HNF4

Overview
NameHNF4 (AFF18489.1)
Smed IDSMED30005748
Uniprot Best hitHepatocyte nuclear factor 4-alpha OS=Xenopus laevis OX=8355 GN=hnf4a PE=2 SV=2 (E=1.54458e-109)
Length (bp)3066
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of HNF4 (SMED30005748) t-SNE clustered cells

Violin plots show distribution of expression levels for HNF4 (SMED30005748) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of HNF4 (SMED30005748) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for HNF4 (SMED30005748) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Don't be a BOT, type this for download: fQBp7gCo

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30005748

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005748SMESG000014588.1 dd_Smed_v4_1694_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
gutSMED30005748SMESG000014588.1 dd_Smed_v4_1694_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30005748SMESG000014588.1 dd_Smed_v4_1694_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
gastrodermal cellSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gamma neoblastSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:25017721FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
embryonic pharynxSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
embryonic pharynxSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
gamma neoblastSMED30005748SMESG000014588.1 SMED30005748smed_20140614PMID:29906446FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
gastrodermal cellSMED30005748SMESG000014588.1 JF802199smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30005748SMESG000014588.1 JF802199smed_ncbi_20200123PMID:21566185whole organismasexual adultfluorescence in situ hybridization evidence
gutSMED30005748SMESG000014588.1 hnf4smed_ncbi_20200123PMID:25254346whole organismasexual adultcolorimetric in situ hybridization evidence
pigment cellSMED30005748SMESG000014588.1 dd_Smed_v6_1694_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
parenchymal cellSMED30005748SMESG000014588.1 dd_Smed_v6_1694_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
progenitor cellSMED30005748SMESG000014588.1 dd_Smed_v6_1694_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
gutSMED30005748SMESG000014588.1 AFF18489.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 AFF18489.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 AFF18489.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
gutSMED30005748SMESG000014588.1 AFF18489.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
embryonic pharynxSMED30005748SMESG000014588.1 AFF18489.1smed_ncbi_20200123PMID:28072387whole organismStage 2colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005748SMESG000014588.1 Contig5288GPL15192PMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
Homology
BLAST of HNF4 vs. Ensembl Human
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:HGNC Symbol;Acc:HGNC:5026])

HSP 1 Score: 350.903 bits (899), Expect = 2.555e-110
Identity = 178/344 (51.74%), Postives = 244/344 (70.93%), Query Frame = -1
Query:  946 ASNASGPEGMEN------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1938
            +S++S PE   N      N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   28 SSDSSAPETSMNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 364          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:HGNC Symbol;Acc:HGNC:5026])

HSP 1 Score: 351.288 bits (900), Expect = 2.584e-110
Identity = 178/344 (51.74%), Postives = 244/344 (70.93%), Query Frame = -1
Query:  946 ASNASGPEGMEN------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1938
            +S++S PE   N      N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   38 SSDSSAPETSMNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 374          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:HGNC Symbol;Acc:HGNC:5026])

HSP 1 Score: 347.051 bits (889), Expect = 2.412e-109
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:HGNC Symbol;Acc:HGNC:5024])

HSP 1 Score: 345.895 bits (886), Expect = 1.702e-108
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   23 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 357          
BLAST of HNF4 vs. Ensembl Human
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:HGNC Symbol;Acc:HGNC:5024])

HSP 1 Score: 345.895 bits (886), Expect = 2.697e-108
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   23 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 357          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-69 (Nuclear hormone receptor family member nhr-69 [Source:UniProtKB/Swiss-Prot;Acc:P91829])

HSP 1 Score: 226.483 bits (576), Expect = 1.148e-65
Identity = 129/344 (37.50%), Postives = 194/344 (56.40%), Query Frame = -1
Query:  934 QLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVI---LSISQLMQAEQRVAIQKPPNPQEY----------MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK--HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHK------PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPP 1899
            ++C IC+DK+TGKHYGA SCDGCKGFFRRS+RK+ +Y C++ +NC + K+KRN CR CRL+KC+  GMK  A+QNERD I  R+ +      ++I   ++   L Q  +   I+   +   Y            R A + D+ +S+  QL L + WAKSLP FS L  +DQ +LLK  A  I++LGV  RS  L  ++ + L N+ ++ +  + +      +   I+D++  P+R L +D  E+  LKAI+FF+P V E + +  V   RY     L     DK            R G+LLL +P L+ + Q +V+ V+  ++ GL  +DSL+ E +L D  P
Sbjct:    4 EICHICNDKSTGKHYGAISCDGCKGFFRRSIRKRYHYQCRFEQNCDVTKNKRNACRACRLQKCVKAGMKSNAIQNERDAIGKRKKTTGAEKEDLIDQLVAAETLCQQLRSSVIKNTSSLAPYDCGKVKWNYEDARAATLDDIGKSIHQQLVLFIEWAKSLPQFSFLAQADQAALLKGGAASIIVLGVAYRSICLTVENTICLANDTLLPKEHATQVGDINCVVGRIIDEIVNPMRRLNMDLIEYVALKAILFFNPVVREINDQSPVENARYAFLRSLQRRCTDKALENMEDESMDCRSGKLLLLLPSLQAIAQQLVEDVQLARLFGLVNVDSLMEELILNDMKP 347          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-64 (Nuclear hormone receptor family member nhr-64 [Source:UniProtKB/Swiss-Prot;Acc:O44960])

HSP 1 Score: 194.512 bits (493), Expect = 2.023e-54
Identity = 121/330 (36.67%), Postives = 180/330 (54.55%), Query Frame = -1
Query:  949 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRIS-----TRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR----VSESGKEFVRRCRYQIQMDLMNHMNDKQYHK--PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLL 1902
            N  C IC D+ATGKHYGA SCDGCKGFFRR++RK+++Y C++   C++DK KRN CR CR   C+  GM+R AVQ ERDRI      +  S+   +P + +L      +A  R              + A   DV +SM  QL L+V WAK L  F +++   Q++LL+  + + L++    RS  L   D + L N   + ++S        +A  I+D +  P+R L +++ E+  LKAI FFDP      SES  + V   R +I      H+     +K  P RF  LLL +P +  +++ +V+ V+  K+ GLA ID+L+ E +L
Sbjct:   30 NVFCAICGDRATGKHYGAMSCDGCKGFFRRTIRKRHSYVCRFGEKCQVDKAKRNSCRKCRFDVCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITKTAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAFRSIHL--SDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAFFDPLAKGITSESYSD-VEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRDLVEDVQLAKLFGLASIDNLMLELML 356          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-64 (Nuclear hormone receptor family member nhr-64 [Source:UniProtKB/Swiss-Prot;Acc:O44960])

HSP 1 Score: 194.126 bits (492), Expect = 2.247e-54
Identity = 121/330 (36.67%), Postives = 180/330 (54.55%), Query Frame = -1
Query:  949 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRIS-----TRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR----VSESGKEFVRRCRYQIQMDLMNHMNDKQYHK--PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLL 1902
            N  C IC D+ATGKHYGA SCDGCKGFFRR++RK+++Y C++   C++DK KRN CR CR   C+  GM+R AVQ ERDRI      +  S+   +P + +L      +A  R              + A   DV +SM  QL L+V WAK L  F +++   Q++LL+  + + L++    RS  L   D + L N   + ++S        +A  I+D +  P+R L +++ E+  LKAI FFDP      SES  + V   R +I      H+     +K  P RF  LLL +P +  +++ +V+ V+  K+ GLA ID+L+ E +L
Sbjct:   24 NVFCAICGDRATGKHYGAMSCDGCKGFFRRTIRKRHSYVCRFGEKCQVDKAKRNSCRKCRFDVCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITKTAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAFRSIHL--SDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAFFDPLAKGITSESYSD-VEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRDLVEDVQLAKLFGLASIDNLMLELML 350          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-64 (Nuclear hormone receptor family member nhr-64 [Source:UniProtKB/Swiss-Prot;Acc:O44960])

HSP 1 Score: 194.126 bits (492), Expect = 2.247e-54
Identity = 121/330 (36.67%), Postives = 180/330 (54.55%), Query Frame = -1
Query:  949 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRIS-----TRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR----VSESGKEFVRRCRYQIQMDLMNHMNDKQYHK--PGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLL 1902
            N  C IC D+ATGKHYGA SCDGCKGFFRR++RK+++Y C++   C++DK KRN CR CR   C+  GM+R AVQ ERDRI      +  S+   +P + +L      +A  R              + A   DV +SM  QL L+V WAK L  F +++   Q++LL+  + + L++    RS  L   D + L N   + ++S        +A  I+D +  P+R L +++ E+  LKAI FFDP      SES  + V   R +I      H+     +K  P RF  LLL +P +  +++ +V+ V+  K+ GLA ID+L+ E +L
Sbjct:   24 NVFCAICGDRATGKHYGAMSCDGCKGFFRRTIRKRHSYVCRFGEKCQVDKAKRNSCRKCRFDVCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITKTAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAFRSIHL--SDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAFFDPLAKGITSESYSD-VEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRDLVEDVQLAKLFGLASIDNLMLELML 350          
BLAST of HNF4 vs. Ensembl Celegans
Match: nhr-35 (Nuclear hormone receptor family member nhr-35 [Source:UniProtKB/Swiss-Prot;Acc:Q17771])

HSP 1 Score: 196.052 bits (497), Expect = 8.280e-54
Identity = 126/385 (32.73%), Postives = 192/385 (49.87%), Query Frame = -1
Query:  931 VYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSS-------FDDIP---PNVILS---------ISQLMQAEQRVA---------------IQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSS---------DKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFD---PRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGEL-LLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPG 1944
             Y  ++      ++N +C ICSD ATG+HYGA +C+GCKGFFRR+VR+   Y C++   C++DK  R  CRYCR  KCI  GM+   VQ+ERD I  R           D  P   P + +S         +  L+++E  +                  K  N   + +R A + DV +SM +QL L++ WAK+LP F QL+ +DQ  LLK  AG+ + L V  RS  +  +D L L N+L I R S          D  +      ++D L  P+R L+LD+ EF  LKA V F+   P +S      V   R +I      ++   +  +  R G+L    +  L ++++ + + + F K++G+A ID L+ E +L +   G
Sbjct:    4 TYNGDSKAETDGKDNSICHICSDVATGRHYGAIACNGCKGFFRRTVRRNYEYHCRFESKCEIDKHNRAVCRYCRFMKCISSGMRDDQVQSERDVIGKREKKDNMKTYCQDPTPRTSPELTMSPVEDEYDQLLESLLKSEMTIQSLRDTVITQTGNVEYTTKSKNRLSHTDRTATLNDVLKSMHSQLLLVIEWAKTLPEFKQLSGADQAVLLKNFAGQHVTLCVAYRS--VGANDALKLLNDLYIPRASKTTPHLKEYVDGFYLRDCEKVMDQLVEPMRFLKLDNKEFVALKACVLFNPVAPGLSNHAVNLVLNARRKIFAAFEKYVRVNKPLETTRVGDLTFFILTPLSVLSKSISEDIMFTKVSGVARIDVLMEELILAETDYG 386          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0344784)

