEQMGSTPVNDYDLSNRQLASINDVCDSMKQQLLILVEWAKYIPAFTELQLDDQVALLRAHAGEHLLLGLARRSMHL--KDVLLLGNNCIITKQCPDLSIARVGARIMDELVKPMTEVQIDDTEFACLKAIVFFDPNARGLSEPSR--IKALRYQIQINLEDYISDRQYDSRGGFGELLLTLPPLQSITWQMIEQIQFAKLFGMAHIDSLLQEMLLGGTSVEPASTIAVVPTTN 424          
BLAST of HNF4 vs. TrEMBL
Match: tr|A0A139WFB8|A0A139WFB8_TRICA (Hepatocyte nuclear factor 4 OS=Tribolium castaneum GN=TcasGA2_TC008726 PE=3 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 8.541e-110
Identity = 188/380 (49.47%), Postives = 258/380 (67.89%), Query Frame = -1
Query:  916 LYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQ-----RVAIQK----PPNPQEYMNR-YADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKH------FAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR---VSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSID 1998
            LY+    + ++ S+       S+ S     + +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR S+++   N  LS+  L+ AE        A+++    P N  +  N+  A + DVC+SMK QL +LV WAK +P F+ L L DQ++LL+AHAGE L+LG+ RRS  L   D+LLLGNN II+++S D         + + S I+D+L  P+ E+Q+DD EFACLKAIVFFDP    +SE  +  ++  RYQIQ++L ++++D+QY   GRFGELLLT+P L+ +T  M+++++F K+ G+A IDSLL E LLG++  G  SID
Sbjct:    3 LYEADTEMTMAASNNSLTATLSSGSAAGVAQMSQHCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHLYTCRFSRNCIVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRPSYEENNQNNGLSVGSLLNAEMLSRQVGAALEQMGPTPVNDYDLSNKQLASINDVCDSMKQQLLILVEWAKYIPAFTDLQLDDQVALLRAHAGEHLLLGLARRSMHL--KDILLLGNNCIITKHSPDSRVSPDLDISRVGSRIMDELVKPMTEVQVDDTEFACLKAIVFFDPNAKGLSEPAR--IKALRYQIQINLEDYISDRQYDSRGRFGELLLTLPALQSITWQMIEQIQFAKLFGVAHIDSLLQEMLLGESILGA-SID 377          
The following BLAST results are available for this feature:
BLAST of HNF4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
HNF4G5.267e-10951.74hepatocyte nuclear factor 4 gamma [Source:HGNC Sym... [more]
HNF4G4.960e-10853.07hepatocyte nuclear factor 4 gamma [Source:HGNC Sym... [more]
HNF4A3.378e-10751.45hepatocyte nuclear factor 4 alpha [Source:HGNC Sym... [more]
HNF4A5.303e-10751.45hepatocyte nuclear factor 4 alpha [Source:HGNC Sym... [more]
HNF4A6.467e-10751.45hepatocyte nuclear factor 4 alpha [Source:HGNC Sym... [more]
back to top
BLAST of HNF4 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-693.116e-6537.50Nuclear hormone receptor family member nhr-69 [So... [more]
nhr-647.995e-5436.67Nuclear hormone receptor family member nhr-64 [So... [more]
nhr-352.243e-5332.73Nuclear hormone receptor family member nhr-35 [So... [more]
nhr-356.205e-5332.73Nuclear hormone receptor family member nhr-35 [So... [more]
nhr-492.600e-5133.33Nuclear hormone receptor family member nhr-49 [So... [more]
back to top
BLAST of HNF4 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
Hnf41.087e-10250.59Hepatocyte nuclear factor 4 [Source:FlyBase gene n... [more]
Hnf42.553e-10250.59Hepatocyte nuclear factor 4 [Source:FlyBase gene n... [more]
Hnf42.553e-10250.59Hepatocyte nuclear factor 4 [Source:FlyBase gene n... [more]
Hnf42.755e-10250.59Hepatocyte nuclear factor 4 [Source:FlyBase gene n... [more]
Hnf43.698e-10250.59Hepatocyte nuclear factor 4 [Source:FlyBase gene n... [more]
