FGFR1 oncogene partner

Overview
NameFGFR1 oncogene partner
Smed IDSMED30005744
Length (bp)1060
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FGFR1 oncogene partner (SMED30005744) t-SNE clustered cells

Violin plots show distribution of expression levels for FGFR1 oncogene partner (SMED30005744) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FGFR1 oncogene partner (SMED30005744) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FGFR1 oncogene partner (SMED30005744) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005744

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005744SMESG000006505.1 dd_Smed_v4_5371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005744SMESG000006505.1 dd_Smed_v4_5371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30005744SMESG000006505.1 dd_Smed_v4_5371_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30005744SMESG000006505.1 dd_Smed_v4_5371_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FGFR1 oncogene partner vs. Ensembl Human
Match: FGFR1OP (FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGNC:17012])

HSP 1 Score: 69.3218 bits (168), Expect = 2.099e-12
Identity = 42/127 (33.07%), Postives = 71/127 (55.91%), Query Frame = 1
Query:   88 HNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
              D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   11 EEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQ-GLEGRENLARDL-GIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. Ensembl Human
Match: FGFR1OP (FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGNC:17012])

HSP 1 Score: 68.9366 bits (167), Expect = 2.168e-12
Identity = 42/125 (33.60%), Postives = 71/125 (56.80%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQ-GLEGRENLARDL-GIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. Ensembl Human
Match: FGFR1OP (FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGNC:17012])

HSP 1 Score: 68.9366 bits (167), Expect = 2.274e-12
Identity = 42/125 (33.60%), Postives = 71/125 (56.80%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQ-GLEGRENLARD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. Ensembl Zebrafish
Match: fgfr1op (FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-090417-1])

HSP 1 Score: 70.8626 bits (172), Expect = 4.871e-13
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 1
Query:   85 SHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            +  D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L   L+ DFLQ  NL  TL+VF+ E  +  LN  D   +L     +     +  SPLL   ++
Sbjct:    4 TEEDTELRDLLIQNLENSGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKSLNTKDGRLVAGLITDFLQVFNLDFTLAVFQPE--ISTLNGLDSREVLSKELGISESEVNKNSPLLLELVK 127          
BLAST of FGFR1 oncogene partner vs. Ensembl Zebrafish
Match: fgfr1op (FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-090417-1])

HSP 1 Score: 70.8626 bits (172), Expect = 4.895e-13
Identity = 45/128 (35.16%), Postives = 72/128 (56.25%), Query Frame = 1
Query:   85 SHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            +  D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L   L+ DFLQ  NL  TL+VF+ E  +  LN  D   +L     +     +  SPLL   ++
Sbjct:    4 TEEDTELRDLLIQNLENSGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKSLNTKDGRLVAGLITDFLQVFNLDFTLAVFQPE--ISTLNGLDSREVLSKELGISESEVNKNSPLLLELVK 127          
BLAST of FGFR1 oncogene partner vs. Ensembl Xenopus
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:549512])

HSP 1 Score: 65.855 bits (159), Expect = 2.834e-11
Identity = 45/134 (33.58%), Postives = 79/134 (58.96%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDS--KIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKS-PLLYSFLRXXXXXXKI 486
            D ELRDL+ + L   G++N++KA+LR+ V L L + + +  K P+ ++   ++  +N  +G+L  +L  +FLQ  NL  TL+VF+ EA +E    +DR+ + +  +  I ++E  KS PL    +R  +  +KI
Sbjct:    7 DTELRDLLIQTLENNGILNKIKAELRSSVFLALEEQEKTQNKTPLVNE--GLKKFLNTRDGRLVANLFTEFLQFFNLDFTLAVFQPEASLEN-GYDDRNHLAK--ELGIVESEGVKSGPLALELVRRCHQKDKI 135          
BLAST of FGFR1 oncogene partner vs. Ensembl Xenopus
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:549512])

HSP 1 Score: 65.4698 bits (158), Expect = 3.315e-11
Identity = 45/134 (33.58%), Postives = 79/134 (58.96%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDS--KIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKS-PLLYSFLRXXXXXXKI 486
            D ELRDL+ + L   G++N++KA+LR+ V L L + + +  K P+ ++   ++  +N  +G+L  +L  +FLQ  NL  TL+VF+ EA +E    +DR+ + +  +  I ++E  KS PL    +R  +  +KI
Sbjct:    7 DTELRDLLIQTLENNGILNKIKAELRSSVFLALEEQEKTQNKTPLVNE--GLKKFLNTRDGRLVANLFTEFLQFFNLDFTLAVFQPEASLEN-GYDDRNHLAK--ELGIVESEGVKSGPLALELVRRCHQKDKI 135          
BLAST of FGFR1 oncogene partner vs. Ensembl Mouse
Match: Fgfr1op (Fgfr1 oncogene partner [Source:MGI Symbol;Acc:MGI:1922546])