HSP 1 Score: 340.502 bits (872), Expect = 6.502e-104
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  103 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 438          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0079747)

HSP 1 Score: 340.502 bits (872), Expect = 1.586e-103
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  141 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 476          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0336633)

HSP 1 Score: 340.502 bits (872), Expect = 1.586e-103
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  141 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 476          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0112846)

HSP 1 Score: 340.502 bits (872), Expect = 1.718e-103
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  145 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 480          
BLAST of HNF4 vs. Ensembl Fly
Match: Hnf4 (gene:FBgn0004914 transcript:FBtr0079748)

HSP 1 Score: 340.887 bits (873), Expect = 2.359e-103
Identity = 171/338 (50.59%), Postives = 232/338 (68.64%), Query Frame = -1
Query:  937 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE-----QRVAIQKPPNPQEYMN--RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK------HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG----DNP 1896
            +C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC++ RNC +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RR+S DD  P   LS+  L++AE      +      PN  E ++  ++A + DVCESMK QL  LV WAK +P F++L L DQ++LL+AHAGE L+LG+ RRS  L   DVLLL NN +I+R+  D         + I + I+D+L   ++++ +DD EFAC+KA+VFFDP      +   ++  R+QI  +L ++++D+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A IDSLL E LLG    DNP
Sbjct:  169 VCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHQYTCRFARNCVVDKDKRNQCRYCRLRKCFKAGMKKEAVQNERDRISCRRTSNDDPDPGNGLSVISLVKAENESRQSKAGAAMEPNINEDLSNKQFASINDVCESMKQQLLTLVEWAKQIPAFNELQLDDQVALLRAHAGEHLLLGLSRRSMHL--KDVLLLSNNCVITRHCPDPLVSPNLDISRIGARIIDELVTVMKDVGIDDTEFACIKALVFFDPNAKGLNEPHRIKSLRHQILNNLEDYISDRQYESRGRFGEILLILPVLQSITWQMIEQIQFAKIFGVAHIDSLLQEMLLGGELADNP 504          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-1077])

HSP 1 Score: 352.058 bits (902), Expect = 9.728e-111
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +   + +A  ILD+L +P ++LQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPQESANMNAANHLGA--GTLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKVAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMY--KDILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-1077])

HSP 1 Score: 352.058 bits (902), Expect = 9.728e-111
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +   + +A  ILD+L +P ++LQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPQESANMNAANHLGA--GTLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKVAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMY--KDILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4a (hepatocyte nuclear factor 4, alpha [Source:ZFIN;Acc:ZDB-GENE-030131-1077])

HSP 1 Score: 352.058 bits (902), Expect = 9.728e-111
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +   + +A  ILD+L +P ++LQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPQESANMNAANHLGA--GTLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKVAAIMDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMMY--KDILLLGNDHIIPRNCPELEVSRVAVRILDELVLPFQDLQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 340.117 bits (871), Expect = 1.086e-106
Identity = 170/332 (51.20%), Postives = 234/332 (70.48%), Query Frame = -1
Query:  946 ASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1929
            + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RR+  D  D+PP   L+ ++ +   Q++    P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +     +++ +LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   19 SQGENGVSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEAL--SQQITAASPMGPADVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MSYKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 344          
BLAST of HNF4 vs. Ensembl Zebrafish
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 340.887 bits (873), Expect = 1.396e-106
Identity = 170/332 (51.20%), Postives = 236/332 (71.08%), Query Frame = -1
Query:  946 ASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1929
            + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RR+  D  D+PP   L+ ++ + ++Q++    P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +     +++ +LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   52 SQGENGVSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRNIQDSHDLPPITALAHAEAL-SQQQITAASPMGPADVSEKKSATISDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MSYKDLLLLGNGCVIHRNCPEPEIGRVSNRVLDELVLPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKAMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 378          
BLAST of HNF4 vs. Ensembl Xenopus
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:100486239])

HSP 1 Score: 355.91 bits (912), Expect = 4.793e-112
Identity = 180/346 (52.02%), Postives = 241/346 (69.65%), Query Frame = -1
Query:  946 VYASNASGPEGMEN--------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE----QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1944
            +Y  + S PEG  N        N +C IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTR+S+F+    ++I SI+ L QAE    Q  A     N +    + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LGV +RS      D+L LGNN +I RN S+   + +AS +LD+L +P +E+Q+DD E+ACLKAIVFFDP     S    ++  RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++V+F+K+ G+ +ID+LL E LLG
Sbjct:   36 LYNDSDSSPEGSANMNSLDNGINSMCAICGDRATGKHYGASSCDGCKGFFRRSIRKCHVYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRKSAFEG---SIIPSINTLSQAEVLSRQITASSPDANTEINTKKIASISDVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGVTKRSMVF--KDILFLGNNYVIHRNCSEMEISRVASRVLDELVLPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPIKIKTMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQVQFVKLFGMVKIDNLLQEMLLG 376          
BLAST of HNF4 vs. Ensembl Xenopus
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:100486239])

HSP 1 Score: 355.91 bits (912), Expect = 5.494e-112
Identity = 179/346 (51.73%), Postives = 240/346 (69.36%), Query Frame = -1
Query:  946 VYASNASGPEGMEN--------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE----QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEF-VRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1944
            +Y  + S PEG  N        N +C IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTR+S+F+    ++I SI+ L QAE    Q  A     N +    + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LGV +RS      D+L LGNN +I RN S+   + +AS +LD+L +P +E+Q+DD E+ACLKAIVFFDP          ++  RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++V+F+K+ G+ +ID+LL E LLG
Sbjct:   34 LYNDSDSSPEGSANMNSLDNGINSMCAICGDRATGKHYGASSCDGCKGFFRRSIRKCHVYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRKSAFEG---SIIPSINTLSQAEVLSRQITASSPDANTEINTKKIASISDVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGVTKRSMVF--KDILFLGNNYVIHRNCSEMEISRVASRVLDELVLPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPIKIKTMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQVQFVKLFGMVKIDNLLQEMLLG 374          
BLAST of HNF4 vs. Ensembl Xenopus
Match: HNF4G (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:100486239])

HSP 1 Score: 353.599 bits (906), Expect = 9.157e-112
Identity = 179/340 (52.65%), Postives = 238/340 (70.00%), Query Frame = -1
Query:  946 SGPEGMEN--------NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE----QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1926
            S PEG  N        N +C IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTR+S+F+    ++I SI+ L QAE    Q  A     N +    + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LGV +RS      D+L LGNN +I RN S+   + +AS +LD+L +P +E+Q+DD E+ACLKAIVFFDP     S    ++  RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++V+F+K+ G+ +ID+LL E LLG
Sbjct:    8 SSPEGSANMNSLDNGINSMCAICGDRATGKHYGASSCDGCKGFFRRSIRKCHVYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRKSAFEG---SIIPSINTLSQAEVLSRQITASSPDANTEINTKKIASISDVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEQLLLGVTKRSMVF--KDILFLGNNYVIHRNCSEMEISRVASRVLDELVLPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPIKIKTMRYQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQVQFVKLFGMVKIDNLLQEMLLG 342          
BLAST of HNF4 vs. Ensembl Xenopus
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:100492541])

HSP 1 Score: 354.369 bits (908), Expect = 2.591e-111
Identity = 180/357 (50.42%), Postives = 250/357 (70.03%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            ++  Q++ +   +   +V + NA+   G+  N LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +    +N      + A + DVC+SMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAI+FFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   30 FENMQVLSIGTDTSPSDVTSLNATNSIGV--NSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINVLIQAE--VLSQQITSSVGVLNTDIRGKKIASITDVCDSMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNDRVIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 377          
BLAST of HNF4 vs. Ensembl Xenopus
Match: HNF4A (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:100492541])

HSP 1 Score: 352.443 bits (903), Expect = 3.243e-111
Identity = 180/357 (50.42%), Postives = 250/357 (70.03%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            ++  Q++ +   +   +V + NA+   G+  N LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +    +N      + A + DVC+SMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAI+FFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   28 FENMQVLSIGTDTSPSDVTSLNATNSIGV--NSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINVLIQAE--VLSQQITSSVGVLNTDIRGKKIASITDVCDSMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNDRVIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4g (hepatocyte nuclear factor 4, gamma [Source:MGI Symbol;Acc:MGI:1353604])

HSP 1 Score: 344.739 bits (883), Expect = 1.798e-108
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   19 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 337          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4g (hepatocyte nuclear factor 4, gamma [Source:MGI Symbol;Acc:MGI:1353604])

HSP 1 Score: 345.125 bits (884), Expect = 5.097e-108
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:   63 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 381          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4a (hepatic nuclear factor 4, alpha [Source:MGI Symbol;Acc:MGI:109128])

HSP 1 Score: 344.739 bits (883), Expect = 6.082e-108
Identity = 176/327 (53.82%), Postives = 240/327 (73.39%), Query Frame = -1
Query:  946 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1896
            LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +P   +N      + A++ DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+ACLKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   50 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLG 367          
BLAST of HNF4 vs. Ensembl Mouse
Match: Hnf4a (hepatic nuclear factor 4, alpha [Source:MGI Symbol;Acc:MGI:109128])

HSP 1 Score: 344.739 bits (883), Expect = 9.105e-108
Identity = 176/327 (53.82%), Postives = 240/327 (73.39%), Query Frame = -1
Query:  946 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1896
            LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +P   +N      + A++ DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+ACLKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   59 LCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSQQITSPISGINGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLG 376          
BLAST of HNF4 vs. Ensembl Mouse
Match: Rxra (retinoid X receptor alpha [Source:MGI Symbol;Acc:MGI:98214])

HSP 1 Score: 226.098 bits (575), Expect = 1.725e-64
Identity = 123/335 (36.72%), Postives = 188/335 (56.12%), Query Frame = -1
Query:  952 NNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDR--------ISTRRSSFDDIPPNVILSISQLMQAEQRVAIQK-----PPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS---HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1905
               +C IC D+++GKHYG +SC+GCKGFF+R+VRK   YTC+ N++C +DK +RN+C+YCR +KC+ +GMKR AVQ ER R        + +  S+ +D+P   IL     ++ +    ++      P +P +       V ++C++   QLF LV WAK +P FS+L L DQ+ LL+A   E+LI     RS  +   D +LL   L + RNS+  H A + +    +L +L   +R++Q+D  E  CL+AIV F+P     S    V   R ++   L  +   K   +PGRF +LLL +P LR +    ++ + F K+ G   ID+ L E L
Sbjct:  108 TKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVEANMGLNPSSPND------PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAV--KDGILLATGLHVHRNSA--HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEML 432          
BLAST of HNF4 vs. UniProt
Match: sp|Q91766|HNF4A_XENLA (Hepatocyte nuclear factor 4-alpha OS=Xenopus laevis OX=8355 GN=hnf4a PE=2 SV=2)

HSP 1 Score: 351.288 bits (900), Expect = 1.545e-109
Identity = 180/357 (50.42%), Postives = 250/357 (70.03%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            ++  Q++ +   +   +V + +AS   G+  N LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  Q+  +    +N      + A + DVC+SMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAI+FFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   28 FENMQVLSIGTDTSTSDVTSLSASNSIGI--NSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINVLIQAE--VLSQQITSSVGVLNTDIRGKKIACIIDVCDSMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMF--KDILLLGNDRLIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLSDPTKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. UniProt
Match: sp|Q14541|HNF4G_HUMAN (Hepatocyte nuclear factor 4-gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=3)