back to top
BLAST of HNF4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4a1.843e-10950.69hepatocyte nuclear factor 4, alpha [Source:ZFIN;Ac... [more]
hnf4a1.843e-10950.69hepatocyte nuclear factor 4, alpha [Source:ZFIN;Ac... [more]
hnf4g1.847e-10551.20hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
hnf4g1.919e-10551.20hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
hnf4g8.449e-10551.20hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
back to top
BLAST of HNF4 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4g6.040e-11152.02hepatocyte nuclear factor 4, gamma [Source:Xenbase... [more]
hnf4b5.569e-11050.55hepatocyte nuclear factor 4, beta [Source:Xenbase;... [more]
hnf4a1.867e-8250.35hepatocyte nuclear factor 4, alpha [Source:Xenbase... [more]
rxra1.154e-6537.24retinoid X receptor, alpha [Source:Xenbase;Acc:XB-... [more]
rxrb2.286e-6237.50retinoid X receptor, beta [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of HNF4 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Hnf4g3.456e-10752.45hepatocyte nuclear factor 4, gamma [Source:MGI Sym... [more]
Hnf4g9.485e-10752.45hepatocyte nuclear factor 4, gamma [Source:MGI Sym... [more]
Hnf4a1.128e-10653.82hepatic nuclear factor 4, alpha [Source:MGI Symbol... [more]
Hnf4a1.674e-10653.82hepatic nuclear factor 4, alpha [Source:MGI Symbol... [more]
Rxra4.062e-6436.72retinoid X receptor alpha [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HNF4 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91766|HNF4A_XENLA3.367e-10850.42Hepatocyte nuclear factor 4-alpha OS=Xenopus laevi... [more]
sp|Q14541|HNF4G_HUMAN2.548e-10753.07Hepatocyte nuclear factor 4-gamma OS=Homo sapiens ... [more]
sp|P79926|HNF4B_XENLA1.168e-10649.86Hepatocyte nuclear factor 4-beta OS=Xenopus laevis... [more]
sp|Q9WUU6|HNF4G_MOUSE4.111e-10652.45Hepatocyte nuclear factor 4-gamma OS=Mus musculus ... [more]
sp|P41235|HNF4A_HUMAN6.518e-10651.45Hepatocyte nuclear factor 4-alpha OS=Homo sapiens ... [more]
back to top
BLAST of HNF4 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|H8YS99|H8YS99_SCHMD3.423e-499.67HNF4 OS=Schmidtea mediterranea GN=hnf4 PE=2 SV=1[more]
tr|K1QT78|K1QT78_CRAGI1.598e-11253.25Hepatocyte nuclear factor 4-alpha OS=Crassostrea g... [more]
tr|V5I8N9|V5I8N9_ANOGL1.761e-11151.20Transcription factor HNF-4 protein (Fragment) OS=A... [more]
tr|D2CPV5|D2CPV5_CALMS5.317e-11051.24Putative hepatocyte nuclear factor 4 nuclear hormo... [more]
tr|A0A139WFB8|A0A139WFB8_TRICA8.541e-11049.47Hepatocyte nuclear factor 4 OS=Tribolium castaneum... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 28..45
NoneNo IPR availableCOILSCoilCoilcoord: 634..637
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 45..128
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 7..21
NoneNo IPR availableTMHMMTMhelixcoord: 64..81
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
IPR001723Nuclear hormone receptorPRINTSPR00398STRDHORMONERcoord: 267..282
score: 47.14
coord: 109..119
score: 45.49
coord: 198..214
score: 46.72
coord: 177..198
score: 34.99
coord: 323..340
score: 29.8
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 48..64