HSP 1 Score: 347.051 bits (889), Expect = 1.158e-108
Identity = 173/326 (53.07%), Postives = 236/326 (72.39%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQR---VAIQKPPNPQEY-MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+FD  +IP     SI+ L QAE R   +++  P +  +  + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGNN +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIP-----SINTLAQAEVRSRQISVSSPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. UniProt
Match: sp|P79926|HNF4B_XENLA (Hepatocyte nuclear factor 4-beta OS=Xenopus laevis OX=8355 GN=hnf4b PE=2 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 5.492e-108
Identity = 178/357 (49.86%), Postives = 236/357 (66.11%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMEN--NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQE----YMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            Y   +   + V     E+     + P  + N  N  C IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRIS RRSS++D   N  LSI+ L QAE  V    P +P       M + A + DVCESMK QL LLV WAK +P F +L L DQ++LL+AHAG  L+LGV +RS  L   D LLLGN+ I+  +  +   A +   ILD+L  PLRE+Q+DD E+ CLKAI+FFDP     S +  V+  R+Q+Q++L +++ND+Q+   GRF ++LL +P L+ +T  M+++V+F K+ G+A IDSLL E LLG
Sbjct:   14 YTMLEFDSIRVLPSNTEIITVETASPGLLNNGINSFCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHVYACRFSRQCIVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISMRRSSYED---NGSLSINVLTQAEAMVHQYSPVSPVHSSDISMKKVASISDVCESMKQQLLLLVEWAKYIPAFCELPLDDQVALLRAHAGAHLLLGVAKRS--LPYKDFLLLGNDFIMPMHCPELEIARVPCRILDELVKPLREIQIDDNEYVCLKAIIFFDPDCKGLSDQTKVKNMRFQVQVNLEDYINDRQFDSRGRFSDILLLLPPLQSITWQMIEQVQFAKLFGVARIDSLLQELLLG 365          
BLAST of HNF4 vs. UniProt
Match: sp|Q9WUU6|HNF4G_MOUSE (Hepatocyte nuclear factor 4-gamma OS=Mus musculus OX=10090 GN=Hnf4g PE=2 SV=2)

HSP 1 Score: 343.584 bits (880), Expect = 1.919e-107
Identity = 171/326 (52.45%), Postives = 233/326 (71.47%), Query Frame = -1
Query:  946 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEY----MNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1902
            N LC IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+++R C +DKDKRNQCRYCRL+KC   GMK+ AVQNERDRISTRRS+++  +IP     SI+ L QAE R      P+P       + + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ +I RNS +   + +A+ +LD+L  P +E+Q+DD E+ACLKAIVFFDP     S    ++  R+Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+ +ID+LL E LLG
Sbjct:    9 NCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTYEGSNIP-----SINTLAQAEVRSCQISVPSPSSSTDINIKKIASISDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMMY--KDILLLGNHYVIHRNSCEVEVSRVANRVLDELVRPFQEIQIDDNEYACLKAIVFFDPDAKGLSDPVKIKNMRFQVQISLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMVKIDNLLQEMLLG 327          
BLAST of HNF4 vs. UniProt
Match: sp|P41235|HNF4A_HUMAN (Hepatocyte nuclear factor 4-alpha OS=Homo sapiens OX=9606 GN=HNF4A PE=1 SV=3)

HSP 1 Score: 345.51 bits (885), Expect = 3.162e-107
Identity = 177/344 (51.45%), Postives = 246/344 (71.51%), Query Frame = -1
Query:  937 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSD-KHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1938
             +N + P  +  + LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QAE  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F +L L DQ++LL+AHAGE L+LG  +RS      DVLLLGN+ I+ R+  +    + ++  ILD+L +P +ELQ+DD E+A LKAI+FFDP    +S+ GK  ++R R Q+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG +P
Sbjct:   45 GTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALLQAE--VLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVF--KDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGK--IKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSP 379          
BLAST of HNF4 vs. TrEMBL
Match: gnl|BL_ORD_ID|20317516 (tr|H8YS99|H8YS99_SCHMD HNF4 OS=Schmidtea mediterranea OX=79327 GN=hnf4 PE=2 SV=1)

HSP 1 Score: 1219.14 bits (3153), Expect = 0.000e+0
Identity = 612/614 (99.67%), Postives = 613/614 (99.84%), Query Frame = -1
Query:  124 VSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGXXXXXXNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYXXXXXXXXXXXXXXXDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 1965
            +SSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYN DANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY
Sbjct:   42 MSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNGDANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 655          
BLAST of HNF4 vs. TrEMBL
Match: gnl|BL_ORD_ID|20342462 (tr|A0A1S3J4P6|A0A1S3J4P6_LINUN hepatocyte nuclear factor 4-gamma isoform X2 OS=Lingula unguis OX=7574 GN=LOC106170072 PE=3 SV=1)

HSP 1 Score: 375.555 bits (963), Expect = 5.594e-115
Identity = 187/337 (55.49%), Postives = 242/337 (71.81%), Query Frame = -1
Query:  907 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE--QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPET 1902
            +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRIS RR+S+D++  N  LS+S L+ AE   R       N      + A + DV ESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE LILGV RRS  L   DVLLLGN+ II R+SSD   + I+  ILD+L +PLRE+Q+DD+EFACLKAIVFFDP    +S+S K  ++  RYQ  ++L +++ND+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A+ID+LL E LLG    G  ++   T
Sbjct:  104 SQYCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHVYTCRFSRNCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISVRRTSYDEVAQNGALSVSTLLNAEILSRQISSPLGNVDISQKKLASINDVVESMKQQLLVLVEWAKYIPSFCELPLDDQVSLLRAHAGEHLILGVARRSISL--KDVLLLGNDYIIPRHSSDLEVSRISGRILDELVVPLREVQIDDSEFACLKAIVFFDPDAKGLSDSAK--IKSMRYQAHINLEDYINDRQYDSRGRFGEILLMLPPLQSITWQMIEQIQFAKLFGMAKIDNLLQEMLLGGATEGAQTLATPT 436          
BLAST of HNF4 vs. TrEMBL
Match: gnl|BL_ORD_ID|16986959 (tr|A0A1S3J5Z2|A0A1S3J5Z2_LINUN hepatocyte nuclear factor 4-gamma isoform X7 OS=Lingula unguis OX=7574 GN=LOC106170072 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 1.222e-114
Identity = 187/347 (53.89%), Postives = 242/347 (69.74%), Query Frame = -1
Query:  907 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE--QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP-------------RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPET 1902
            +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRIS RR+S+D++  N  LS+S L+ AE   R       N      + A + DV ESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE LILGV RRS  L   DVLLLGN+ II R+SSD   + I+  ILD+L +PLRE+Q+DD+EFACLKAIVFFDP              +S+S K  ++  RYQ  ++L +++ND+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A+ID+LL E LLG    G  ++   T
Sbjct:   13 SQYCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHVYTCRFSRNCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISVRRTSYDEVAQNGALSVSTLLNAEILSRQISSPLGNVDISQKKLASINDVVESMKQQLLVLVEWAKYIPSFCELPLDDQVSLLRAHAGEHLILGVARRSISL--KDVLLLGNDYIIPRHSSDLEVSRISGRILDELVVPLREVQIDDSEFACLKAIVFFDPGMKFQHLGDTDAKGLSDSAK--IKSMRYQAHINLEDYINDRQYDSRGRFGEILLMLPPLQSITWQMIEQIQFAKLFGMAKIDNLLQEMLLGGATEGAQTLATPT 355          
BLAST of HNF4 vs. TrEMBL
Match: gnl|BL_ORD_ID|20308518 (tr|A0A1S3J492|A0A1S3J492_LINUN hepatocyte nuclear factor 4-gamma isoform X6 OS=Lingula unguis OX=7574 GN=LOC106170072 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 2.517e-114
Identity = 187/347 (53.89%), Postives = 242/347 (69.74%), Query Frame = -1
Query:  907 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE--QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP-------------RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPET 1902
            +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRIS RR+S+D++  N  LS+S L+ AE   R       N      + A + DV ESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE LILGV RRS  L   DVLLLGN+ II R+SSD   + I+  ILD+L +PLRE+Q+DD+EFACLKAIVFFDP              +S+S K  ++  RYQ  ++L +++ND+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A+ID+LL E LLG    G  ++   T
Sbjct:   34 SQYCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHVYTCRFSRNCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISVRRTSYDEVAQNGALSVSTLLNAEILSRQISSPLGNVDISQKKLASINDVVESMKQQLLVLVEWAKYIPSFCELPLDDQVSLLRAHAGEHLILGVARRSISL--KDVLLLGNDYIIPRHSSDLEVSRISGRILDELVVPLREVQIDDSEFACLKAIVFFDPGMKFQHLGDTDAKGLSDSAK--IKSMRYQAHINLEDYINDRQYDSRGRFGEILLMLPPLQSITWQMIEQIQFAKLFGMAKIDNLLQEMLLGGATEGAQTLATPT 376          
BLAST of HNF4 vs. TrEMBL
Match: gnl|BL_ORD_ID|20304777 (tr|A0A1S3J4E8|A0A1S3J4E8_LINUN hepatocyte nuclear factor 4-gamma isoform X8 OS=Lingula unguis OX=7574 GN=LOC106170072 PE=3 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 4.358e-114
Identity = 186/340 (54.71%), Postives = 239/340 (70.29%), Query Frame = -1
Query:  928 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE--QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP-------------RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGV 1902
            +Q C IC D+ATGKHYGA SCDGCKGFFRRSVRK + YTC+++RNC +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRIS RR+S+D++  N  LS+S L+ AE   R       N      + A + DV ESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE LILGV RRS  L   DVLLLGN+ II R+SSD   + I+  ILD+L +PLRE+Q+DD+EFACLKAIVFFDP              +S+S K  ++  RYQ  ++L +++ND+QY   GRFGE+LL +P L+ +T  M+++++F K+ G+A+ID+LL E LLG    G 
Sbjct:  104 SQYCAICGDRATGKHYGAASCDGCKGFFRRSVRKNHVYTCRFSRNCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISVRRTSYDEVAQNGALSVSTLLNAEILSRQISSPLGNVDISQKKLASINDVVESMKQQLLVLVEWAKYIPSFCELPLDDQVSLLRAHAGEHLILGVARRSISL--KDVLLLGNDYIIPRHSSDLEVSRISGRILDELVVPLREVQIDDSEFACLKAIVFFDPGMKFQHLGDTDAKGLSDSAK--IKSMRYQAHINLEDYINDRQYDSRGRFGEILLMLPPLQSITWQMIEQIQFAKLFGMAKIDNLLQEMLLGGQVQGA 439          
BLAST of HNF4 vs. Ensembl Cavefish
Match: hnf4a (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:103043163])

HSP 1 Score: 352.058 bits (902), Expect = 8.689e-111
Identity = 183/361 (50.69%), Postives = 250/361 (69.25%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II+RN  +   + +   ILD+L +P +ELQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   24 TTLEFENMQVLAMSTDSSPAESANMNAASHLGA--GSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKMATITDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMLY--KDLLLLGNDHIIARNCPELEVSRVTVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 375          
BLAST of HNF4 vs. Ensembl Cavefish
Match: hnf4a (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:103043163])

HSP 1 Score: 350.903 bits (899), Expect = 1.254e-110
Identity = 183/358 (51.12%), Postives = 249/358 (69.55%), Query Frame = -1
Query:  943 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGD 1995
            ++  Q++ +S  S   E    NA+   G     LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++NR C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II+RN  +   + +   ILD+L +P +ELQ+DD E+ACLKAIVFFDP     S    ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG+
Sbjct:   19 FENMQVLAMSTDSSPAESANMNAASHLGA--GSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFNRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VLSRQISSPGPILNGDIRTKKMATITDVCESMKQQLLVLVEWAKYIPAFCDLPLDDQVALLRAHAGEHLLLGAAKRSMLY--KDLLLLGNDHIIARNCPELEVSRVTVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKGLSDPSKIKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLGE 367          
BLAST of HNF4 vs. Ensembl Cavefish
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:103037173])

HSP 1 Score: 347.436 bits (890), Expect = 2.071e-109
Identity = 177/349 (50.72%), Postives = 243/349 (69.63%), Query Frame = -1
Query:  946 VSVSSQQHEVYASNAS---GPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1971
            + VS Q+ E   +  S   G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RRS  D  D+PP  +L+ ++ +   Q++ +  P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +   + +A+ +LD+L  P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:    7 ILVSGQEEESMPTEPSISQGDNGVNSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRSLQDSHDLPPITVLAQAESL--SQQINVASPAGPADISEKKSATIGDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MPYKDILLLGNGCVIHRNCPEAEISRVANRVLDELVAPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKNMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 349          
BLAST of HNF4 vs. Ensembl Cavefish
Match: hnf4g (hepatocyte nuclear factor 4 gamma [Source:NCBI gene;Acc:103037173])

HSP 1 Score: 345.125 bits (884), Expect = 3.531e-108
Identity = 174/334 (52.10%), Postives = 235/334 (70.36%), Query Frame = -1
Query:  946 SNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRY-ADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1935
            S + G  G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + Y+C++NR C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RRS  D  D+PP  +L  +Q     Q++ +  P  P +   +  A + DVCESMK QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS  +   D+LLLGN  +I RN  +   + +A+ +LD+L  P +++Q+DD E+A LKAIVFFDP   S      ++  RYQ+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   50 SISQGDNGVNSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFNRQCVVDKDKRNQCRFCRLHKCFRAGMKKEAVQNERDRISSRRSLQDSHDLPPITVL--AQAESLSQQINVASPAGPADISEKKSATIGDVCESMKQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRS--MPYKDILLLGNGCVIHRNCPEAEISRVANRVLDELVAPFQDIQIDDNEYAALKAIVFFDPDAKSLRDPSKIKNMRYQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLFGLAKIDNLLQEMLLG 377          
BLAST of HNF4 vs. Ensembl Cavefish
Match: hnf4b (hepatic nuclear factor 4, beta [Source:ZFIN;Acc:ZDB-GENE-030131-2730])

HSP 1 Score: 293.123 bits (749), Expect = 3.342e-88
Identity = 162/327 (49.54%), Postives = 216/327 (66.06%), Query Frame = -1
Query:  940 NNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE----QRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDN 1905
               LC IC+DKATGKHYGA SCDGCKGFFRRSVRK + YTC+++R C +DKDKRNQCRYCRL+KC   GM++ AVQNERDRIS RR +         L+IS L++AE    Q +++  P        + A   DVCESMK QL LLV WAK +P F  L + D++ LL+AHA E LILG  RRS  L   D++LLGN+ II  +  ++  +++A+ +LD+L  PLREL ++D EFACLKAI+FF P        + VRR R+Q Q+ L    ++    + GRFGELLL +P L+ +   MV++++  ++ G A +DSLL E LLG+ 
Sbjct:   57 GGTLCSICADKATGKHYGANSCDGCKGFFRRSVRKNHAYTCRFSRQCVVDKDKRNQCRYCRLRKCFRAGMRKEAVQNERDRISCRRENQG----IGTLTISVLLKAEASTHQYISL-VPLVSDMSSKKIARSGDVCESMKQQLLLLVEWAKRIPEFCDLPVDDRVCLLRAHAAEHLILGGARRS--LPYSDIILLGNDFIIPVSGPEREMSKLAARVLDELVRPLRELDINDTEFACLKAIIFFAPDCPGLESSQMVRRLRFQAQVLL----DEATCEQRGRFGELLLLLPPLQSMAWQMVEQLQLARLLGEASVDSLLQEMLLGEG 372          
BLAST of HNF4 vs. Ensembl Sea Lamprey
Match: hnf4g (hepatocyte nuclear factor 4, gamma [Source:ZFIN;Acc:ZDB-GENE-060929-100])

HSP 1 Score: 305.449 bits (781), Expect = 2.312e-94
Identity = 168/347 (48.41%), Postives = 228/347 (65.71%), Query Frame = -1
Query:  946 SSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPP----NPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLL---GNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1962
            +SQ++     NA G   M     C IC D+ATGKHYGA SCDGCKGFFRRS+RK + Y+C+Y+R C +DKDKRNQCRY RLKKC   GMK+ AVQNERDRISTRR+S DD       SI+  +QAE       PP    +    + + A + D+CES+K QL +LV WAK LP F +L L DQ++LL+AHAGE L+LGV +RS  +   DVLLL   G+  I++R+  +     +A  +LD+L +P +ELQ+DD EFACLKA+VFFDP        E +R  R+Q Q+ L +++ D+QY   GRFG+LLL +P L+ +   M+++++  ++  +  +DSLL E LLG
Sbjct:   43 ASQRNVNVHHNAIGGGTMS---FCAICGDRATGKHYGASSCDGCKGFFRRSIRKNHMYSCRYSRQCVVDKDKRNQCRY-RLKKCFRAGMKKEAVQNERDRISTRRNSQDDATSP---SINTFVQAESLSRQFMPPMVGGSGDLSLKQVASIQDICESIKQQLLVLVEWAKYLPVFCELLLDDQVALLRAHAGEHLLLGVAKRS--MTYKDVLLLGAAGDGHILARSCPEADVGRVACRVLDELVVPFQELQIDDNEFACLKAVVFFDPDAKGLRDPERIRNVRFQAQLSLEDYVTDRQYESRGRFGQLLLLLPTLQSLAWQMIEQIQLARLLSVVRVDSLLQEMLLG 380          
BLAST of HNF4 vs. Ensembl Sea Lamprey
Match: nr2f1b (nuclear receptor subfamily 2, group F, member 1b [Source:NCBI gene;Acc:393564])

HSP 1 Score: 136.346 bits (342), Expect = 2.791e-35
Identity = 101/333 (30.33%), Postives = 159/333 (47.75%), Query Frame = -1
Query:  940 RSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKR--AAVQNERDRISTRRSSFDDIP------------PNVILS------------------ISQLMQAEQRVAIQKPPNPQEYM-------NRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS-HILDDLFIPLRELQLDDAEFACLKAIVFFDP-RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDN 1815
            RSVR+   YTC+ NRNC +D+  RNQC+YCRLKKC+ VGM+R  A V+   D+    R S    P            PN  L                   IS L++AE        P P           N    + ++CE     LF  V WA+++P F  L ++DQ++LL+    E+ +L   + +  L     LL    L  S  S+D+  A +    I  +    L+ L +D AE++CLKAIV F       S    +   + + Q  L  ++  +  ++P RFG+LLL +P LR V+  +++++ F+++ G   I++L+ + LL  +
Sbjct:    1 RSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREGACVKVHADQ----RVSLVPFPAVQRGRLAPTQHPNPALQYALVNGDPLNGHSYLSGYISLLLRAE--------PYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVALLRLVWSELFVLNAAQCAMPLHVAP-LLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFSTDACGLSDAAHIENLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGS 320          
BLAST of HNF4 vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 133.265 bits (334), Expect = 3.827e-34
Identity = 88/282 (31.21%), Postives = 142/282 (50.35%), Query Frame = -1
Query: 1183 ASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKR------AAVQNERDRISTRRS--------------SFDDIPPNVILSISQLMQAEQRVAIQKPP-------NPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLF---IPLRELQLDDAEFACLKAIVFFD 1938
            AS   GP      QLC +C D ++G HYG ++C+GCK FF+RSV+ KNN+ C    +C +DK +R +C+ CRL+KC   GM R       A  +   R++ R S              S      +++L I  L +  Q + ++  P       +P E +   + +    +    ++  +V+WAK +P F +L+L  +I LL+    E+LI G+I RS  +++ D L+  ++L+ +R  +D    E    I D +       REL L   E+ACLKA+V  +
Sbjct:    1 ASPVDGPA----TQLCSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATNHCTIDKTRRRRCQACRLRKCYEAGMIRDVPLLATACSSRLTRLARRHSPACHGSLAAPYSTHSPSLPLQSLLLRIQLLPKHLQAILLEAEPPKLLCMRSPGEPLTEASMMTLFTDLATKEMVHIVSWAKKIPGFMELDLPVKIQLLENSWVEVLITGLIWRS--MEQQDTLVFASDLVFTR--ADGSRMEGTMEIFDQVLAIVTHFRELCLRMEEYACLKAMVLLN 274          
BLAST of HNF4 vs. Ensembl Sea Lamprey
Match: ESR2 (estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3468])

HSP 1 Score: 131.724 bits (330), Expect = 1.148e-33
Identity = 89/292 (30.48%), Postives = 139/292 (47.60%), Query Frame = -1
Query: 1183 NQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRI-------------------------------------STRRS---SFDDIPPNVILS----ISQLMQAE--QRVAIQKPPNP---QEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLF---IPLRELQLDDAEFACLKAIVFFD 1902
             QLC +C D ++G HYG ++C+GCK FF+RSV+ KNN+ C    +C +DK +R +C+ CRL+KC   GM R    + RDRI                                       RR    SF    P+  +     I  L++AE  + + ++ P  P      M  + D+         ++  +V+WAK +P F +L+L  +I LL+    E+LI G+I RS  +++ D L+  ++L+ +R  +D    E    I D +       REL L   E+ACLKA+V  +
Sbjct:    2 TQLCSVCGDFSSGYHYGVWTCEGCKAFFKRSVQGKNNFVCPATNHCTIDKTRRRRCQACRLRKCYEAGMIRDGCHS-RDRILLCMVIKSLKQLEKNASHGIRNTTSAQTPTGYRGFKSDARRGGIRSFGGAVPHAHVEGMGIIHILLEAEPPKLLCMRSPGEPLTEASMMTLFTDLAT------KEMVHIVSWAKKIPGFMELDLPVKIQLLENSWVEVLITGLIWRS--MEQQDTLVFASDLVFTR--ADGSRMEGTMEIFDQVLAIVTHFRELCLRMEEYACLKAMVLLN 282          
BLAST of HNF4 vs. Ensembl Sea Lamprey
Match: thrb (thyroid hormone receptor beta [Source:NCBI gene;Acc:30607])