score: 51.77
coord: 97..105
score: 62.02
coord: 64..79
score: 60.34
coord: 105..113
score: 60.32
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 45..116
e-value: 5.3E-38
score: 142.3
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 46..115
e-value: 8.7E-30
score: 102.9
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS00031NUCLEAR_REC_DBD_1coord: 48..74
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 45..120
score: 21.136
IPR000536Nuclear hormone receptor, ligand-binding domainSMARTSM00430holicoord: 176..335
e-value: 3.6E-40
score: 149.5
IPR000536Nuclear hormone receptor, ligand-binding domainGENE3DG3DSA:1.10.565.10coord: 111..362
e-value: 3.3E-59
score: 200.0
IPR000536Nuclear hormone receptor, ligand-binding domainPFAMPF00104Hormone_recepcoord: 160..347
e-value: 9.9E-37
score: 126.0
IPR000536Nuclear hormone receptor, ligand-binding domainSUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 114..361
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 45..110
e-value: 1.7E-31
score: 107.8

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001723Nuclear_hrmn_rcpt
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR013088Znf_NHR/GATA
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003707steroid hormone receptor activity
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000049digestive system
PLANA:0000026definitive gut
PLANA:0000058embryonic digestive system
PLANA:0000023temporary embryonic pharynx
PLANA:0000039gamma neoblast
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000005Stage 5
PLANA:0000007Stage 7
PLANA:0000002Stage 2
PLANA:0000008Stage 8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005748 ID=SMED30005748|Name=HNF4|organism=Schmidtea mediterranea sexual|type=transcript|length=3066bp
GAAGAATAACAAAGAAATTTATTGCCAAACTAAAATACCCGGCCTATTTC
ATCAAAAAAAAAACAATCAAAAACACAAATCGCTACGAAAACTTGTATAA
AAGATTCACATTAAAAGTCATCAATATTCCTCTTTTTTAAAGACTGATGA
TTCAGATTCTTGGATCCGAATGGGGTGATCTGTTAGGAAGTGAGCTGTTG
ACGAGATAGCTGAATAGTTTGATCTGGAATTGTGCTGTTGGTTCGCTTCC
GATGATCTGTTGGCGATTGATTGAATTTGGCAGTTTTCTATCGGCGAGTT
TGGAAGCGACTTGGTATAGGCCACAAGAAGCGACGGATCAACGACATTTT
GAGTGGAATTCACAGAAAGAGCTGGGTGGATTAGGTCATCTGAATTGGAA
GAATTTGAGCAGTTATGATTTGCGTCACTGTTATAGGCGTATTTTGACTG
GTTGATCATGGGGAACCCTTGATCAAGGTTGACCAAGAAATGGCTGGTAT
CCTGTGATAAATTGGAATGCTGATAAAGATTGATGGAATCATTGACGCAT
GAAAACAGAGAAGGAACGCCGACTCTTTCATTTTTCAGCATCATCCCATC
GCTGTTGATTATCATACCGAAGTTGCTATTGTCCTGGGAATTTTGCTGCA
TTATTTCAGTTCCTTGATTAACAAAAGCTCGATATATATTTCCTGAAGGC
ATCGACGTAGAACTTGGCAAATATGCACTCCATATTTTTGAGGCCGCTTC
AGGTGATATGTTTTGGTTGTTGATATTGAGTAGGACACTGTCTGGCATGA
AAGGGGGAATTCCGTAGCAGTCCTGGTAAGTATATTTCGGTGAGGAAATC
CTGTGGGAGTTAATTATATCCATGGAATCGTTTTGATTATTGTTATTGTT
CCCATCTGTTTCTGGATCTATGCTGAATACCCCTGGTGGATTGTCACCCA
ATAATGTTTCAGATAACAAGCTATCAATCTCGGCTAATCCTGTCATTTTC
ATGAACTCGACCTTCTTTACCATCAGCTGGGTGACCAATCTCAGATCAGG
AATTGTCAGCAGCAATTCCCCGAATCTACCCGGCTTGTGGTATTGCTTGT
CATTCATGTGGTTCATCAGGTCCATTTGTATTTGGTATCGGCATCGTCTC
ACGAACTCCTTGCCAGACTCGCTGACTCTCGGATCAAAAAATACGATCGC
TTTCAAACAAGCGAATTCTGCGTCATCCAATTGCAATTCTCGCAGCGGAA
TGAACAGGTCGTCAAGGATGTGACTGGCTATTTCAGCGAAATGTTTGTCA