HSP 1 Score: 128.642 bits (322), Expect = 4.496e-32
Identity = 101/358 (28.21%), Postives = 165/358 (46.09%), Query Frame = -1
Query:  991 NASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRK--KNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTR--------RSSFDDIPPNVI---------LSISQLMQA--------------EQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFL---------LVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLD-EDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP-RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMT 1932
             A  P  ++ N+ C++C DKATG HY   +C+GCKGFFRR+++K    +Y C+Y  +C +D+  RNQC+ CR +KCI VGM    V ++  R++ R        R   D+   NVI           + QL+ A               +R  +     P+  ++   D  D  +      F          +V++AK LP F++L   DQI LLK    EI+ L   R + + D E D L L   + + +         + S  + DL   L    LDD E A L+A++     R      + V + +    + L +++N +++     + +LL+ + DLRL+      ++  MK+T
Sbjct:   27 GAYMPSYLDKNEPCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYACKYEGSCIIDRITRNQCQECRYQKCIAVGMASDLVLDDSKRLAKRRLIEENRQRRKQDEKRRNVIERPGPSDKEWELIQLVTAAHCTTNAQGSQWKEHRRFLVSNCLGPESVLSSL-DGDDKVDLQAFTHFTAIITPSITRVVDFAKKLPMFTELPCEDQIVLLKGCCMEIMSL---RAAVRYDPESDTLTLNGEVAVKKEQLKNGGLGLVSDAIFDLGRSLAAFSLDDTEVALLQAVLLMSTDRPGLVNVDKVEKLQDTYLLALEHYINHREHRLNHFWPKLLMKVTDLRLIGACHSSRILHMKVT 380          
BLAST of HNF4 vs. Ensembl Nematostella
Match: EDO46487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ27])

HSP 1 Score: 321.627 bits (823), Expect = 1.018e-101
Identity = 159/323 (49.23%), Postives = 223/323 (69.04%), Query Frame = -1
Query:  946 LICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAE--QRVAIQKPPNPQEYMN-----RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESG-KEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1890
            LIC+D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C++ RNC ++KDKRNQCR+CRL+KC   GMK+ AVQNERD IS +            L+   L+ AE   R A   PP  +  +      + A+  D+CESM+ QL +LV WAK LPCF +L L DQ++LL+AHA E L+LGV RRS  L   D+LLLGN+L+I R + D    +IA+ ILD++ +P+R+L +DD E++CLKAIVFF+P     G  + ++  R++IQ  L ++++D QY   G+FGE+LL +P L+ +   MV++++F ++ G+A++DSLL E LLG
Sbjct:    2 LICADRATGKHYGASSCDGCKGFFRRSVRKNHVYSCRFQRNCVINKDKRNQCRFCRLRKCFRAGMKKEAVQNERDSISKKPKE----EKKYGLTTQSLLSAEILSRPA-SSPPGTKTLLKSICLEKEANYSDICESMRQQLLILVEWAKHLPCFCELPLDDQVALLRAHASEHLVLGVSRRSLNL--KDILLLGNDLVIPRQAGDTEVRKIATRILDEIVLPMRQLNIDDVEYSCLKAIVFFNPDAKGLGDSQKIKALRFEIQTTLEDYISDHQYECRGKFGEILLLLPTLQAIALQMVEQIQFARLFGVAKVDSLLQEMLLG 317          
BLAST of HNF4 vs. Ensembl Nematostella
Match: EDO37645 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF49])

HSP 1 Score: 181.415 bits (459), Expect = 2.879e-50
Identity = 115/343 (33.53%), Postives = 186/343 (54.23%), Query Frame = -1
Query:  937 PEGMENN-QL-CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNER---DRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVP-------DVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASH--ILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNP 1920
            PE  E N Q+ C +C DK++GKHYG F+C+GCK FF+RSVR+   YTC+ +R+C +D+  RNQC+YCRLKKC+ VGM+R AVQ  R    +  T+ ++   I  +   +    +     + ++  P P     +  ++P       ++CE     LF  V WA+++P F  L ++DQ++LL+    E+ +L   +    L      LL    I S + S         +  I  +    LR L +D AEFACLKAIV F    S  +  +++   + + Q  L  +  ++  ++P RFG+LLL +P LR ++  +V+++ F+++ G   I++LL + LL   P
Sbjct:   17 PEDSEKNVQVECAVCGDKSSGKHYGVFTCEGCKSFFKRSVRRNLTYTCRASRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRIPAAQTPTQNAALPGINGDGSTNGHSYLSGFIALLLRAEPYPTTRFQQGLNMPCGIMGIENICELAARLLFSAVEWARNIPFFPDLAVTDQVALLRLVWSELFVLNAAQCPMPLQVAP--LLATAGIHSNHMSPDRMVSFMDNIRIFQEQVEKLRNLHVDAAEFACLKAIVLFTSDASGLTDPQYIESLQEKTQCALEEYTRNQYPNQPTRFGKLLLRLPSLRSISSSVVEQLFFVRLVGKTPIETLLRDMLLSGTP 357          
BLAST of HNF4 vs. Ensembl Nematostella
Match: EDO38323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD90])

HSP 1 Score: 162.54 bits (410), Expect = 9.572e-44
Identity = 119/346 (34.39%), Postives = 173/346 (50.00%), Query Frame = -1
Query:  958 CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNR---NCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERD-RISTRRS--------------SFDDIPPNVILSISQLMQAEQR-----VAIQ------KPPNPQEYMN---RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS-HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSE 1893
            C +C D+++GKHYG ++CDGC GFF+RS+R+  +YTC+      NC +DK  RNQCR CRLKKC  V M + AVQ+ER  R ST R               S    P      I+ L+ AE R     +A+       KP   Q  M+    Y+    VCE+    LF+ V WA+++P F  L   DQ+ LL+    E+ +LG  + S  L E   +L  + + +     +K    +A+   L +     +   +D  EFACLKAIV F P        E +   + Q Q+ L  ++      +  RFG LLL +P LR V+ L ++++ F K  G   I+ LLS+
Sbjct:    8 CKVCGDRSSGKHYGIYACDGCSGFFKRSIRRNRSYTCRATNGKGNCPVDKIHRNQCRSCRLKKCFDVSMNKDAVQHERGPRSSTLRKQKMLKEAQERLELVSVAHAPQGPSGFINTLLAAEPRMDGCGMAVNDFDLEYKPIRLQSDMSVPMYYSSPESVCEAAAKLLFMSVKWARNIPSFMSLPFRDQVILLEEGWRELFLLGASQWSMPL-EIAPILAASGMHVDNTPPEKIVDVMATVRTLQEAVNKFKAFGVDSTEFACLKAIVLFKPAACGLKDPEQIETTQDQAQLMLGEYIRSTYPTQVARFGRLLLLLPALRRVSALAIEELFFKKTIGTVPIERLLSD 352          
BLAST of HNF4 vs. Ensembl Nematostella
Match: EDO32715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUB6])

HSP 1 Score: 159.844 bits (403), Expect = 3.525e-43
Identity = 105/329 (31.91%), Postives = 163/329 (49.54%), Query Frame = -1
Query:  958 ICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQR---VAIQKPPN-------PQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS-HILDDLFIPLRELQLDDAEFACLKAIVFFDPRV--------SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSE 1887
            +C D+++GKHYG F+CDGC+GFF+RS+R+   Y C+    C +D  +RNQC+ CRLKKC  V M + AVQ+ER   S +      I P    + +  +  E R   V  Q+  +       P  Y     D   + ES    L++ V WA+++P F  L   DQ  LL+    E+ +L   + S  LD    LL    L + +  +D+  A +A   +L ++    + LQ+D  E+ACLKAIV F P +             + V R + Q Q  L  +   +   +  RFG+LLL +P L+ V+  M++ + F        I+ +L +
Sbjct:    3 VCGDRSSGKHYGVFTCDGCRGFFKRSIRRNLTYHCKELGKCVVDVARRNQCQACRLKKCFEVQMNKDAVQHERAPRSAQ------ILPRATSTTTIDLNKEDRPDGVPTQRSTDMCPGWTFPTGYQTAPQD--SIYESAVQLLYMSVTWARNIPTFLDLPFRDQAILLEEGWSELFVLSSAQFSLPLDMGP-LLSAAGLQVDKAPTDRIVAGMADIRLLQNIVTRFKRLQIDSTEYACLKAIVLFKPVLPFFPVNLRGLRAPQLVERLQDQAQSMLGEYCRSQYPDQQVRFGKLLLMLPSLKTVSPKMIEDLFFRGTLDNVPIERMLCD 322          
BLAST of HNF4 vs. Ensembl Nematostella
Match: EDO38322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD88])

HSP 1 Score: 159.073 bits (401), Expect = 1.014e-42
Identity = 118/332 (35.54%), Postives = 177/332 (53.31%), Query Frame = -1
Query:  952 LCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTR--RSSFDDIPPNVILS--ISQLMQAEQ-RVAIQKPPNPQE--YMNRYADVPDVC-------ESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS-HILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLM--NHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1896
            LC +C D ++G+HYG ++CDGC GFF RSVR+   YTC+ N  C +DK +RNQC+ CR KKC+ V M R AVQ ER   STR  +   D+     + +  ++ L+ AE  R A+ +        Y+ +    P  C       ES    LF+ V WA+++P F  L   DQ+ LL+    E+ I+G I+ +  L E   LL    + +    ++K  A +A    L ++    R LQ+ +AEFACLKAIV F P + +        C YQ Q  +M  +++  +   +  RFG+LLL +P LRLV    ++++ F +  G   I+SLL +  
Sbjct:    8 LCKVCGDISSGRHYGVYTCDGCSGFFMRSVRRDMVYTCKGNGGCTVDKKRRNQCQACRFKKCLEVKMNRFAVQQERQPNSTRVMKPHLDEYGLKGLNNEFLASLIVAEPCRDAVYRTSQGLNLPYLQQDVASPLFCSSPDALFESAARLLFMSVKWARNIPSFVNLPFRDQVVLLEEGWRELFIMGAIQWNLPL-EVAPLLAAAGMHVDNTPAEKIVATMADIRKLQEIGSRFRALQVCEAEFACLKAIVLFKPDLRDLRDPQQVEC-YQDQAQIMLGDYIKRQFAGQQVRFGKLLLMLPSLRLVRNKTIEELFFRQTIGSVAIESLLCDMF 337          
BLAST of HNF4 vs. Ensembl Medaka
Match: hnf4a (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:101174427])

HSP 1 Score: 355.525 bits (911), Expect = 3.605e-112
Identity = 184/363 (50.69%), Postives = 253/363 (69.70%), Query Frame = -1
Query:  946 SVVLYKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 2007
            + + ++  Q++ +   S   E    NA+G   +    LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAIVFFDP    +S+ GK  ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   15 TTLEFENMQVLPLGTDSSPAESTNMNATG--HLAAGSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VMTRQITSPTPILNGDVRTKKIATITDVCESMKQQLLVLVEWAKYIPAFCDLALDDQVALLRAHAGEHLLLGAAKRSMLY--KDILLLGNDHIIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKGLSDLGK--IKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 366          
BLAST of HNF4 vs. Ensembl Medaka
Match: hnf4a (hepatocyte nuclear factor 4 alpha [Source:NCBI gene;Acc:101174427])

HSP 1 Score: 354.755 bits (909), Expect = 5.251e-112
Identity = 184/359 (51.25%), Postives = 251/359 (69.92%), Query Frame = -1
Query:  946 YKYYQIVFVSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMN------RYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1995
            ++  Q++ +   S   E    NA+G   +    LC IC D+ATGKHYGA SCDGCKGFFRRSVRK + Y+C+++R C +DKDKRNQCRYCRLKKC   GMK+ AVQNERDRISTRRSS++D   + + SI+ L+QA+  V  ++  +P   +N      + A + DVCESMK QL +LV WAK +P F  L L DQ++LL+AHAGE L+LG  +RS      D+LLLGN+ II RN  +     +A  ILD+L +P +ELQ+DD E+ACLKAIVFFDP    +S+ GK  ++R RYQ+Q+ L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ G+A+ID+LL E LLG
Sbjct:   19 FENMQVLPLGTDSSPAESTNMNATG--HLAAGSLCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCIVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYED---SSLPSINALIQAD--VMTRQITSPTPILNGDVRTKKIATITDVCESMKQQLLVLVEWAKYIPAFCDLALDDQVALLRAHAGEHLLLGAAKRSMLY--KDILLLGNDHIIPRNCPELEVGRVAVRILDELVLPFQELQIDDNEYACLKAIVFFDPDAKGLSDLGK--IKRMRYQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFVKLFGMAKIDNLLQEMLLG 366          
BLAST of HNF4 vs. Ensembl Medaka
Match: hnf4g (hepatocyte nuclear factor 4-gamma [Source:NCBI gene;Acc:101162560])

HSP 1 Score: 335.88 bits (860), Expect = 3.396e-105
Identity = 174/331 (52.57%), Postives = 234/331 (70.69%), Query Frame = -1
Query:  946 GPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLM--QAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1923
            G +G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + YTC+++R C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RRS  D  D+PP  IL+ ++ +  Q    VA+    +  E   + A V DVC+SM+ QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS +    D+LLLGN  II RNS +     +A+  LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  R Q+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   21 GADGLSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYTCRFSRQCIVDKDKRNQCRFCRLNKCFRAGMKKEAVQNERDRISSRRSIPDSQDLPPITILAQAESLSQQITTPVALT---DTSEL--KSASVADVCDSMRQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRSMRF--KDLLLLGNGCIIHRNSPEPEICRVANRALDELVVPFQDIQIDDNEYAALKAIVFFDPDAKSLRNPSKIKAMRLQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLCGLAKIDNLLHEMLLG 342          
BLAST of HNF4 vs. Ensembl Medaka
Match: hnf4g (hepatocyte nuclear factor 4-gamma [Source:NCBI gene;Acc:101162560])

HSP 1 Score: 336.265 bits (861), Expect = 5.429e-105
Identity = 174/331 (52.57%), Postives = 234/331 (70.69%), Query Frame = -1
Query:  946 GPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFD--DIPPNVILSISQLM--QAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRV-SESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLG 1923
            G +G+ +N  C IC DKATGKHYGA SCDGCKGFFRRS+RK + YTC+++R C +DKDKRNQCR+CRL KC   GMK+ AVQNERDRIS+RRS  D  D+PP  IL+ ++ +  Q    VA+    +  E   + A V DVC+SM+ QL +LV WAK +P F +L L DQ+SLL+AHAGE L+LGV +RS +    D+LLLGN  II RNS +     +A+  LD+L +P +++Q+DD E+A LKAIVFFDP   S      ++  R Q+QM L +++ND+QY   GRFGELLL +P L+ +T  M+++++F+K+ GLA+ID+LL E LLG
Sbjct:   53 GADGLSSN--CAICGDKATGKHYGASSCDGCKGFFRRSIRKSHVYTCRFSRQCIVDKDKRNQCRFCRLNKCFRAGMKKEAVQNERDRISSRRSIPDSQDLPPITILAQAESLSQQITTPVALT---DTSEL--KSASVADVCDSMRQQLLVLVEWAKYIPAFGELPLDDQVSLLRAHAGEHLLLGVAKRSMRF--KDLLLLGNGCIIHRNSPEPEICRVANRALDELVVPFQDIQIDDNEYAALKAIVFFDPDAKSLRNPSKIKAMRLQVQMSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQLQFIKLCGLAKIDNLLHEMLLG 374          
BLAST of HNF4 vs. Ensembl Medaka
Match: rxraa (retinoid X receptor alpha [Source:NCBI gene;Acc:100125504])

HSP 1 Score: 227.254 bits (578), Expect = 6.641e-65
Identity = 127/343 (37.03%), Postives = 193/343 (56.27%), Query Frame = -1
Query:  952 PEGME---NNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPP--NVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVP---------DVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIAS---HILDDLFIPLRELQLDDAEFACLKAIVFFDP---RVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETL 1920
            P GM       +C IC D+++GKHYG +SC+GCKGFF+R+VRK   YTC+ N++C +DK +RN+C+YCR +KC+ +GMKR AVQ ER R   +  +  +     N  + + ++++AE+ V     P  + Y+     VP         ++C++   QLF LV WAK +P FS L L DQ+ LL+A   E+LI     RS  +   D +LL   L + RNS+  H A + +    +L +L   +R++Q+D  E  CL+AIV F+P    +S  G+  V   R ++   L  +   K   +PGRF +LLL +P LR +    ++ + F K+ G   ID+ L E L
Sbjct:  112 PSGMALSLTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCIIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRAKEKNENEVESTSCVNEDMPVEKILEAEEAVE----PKTETYIETNLSVPSNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSDLPLDDQVILLRAGWNELLIASFSHRSIAV--KDGILLATGLHVHRNSA--HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPGE--VEALREKVYASLEAYCKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEML 444          
BLAST of HNF4 vs. Planmine SMEST
Match: SMESG000014588.1 (SMESG000014588.1)

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 613/614 (99.84%), Postives = 614/614 (100.00%), Query Frame = -1
Query:  124 VSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGXXXXXXNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYXXXXXXXXXXXXXXXDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 1965
            +SSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNSDANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY
Sbjct:   42 MSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDIINSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPSSTSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVPSLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNSDANHNCSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIANRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY 655          

HSP 2 Score: 55.0694 bits (131), Expect = 2.307e-7
Identity = 41/41 (100.00%), Postives = 41/41 (100.00%), Query Frame = -2
Query: 2346 MTSTQHPNLNPAFSYQLLTXXXXXXXXXXXXXSMQYPLESE 2468
            MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESE
Sbjct:    1 MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESE 41          
BLAST of HNF4 vs. Planmine SMEST
Match: SMESG000056421.1 (SMESG000056421.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.062e-45
Identity = 111/383 (28.98%), Postives = 200/383 (52.22%), Query Frame = -1
Query:  949 SVSSQQHEVYASNASGPEG---------------MENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILS------ISQLMQAEQRVAIQKPPNPQEYMNR-YADVPDVCESMKNQLFL---------------LVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHI--LDDLFIPLRELQLDDAEFACLKAIVFFDPRVSE-SGKEFVRRCRYQIQMDLMNHMNDKQYHKPG---RFGELLLTIPDLRLVTQLMVKKVEFMKMTGLAEIDSLLSETLL 1968
            S+S++Q+E   +  +  EG               + NN  C++C DK++GKHYG ++C+GCK FF+RSVR+   Y+C+ N NC +D   RNQC+ CR +KC+ +GM++ AVQ  + RI    S +     +   S      I  +MQ +  ++ Q+      +MN  +++  ++C++   + +                ++ W+KS+P F  L+++DQI+LLK+   E+ +L     S  L     LL    L ++   ++K    +  HI  + D    L++ Q+D AEF+CLKA+V F+  +   S   +V   +  +Q  L  +   +++H P    RFG+LLL IP L+ +   +++++ F ++ G   + +L+ E ++
Sbjct:   72 SLSNKQYEEPTTTTTSAEGSSPSSPSNQDSEDNKLGNNIECVVCGDKSSGKHYGQYTCEGCKSFFKRSVRRNLTYSCRGNHNCPIDIHHRNQCQNCRFQKCLKMGMRKEAVQ--QGRIPQFSSHYGQYIASTYGSSYFNRFIGMMMQNDSMLSKQEKIG---FMNHLFSNHSNICDTTSEEKYFGIDSIYDIASKILHGVIQWSKSIPFFPDLSITDQITLLKSSWSELFLLTSAHSSTPLHLAP-LLASVGLQVNPVGAEK-VVILLDHIRLIQDQIEKLKKFQIDSAEFSCLKALVLFNSDIRGLSDPVYVEHIQETVQNALEEY---EKFHYPNQITRFGKLLLRIPQLKSINSSIIEELLFTRLIGNNSVTNLIKEYII 444          
BLAST of HNF4 vs. Planmine SMEST
Match: SMESG000019911.1 (SMESG000019911.1)

HSP 1 Score: 172.555 bits (436), Expect = 2.618e-45
Identity = 112/326 (34.36%), Postives = 170/326 (52.15%), Query Frame = -1
Query: 1006 VSVSSQQHEVYASNASGPEGMENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNV-ILSISQLMQAEQRVA-IQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDK-HFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPR-VSESGKEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVE 1971
            +S+ S Q   Y +N+       +  LC IC+D ATGKHYG  +C+GCKGFF+R++RK+ +YTC+    C + +  RN+C+ CR  KC+  GMK  AVQ ER     + SS   I  ++ I+    ++Q E     ++  P  +       +   +C  +  QLF LV WAKS+P FS L   DQ+ LL     EILI+    RS    E   L + N   +S + + K  F  +   IL +L + L+ +++D  E ACLK I+ FD   V+    E + + RY+I   L  +++ K   +P R  +LLL +  LR  T   V  ++
Sbjct:  151 LSIDSSQSS-YTNNSLAAAPSSHYDLCAICTDLATGKHYGVLACEGCKGFFKRTIRKELHYTCREKNMCPITERLRNRCQSCRFNKCLDQGMKIEAVQRERSVQQLQASSESKITDSIPIVEAENILQNEIAFYFVENSPGEELSTVEIDEAKLLCFVINKQLFNLVMWAKSVPGFSHLEKCDQMVLLNKCWVEILIVSFSFRSSVESEFGSLRMDNVHRLSLSVASKLGFGNLMIRILRELIMSLKYIKVDQMEIACLKTIILFDSNYVNLKNSELIAQFRYRIFDILKQYVSQKYPEQPFRIYKLLLKLTSLRSFTASFVTTMK 475          
BLAST of HNF4 vs. Planmine SMEST
Match: SMESG000078464.1 (SMESG000078464.1)