CTGGAGTTCCTACTGATGATAAGATTGTTTCCCAATAATAGCACATCGTC
TTCGTCCAATTGAAACGACCGCCTTATTACTCCAAGAATTAGAATTTCTC
CCGCGTGTGCTTTTAAAAGGGAAATTTGATCGCTCAAGTTTAACTGTGAA
AAACAAGGCAAAGACTTTGCCCAATTCACTAGAAGAAATAACTGATTTTT
CATGGACTCGCAAACATCAGGCACATCGGCATATCTGTTCATGTATTCCT
GAGGATTCGGGGGCTTTTGTATTGCAACCCTTTGCTCGGCCTGCATCAAC
TGAGAAATGGAGAGAATGACATTCGGAGGAATATCATCAAACGACGATCT
TCGAGTACTGATCCTATCTCGTTCATTTTGAACCGCTGCTCGCTTCATTC
CTACAAGAATGCATTTCTTTAGCCGACAATAACGGCATTGGTTTCGTTTA
TCCTTGTCCATTTTACAATTCCGATTGTACTGGCAAGTGTAGTTATTCTT
CTTCCTCACTGACCTCCGAAAAAATCCTTTACAACCGTCACACGAGAAAG
CCCCATAATGTTTTCCTGTAGCTTTGTCACTGCAAATGAGACAGAGTTGA
TTGTTTTCCATTCCTTCTGGTCCCGACGCGTTAGACGCATAGACTTCATG
TTGTTGCGAGGACACTGAAACGAAAACTATTTGATAATATTTGTACAAAA
CAACTGACAGATGGTTTCGGAAAAGGTTCAATGTTCAGCCATAGTTCAGC
GAAAGGTCAAATTCCTGAACTACTATTTCAAGGTATAAATTTGAATATAT
TGGTTTTGCCTCGTGCTAACAAAGTCCAGAAATATAATAAGCAAAGTCTG
AATCGTGTACTTTGGATTTCTAGCCAGGGGCACACAATAACCTATATTTA
ATAGCAGTTCATTGCGTTCACTCGTTATTTCTCCGACTGAACTGCATTGC
AGGAGGATCCGCAACCATGGAGATTTCATAATTATTATCAAAATGATAAT
AATAATAATTATTATGAGGTATTGTAAAAGAAAACGTAACTCACTTTCAC
TTTCCAATGGATATTGCATCGAGGAAGCGTTGCTGGAAATGGAAATCGGA
GCTGAATTGCTAGTCAATAGTTGATAGGAGAATGCTGGATTGAGGTTCGG
ATGCTGGGTAGACGTCATATAGAATTGGCTCGACGGATTCGGTAAAATTA
TGGTGAAGTTTACAATCGAAGCTCAGATATAACGTATTATAATGAAGTAT
TATTAATAAACTGCAAGTAACGTGCGCGCATTCTGAAGTGGTTGATTGAG
AATAATCAGTTCTTATTCGACAAATTCAGATAAAAAAGGCACCACTCGAA
TTGTTCAGCTGCGTCATGTGAATGCCGGAACGTTGTGCGTTGGCTGTTGG
CAGATCAGCGCTCCGTGTTCACTGCAATCCGGATACACCAGACCACTTGA
AATCGTTGCGAATTCAGCGTGTCGAGTGCATTGTGCGAGATCAGTATCGG
TGTGTATGTGTGTCTGCCTGTGTGCGTGTGGATGTGTGTGCTTGTCGAGT
CGGTTGTGTGTTTATGAGTGTAACTGTGTCGATTTGGTCGAATGCAGTAG
CAGATAGCTGAAATGCGATTGTTCCTATTTTTCATTTAATATTGTTTTAT
GTTTTGTTTCTATTTTTATAATTTAATTTATCAGTTTTTGTTTAGATTAT
GCAATCATTGTTTAATTTATTTTTGTCAATTTAAAATTTATTATTAATTA
AATTATTATAATTATT
back to top

protein sequence of SMED30005748-orf-1

>SMED30005748-orf-1 ID=SMED30005748-orf-1|Name=SMED30005748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=597bp
MENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCK
MDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVIL
SISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKS
LPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIIS
RNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESG
KEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKK
VEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDII
NSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPS
STSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVP
SLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNSDANHN
CSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIA
NRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY*
back to top

protein sequence of SMED30005748-orf-2

>SMED30005748-orf-2 ID=SMED30005748-orf-2|Name=SMED30005748-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESESELRFLLQY
LIIIIIIIILIIIMKSPWLRILLQCSSVGEITSERNELLLNIGYCVPLAR
NPKYTIQTLLIIFLDFVSTRQNQYIQIYTLK*
back to top
Aliases
The feature 'HNF4' has the following synonyms
Synonym
hnf-4
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005748
GenBankAFF18489.1