HSP 1 Score: 116.316 bits (290), Expect = 3.062e-26
Identity = 100/385 (25.97%), Postives = 170/385 (44.16%), Query Frame = -1
Query:  952 CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRN----CKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDD-----------------------------------IPPNVILSISQLMQA----------------------EQRVAIQKPPNPQE-YMNRYADVPDVC------ESMKNQLFLLVNWAKSLPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESGKEFVRRCRYQIQMDLMNHMNDKQYHK--PGRFGELLLTIPDLRLVTQLMVKKVEFMK-MTGLAEIDSLLSETL 1893
            C IC D  +G HYG F C+ CKGFF+RSV+   +Y C   ++    C ++K  R +C  CR ++CI  GM+  AV+N+R R   R+S+ DD                                   IPP+  L  S+++ +                      E  VA+++  + +E  + + ++  D+       +  + +L  +V W++ LP F+ ++  DQI L++    ++LIL    RS   D  ++ L     I    + +    EI + IL  +   L+  +LD  EFACLK ++   P +     E   R   +    L+     + Y    P +F +L++ IP++R  +   VK++   K +T     +SLL E L
Sbjct:  307 CPICEDAISGYHYGIFCCESCKGFFKRSVQNHKDYVCHAQQSGGEPCVINKHTRKKCPSCRFQRCIDKGMRIEAVRNDRSR-GGRKSTSDDASQKTSNDAADSPNYLGFVRQLNSIQSTVSNSGNTIPPSSSLEYSKIVSSSNNGPLHRALSSRGRTSMMSVLENIVAVEETLSQEEDVLGQVSEDDDMAVYRVLLKLAEQRLHRMVRWSRLLPEFAAIDTDDQIMLVQNCWADLLILDCCYRSLG-DPREIHLTSGKCINLEAACELGAKEIVAFIL-QMTQKLKRFKLDIREFACLKVLLLMQPDLKNLKAEGRVRTFQETVSQLLLDYTTQNYENEIPNKFYDLIMCIPEIRSAS-FSVKEMLISKDLTPFLNHNSLLLELL 687          
BLAST of HNF4 vs. Planmine SMEST
Match: SMESG000023925.1 (SMESG000023925.1)

HSP 1 Score: 111.309 bits (277), Expect = 1.650e-25
Identity = 88/336 (26.19%), Postives = 161/336 (47.92%), Query Frame = -1
Query:  940 CLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCKMDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVILSISQL-MQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKSLPCFSQ--------LNLSDQISLLKAHAGEILILGVIRRSFQLDED----DVLLLGNNLIISRNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDP-RVSESGKEFVRRCRYQIQMDLMNH-MNDKQYHKPGRFGELLLTIPDLRLVTQLMVKKVEFMKMTGLA---EIDSLLSETLLGDN 1893
            C +C DK++G+HYG ++C+GCK FF+RSVR +++Y C  + +C +D  +RN C++CR +KC   GM++ AVQ  R  +ST  S        +I    +L MQ  + + I      Q  +  Y   P++ +   +   L+     +L C  Q        L++SDQ  L+K++   IL L   +   QL  +    + +   NN +I    +  H   I +H+       ++ L+ +  ++  L  ++ ++P     S    V      IQ  L++  + D          +LLL +P L +  Q +++++ F +M  L     I+ ++++ +L  N
Sbjct:   57 CKVCGDKSSGRHYGQYTCEGCKSFFKRSVRNQSSYQCYASGDCVIDIQRRNNCQFCRFQKCFASGMRKEAVQTGR-CLSTTGS--------IIYKTDKLAMQNSKNIPINSLDYNQSRLMDYLSAPEISQYGLSWSLLM----STLDCIGQDFRLKKSGLSMSDQFLLIKSNWHIILALIACQNQIQLPFNSWISEKMSYNNNGLI---HTIPHLNFIENHLRK-----IQNLKPNFKQYNWLFNVILYNPDTYGLSAPHLVGT----IQQTLLDSVITDLTKENVLIHSKLLLNVPSLVIFNQPLIEEILFREMINLGYFININQVINKWVLSYN 367          
The following BLAST results are available for this feature:
BLAST of HNF4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNF4G2.555e-11051.74hepatocyte nuclear factor 4 gamma [Source:HGNC Sym... [more]
HNF4G2.584e-11051.74hepatocyte nuclear factor 4 gamma [Source:HGNC Sym... [more]
HNF4G2.412e-10953.07hepatocyte nuclear factor 4 gamma [Source:HGNC Sym... [more]
HNF4A1.702e-10851.45hepatocyte nuclear factor 4 alpha [Source:HGNC Sym... [more]
HNF4A2.697e-10851.45hepatocyte nuclear factor 4 alpha [Source:HGNC Sym... [more]
back to top
BLAST of HNF4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhr-691.148e-6537.50Nuclear hormone receptor family member nhr-69 [So... [more]
nhr-642.023e-5436.67Nuclear hormone receptor family member nhr-64 [So... [more]
nhr-642.247e-5436.67Nuclear hormone receptor family member nhr-64 [So... [more]
nhr-642.247e-5436.67Nuclear hormone receptor family member nhr-64 [So... [more]
nhr-358.280e-5432.73Nuclear hormone receptor family member nhr-35 [So... [more]
back to top
BLAST of HNF4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnf46.502e-10450.59gene:FBgn0004914 transcript:FBtr0344784[more]
Hnf41.586e-10350.59gene:FBgn0004914 transcript:FBtr0079747[more]
Hnf41.586e-10350.59gene:FBgn0004914 transcript:FBtr0336633[more]
Hnf41.718e-10350.59gene:FBgn0004914 transcript:FBtr0112846[more]
Hnf42.359e-10350.59gene:FBgn0004914 transcript:FBtr0079748[more]
back to top
BLAST of HNF4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4a9.728e-11150.69hepatocyte nuclear factor 4, alpha [Source:ZFIN;Ac... [more]
hnf4a9.728e-11150.69hepatocyte nuclear factor 4, alpha [Source:ZFIN;Ac... [more]
hnf4a9.728e-11150.69hepatocyte nuclear factor 4, alpha [Source:ZFIN;Ac... [more]
hnf4g1.086e-10651.20hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
hnf4g1.396e-10651.20hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
back to top
BLAST of HNF4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNF4G4.793e-11252.02hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
HNF4G5.494e-11251.73hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
HNF4G9.157e-11252.65hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
HNF4A2.591e-11150.42hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
HNF4A3.243e-11150.42hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
back to top
BLAST of HNF4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnf4g1.798e-10852.45hepatocyte nuclear factor 4, gamma [Source:MGI Sym... [more]
Hnf4g5.097e-10852.45hepatocyte nuclear factor 4, gamma [Source:MGI Sym... [more]
Hnf4a6.082e-10853.82hepatic nuclear factor 4, alpha [Source:MGI Symbol... [more]
Hnf4a9.105e-10853.82hepatic nuclear factor 4, alpha [Source:MGI Symbol... [more]
Rxra1.725e-6436.72retinoid X receptor alpha [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of HNF4 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91766|HNF4A_XENLA1.545e-10950.42Hepatocyte nuclear factor 4-alpha OS=Xenopus laevi... [more]
sp|Q14541|HNF4G_HUMAN1.158e-10853.07Hepatocyte nuclear factor 4-gamma OS=Homo sapiens ... [more]
sp|P79926|HNF4B_XENLA5.492e-10849.86Hepatocyte nuclear factor 4-beta OS=Xenopus laevis... [more]
sp|Q9WUU6|HNF4G_MOUSE1.919e-10752.45Hepatocyte nuclear factor 4-gamma OS=Mus musculus ... [more]
sp|P41235|HNF4A_HUMAN3.162e-10751.45Hepatocyte nuclear factor 4-alpha OS=Homo sapiens ... [more]
back to top
BLAST of HNF4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203175160.000e+099.67tr|H8YS99|H8YS99_SCHMD HNF4 OS=Schmidtea mediterra... [more]
gnl|BL_ORD_ID|203424625.594e-11555.49tr|A0A1S3J4P6|A0A1S3J4P6_LINUN hepatocyte nuclear ... [more]
gnl|BL_ORD_ID|169869591.222e-11453.89tr|A0A1S3J5Z2|A0A1S3J5Z2_LINUN hepatocyte nuclear ... [more]
gnl|BL_ORD_ID|203085182.517e-11453.89tr|A0A1S3J492|A0A1S3J492_LINUN hepatocyte nuclear ... [more]
gnl|BL_ORD_ID|203047774.358e-11454.71tr|A0A1S3J4E8|A0A1S3J4E8_LINUN hepatocyte nuclear ... [more]
back to top
BLAST of HNF4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4a8.689e-11150.69hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
hnf4a1.254e-11051.12hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
hnf4g2.071e-10950.72hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
hnf4g3.531e-10852.10hepatocyte nuclear factor 4 gamma [Source:NCBI gen... [more]
hnf4b3.342e-8849.54hepatic nuclear factor 4, beta [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of HNF4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4g2.312e-9448.41hepatocyte nuclear factor 4, gamma [Source:ZFIN;Ac... [more]
nr2f1b2.791e-3530.33nuclear receptor subfamily 2, group F, member 1b [... [more]
ESR23.827e-3431.21estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
ESR21.148e-3330.48estrogen receptor 2 [Source:HGNC Symbol;Acc:HGNC:3... [more]
thrb4.496e-3228.21thyroid hormone receptor beta [Source:NCBI gene;Ac... [more]
back to top
BLAST of HNF4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of HNF4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464871.018e-10149.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376452.879e-5033.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383239.572e-4434.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327153.525e-4331.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383221.014e-4235.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of HNF4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnf4a3.605e-11250.69hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
hnf4a5.251e-11251.25hepatocyte nuclear factor 4 alpha [Source:NCBI gen... [more]
hnf4g3.396e-10552.57hepatocyte nuclear factor 4-gamma [Source:NCBI gen... [more]
hnf4g5.429e-10552.57hepatocyte nuclear factor 4-gamma [Source:NCBI gen... [more]
rxraa6.641e-6537.03retinoid X receptor alpha [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of HNF4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014588.12.307e-799.84SMESG000014588.1[more]
SMESG000056421.11.062e-4528.98SMESG000056421.1[more]
SMESG000019911.12.618e-4534.36SMESG000019911.1[more]
SMESG000078464.13.062e-2625.97SMESG000078464.1[more]
SMESG000023925.11.650e-2526.19SMESG000023925.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005748
GenBankAFF18489.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005748 ID=SMED30005748|Name=HNF4|organism=Schmidtea mediterranea sexual|type=transcript|length=3066bp
GAAGAATAACAAAGAAATTTATTGCCAAACTAAAATACCCGGCCTATTTC
ATCAAAAAAAAAACAATCAAAAACACAAATCGCTACGAAAACTTGTATAA
AAGATTCACATTAAAAGTCATCAATATTCCTCTTTTTTAAAGACTGATGA
TTCAGATTCTTGGATCCGAATGGGGTGATCTGTTAGGAAGTGAGCTGTTG
ACGAGATAGCTGAATAGTTTGATCTGGAATTGTGCTGTTGGTTCGCTTCC
GATGATCTGTTGGCGATTGATTGAATTTGGCAGTTTTCTATCGGCGAGTT
TGGAAGCGACTTGGTATAGGCCACAAGAAGCGACGGATCAACGACATTTT
GAGTGGAATTCACAGAAAGAGCTGGGTGGATTAGGTCATCTGAATTGGAA
GAATTTGAGCAGTTATGATTTGCGTCACTGTTATAGGCGTATTTTGACTG
GTTGATCATGGGGAACCCTTGATCAAGGTTGACCAAGAAATGGCTGGTAT
CCTGTGATAAATTGGAATGCTGATAAAGATTGATGGAATCATTGACGCAT
GAAAACAGAGAAGGAACGCCGACTCTTTCATTTTTCAGCATCATCCCATC
GCTGTTGATTATCATACCGAAGTTGCTATTGTCCTGGGAATTTTGCTGCA
TTATTTCAGTTCCTTGATTAACAAAAGCTCGATATATATTTCCTGAAGGC
ATCGACGTAGAACTTGGCAAATATGCACTCCATATTTTTGAGGCCGCTTC
AGGTGATATGTTTTGGTTGTTGATATTGAGTAGGACACTGTCTGGCATGA
AAGGGGGAATTCCGTAGCAGTCCTGGTAAGTATATTTCGGTGAGGAAATC
CTGTGGGAGTTAATTATATCCATGGAATCGTTTTGATTATTGTTATTGTT
CCCATCTGTTTCTGGATCTATGCTGAATACCCCTGGTGGATTGTCACCCA
ATAATGTTTCAGATAACAAGCTATCAATCTCGGCTAATCCTGTCATTTTC
ATGAACTCGACCTTCTTTACCATCAGCTGGGTGACCAATCTCAGATCAGG
AATTGTCAGCAGCAATTCCCCGAATCTACCCGGCTTGTGGTATTGCTTGT
CATTCATGTGGTTCATCAGGTCCATTTGTATTTGGTATCGGCATCGTCTC
ACGAACTCCTTGCCAGACTCGCTGACTCTCGGATCAAAAAATACGATCGC
TTTCAAACAAGCGAATTCTGCGTCATCCAATTGCAATTCTCGCAGCGGAA
TGAACAGGTCGTCAAGGATGTGACTGGCTATTTCAGCGAAATGTTTGTCA
CTGGAGTTCCTACTGATGATAAGATTGTTTCCCAATAATAGCACATCGTC
TTCGTCCAATTGAAACGACCGCCTTATTACTCCAAGAATTAGAATTTCTC
CCGCGTGTGCTTTTAAAAGGGAAATTTGATCGCTCAAGTTTAACTGTGAA
AAACAAGGCAAAGACTTTGCCCAATTCACTAGAAGAAATAACTGATTTTT
CATGGACTCGCAAACATCAGGCACATCGGCATATCTGTTCATGTATTCCT
GAGGATTCGGGGGCTTTTGTATTGCAACCCTTTGCTCGGCCTGCATCAAC
TGAGAAATGGAGAGAATGACATTCGGAGGAATATCATCAAACGACGATCT
TCGAGTACTGATCCTATCTCGTTCATTTTGAACCGCTGCTCGCTTCATTC
CTACAAGAATGCATTTCTTTAGCCGACAATAACGGCATTGGTTTCGTTTA
TCCTTGTCCATTTTACAATTCCGATTGTACTGGCAAGTGTAGTTATTCTT
CTTCCTCACTGACCTCCGAAAAAATCCTTTACAACCGTCACACGAGAAAG
CCCCATAATGTTTTCCTGTAGCTTTGTCACTGCAAATGAGACAGAGTTGA
TTGTTTTCCATTCCTTCTGGTCCCGACGCGTTAGACGCATAGACTTCATG
TTGTTGCGAGGACACTGAAACGAAAACTATTTGATAATATTTGTACAAAA
CAACTGACAGATGGTTTCGGAAAAGGTTCAATGTTCAGCCATAGTTCAGC
GAAAGGTCAAATTCCTGAACTACTATTTCAAGGTATAAATTTGAATATAT
TGGTTTTGCCTCGTGCTAACAAAGTCCAGAAATATAATAAGCAAAGTCTG
AATCGTGTACTTTGGATTTCTAGCCAGGGGCACACAATAACCTATATTTA
ATAGCAGTTCATTGCGTTCACTCGTTATTTCTCCGACTGAACTGCATTGC
AGGAGGATCCGCAACCATGGAGATTTCATAATTATTATCAAAATGATAAT
AATAATAATTATTATGAGGTATTGTAAAAGAAAACGTAACTCACTTTCAC
TTTCCAATGGATATTGCATCGAGGAAGCGTTGCTGGAAATGGAAATCGGA
GCTGAATTGCTAGTCAATAGTTGATAGGAGAATGCTGGATTGAGGTTCGG
ATGCTGGGTAGACGTCATATAGAATTGGCTCGACGGATTCGGTAAAATTA
TGGTGAAGTTTACAATCGAAGCTCAGATATAACGTATTATAATGAAGTAT
TATTAATAAACTGCAAGTAACGTGCGCGCATTCTGAAGTGGTTGATTGAG
AATAATCAGTTCTTATTCGACAAATTCAGATAAAAAAGGCACCACTCGAA
TTGTTCAGCTGCGTCATGTGAATGCCGGAACGTTGTGCGTTGGCTGTTGG
CAGATCAGCGCTCCGTGTTCACTGCAATCCGGATACACCAGACCACTTGA
AATCGTTGCGAATTCAGCGTGTCGAGTGCATTGTGCGAGATCAGTATCGG
TGTGTATGTGTGTCTGCCTGTGTGCGTGTGGATGTGTGTGCTTGTCGAGT
CGGTTGTGTGTTTATGAGTGTAACTGTGTCGATTTGGTCGAATGCAGTAG
CAGATAGCTGAAATGCGATTGTTCCTATTTTTCATTTAATATTGTTTTAT
GTTTTGTTTCTATTTTTATAATTTAATTTATCAGTTTTTGTTTAGATTAT
GCAATCATTGTTTAATTTATTTTTGTCAATTTAAAATTTATTATTAATTA
AATTATTATAATTATT
back to top

protein sequence of SMED30005748-orf-1

>SMED30005748-orf-1 ID=SMED30005748-orf-1|Name=SMED30005748-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=597bp
MENNQLCLICSDKATGKHYGAFSCDGCKGFFRRSVRKKNNYTCQYNRNCK
MDKDKRNQCRYCRLKKCILVGMKRAAVQNERDRISTRRSSFDDIPPNVIL
SISQLMQAEQRVAIQKPPNPQEYMNRYADVPDVCESMKNQLFLLVNWAKS
LPCFSQLNLSDQISLLKAHAGEILILGVIRRSFQLDEDDVLLLGNNLIIS
RNSSDKHFAEIASHILDDLFIPLRELQLDDAEFACLKAIVFFDPRVSESG
KEFVRRCRYQIQMDLMNHMNDKQYHKPGRFGELLLTIPDLRLVTQLMVKK
VEFMKMTGLAEIDSLLSETLLGDNPPGVFSIDPETDGNNNNNQNDSMDII
NSHRISSPKYTYQDCYGIPPFMPDSVLLNINNQNISPEAASKIWSAYLPS
STSMPSGNIYRAFVNQGTEIMQQNSQDNSNFGMIINSDGMMLKNERVGVP
SLFSCVNDSINLYQHSNLSQDTSHFLVNLDQGFPMINQSKYAYNSDANHN
CSNSSNSDDLIHPALSVNSTQNVVDPSLLVAYTKSLPNSPIENCQIQSIA
NRSSEANQQHNSRSNYSAISSTAHFLTDHPIRIQESESSVFKKEEY*
back to top

protein sequence of SMED30005748-orf-2

>SMED30005748-orf-2 ID=SMED30005748-orf-2|Name=SMED30005748-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MTSTQHPNLNPAFSYQLLTSNSAPISISSNASSMQYPLESESELRFLLQY
LIIIIIIIILIIIMKSPWLRILLQCSSVGEITSERNELLLNIGYCVPLAR
NPKYTIQTLLIIFLDFVSTRQNQYIQIYTLK*
back to top
Aliases
The feature 'HNF4' has the following synonyms
Synonym
hnf-4
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000120progenitor cell
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0003108gastrodermal cell
PLANA:0003116parenchymal cell
PLANA:0000058embryonic digestive system
PLANA:0000049digestive system
PLANA:0000039gamma neoblast
PLANA:0000026gut
PLANA:0000023embryonic pharynx
Vocabulary: INTERPRO
TermDefinition
IPR035500NHR-like_dom_sf
IPR001723Nuclear_hrmn_rcpt
IPR001628Znf_hrmn_rcpt
IPR000536Nucl_hrmn_rcpt_lig-bd
IPR013088Znf_NHR/GATA
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003707steroid hormone receptor activity
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0008270zinc ion binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0043401steroid hormone mediated signaling pathway
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000002Stage 2
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001723Nuclear hormone receptorPRINTSPR00398STRDHORMONERcoord: 68..78
score: 45.49
coord: 226..241
score: 47.14
coord: 136..157
score: 34.99
coord: 282..299
score: 29.8
coord: 157..173
score: 46.72
IPR001628Zinc finger, nuclear hormone receptor-typePRINTSPR00047STROIDFINGERcoord: 56..64
score: 62.02
coord: 7..23
score: 51.77
coord: 64..72
score: 60.32
coord: 23..38
score: 60.34
IPR001628Zinc finger, nuclear hormone receptor-typeSMARTSM00399c4goldcoord: 4..75
e-value: 5.3E-38
score: 142.3
IPR001628Zinc finger, nuclear hormone receptor-typePFAMPF00105zf-C4coord: 5..74
e-value: 8.7E-30
score: 103.0
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS00031NUCLEAR_REC_DBD_1coord: 7..33
IPR001628Zinc finger, nuclear hormone receptor-typePROSITEPS51030NUCLEAR_REC_DBD_2coord: 4..79
score: 21.136
IPR000536Nuclear hormone receptor, ligand-binding domainSMARTSM00430holicoord: 135..294
e-value: 3.6E-40
score: 149.5
IPR000536Nuclear hormone receptor, ligand-binding domainPFAMPF00104Hormone_recepcoord: 121..306
e-value: 6.8E-34
score: 117.3
IPR000536Nuclear hormone receptor, ligand-binding domainPROSITEPS51843NR_LBDcoord: 97..323
score: 50.946
IPR035500Nuclear hormone receptor-like domain superfamilyGENE3DG3DSA:1.10.565.10coord: 98..323
e-value: 4.1E-69
score: 234.5
IPR035500Nuclear hormone receptor-like domain superfamilySUPERFAMILYSSF48508Nuclear receptor ligand-binding domaincoord: 73..320
IPR013088Zinc finger, NHR/GATA-typeGENE3DG3DSA:3.30.50.10coord: 1..95
e-value: 8.1E-34
score: 117.9
NoneNo IPR availablePANTHERPTHR24083:SF42HEPATOCYTE NUCLEAR FACTOR 4-GAMMAcoord: 4..331
NoneNo IPR availablePANTHERPTHR24083NUCLEAR HORMONE RECEPTORcoord: 4..331
NoneNo IPR availableCDDcd06960NR_DBD_HNF4Acoord: 7..82
e-value: 4.57587E-45
score: 151.958
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 4..87