HSP 1 Score: 70.0922 bits (170), Expect = 7.830e-13
Identity = 43/125 (34.40%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF  E    +  L  R+++ Q+   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--NLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPETSTIQ-GLEGRENLAQD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. Ensembl Mouse
Match: Fgfr1op (Fgfr1 oncogene partner [Source:MGI Symbol;Acc:MGI:1922546])

HSP 1 Score: 69.707 bits (169), Expect = 9.210e-13
Identity = 43/125 (34.40%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF  E    +  L  R+++ Q+   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--NLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPETSTIQ-GLEGRENLAQD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Match: sp|Q66JX5|FR1OP_MOUSE (FGFR1 oncogene partner OS=Mus musculus OX=10090 GN=Fgfr1op PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 6.442e-12
Identity = 43/125 (34.40%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF  E    +  L  R+++ Q+   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--NLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPETSTIQ-GLEGRENLAQD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Match: sp|O95684|FR1OP_HUMAN (FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=FGFR1OP PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.008e-11
Identity = 42/127 (33.07%), Postives = 71/127 (55.91%), Query Frame = 1
Query:   88 HNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
              D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   11 EEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQ-GLEGRENLARDL-GIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Match: sp|Q4R7V3|FR1OP_MACFA (FGFR1 oncogene partner OS=Macaca fascicularis OX=9541 GN=FGFR1OP PE=2 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.031e-11
Identity = 42/125 (33.60%), Postives = 71/125 (56.80%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTLQ-GLEGRENLARDL-GIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Match: sp|Q4V7C1|FR1OP_RAT (FGFR1 oncogene partner OS=Rattus norvegicus OX=10116 GN=Fgfr1op PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 1.775e-11
Identity = 42/125 (33.60%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELRDL+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF  E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   13 DTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFHPETSTIQ-GLEGRENLARD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Match: sp|Q2YDD1|FR1OP_BOVIN (FGFR1 oncogene partner OS=Bos taurus OX=9913 GN=FGFR1OP PE=2 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.840e-10
Identity = 41/125 (32.80%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   94 DAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            D ELR L+ + L   G++N +KA+LRA V L L + +  ++K P+ ++   ++  +N  +G+L  SLV +FLQ  NL  TL+VF+ E    +  L  R+++ ++   +I        PLL   +R
Sbjct:   13 DTELRYLLVQTLENSGVLNRIKAELRAAVFLALEEQEKVENKTPLVNE--SLKKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETSTFQ-GLEGRENLARD-LGIIEAEGTVGGPLLLEVIR 133          
BLAST of FGFR1 oncogene partner vs. TrEMBL
Match: A0A4Y2ADX1 (FGFR1 oncogene partner OS=Araneus ventricosus OX=182803 GN=FGFR1OP PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.130e-13
Identity = 49/128 (38.28%), Postives = 73/128 (57.03%), Query Frame = 1
Query:   85 SHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKD--SKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            +  + ELRDLI + L   G +N++KA+LRAGVLL   +++   SKIP+++  KK    +   +GKL  SLV++FL+  NL  T+SVF+ E       LN  D  L    N+   N D   P++ + LR
Sbjct:    3 AEGETELRDLIIQNLEACGFLNKIKAELRAGVLLAFEEERSLRSKIPLFN--KKFDEFMEKKDGKLVVSLVREFLEYFNLNFTISVFDPEIATSSPCLNRTD--LCKELNL--KNSDFDGPVISALLR 124          
BLAST of FGFR1 oncogene partner vs. TrEMBL
Match: A0A0P6F9S5 (FGFR1 oncogene partner (Fragment) OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.485e-12
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELE 348
            MS EE    D ELRDLI + L   G++ +L+AQLRA   L L Q +DSK+   +    +Q  V+   G +  SL++DFL   NL+ TL+VF+ E
Sbjct:    1 MSTEE----DPELRDLIAKSLENNGVLGKLRAQLRASTFLALDQQEDSKVTFPNSNSAVQEFVSTKHGAITMSLIRDFLTLFNLQFTLAVFDPE 90          
BLAST of FGFR1 oncogene partner vs. TrEMBL
Match: A0A164KTY9 (LisH domain-containing protein FOPNL OS=Daphnia magna OX=35525 GN=APZ42_033714 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.819e-12
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELE 348
            MS EE    D ELRDLI + L   G++ +L+AQLRA   L L Q +DSK+   +    +Q  V+   G +  SL++DFL   NL+ TL+VF+ E
Sbjct:    1 MSTEE----DPELRDLIAKSLENNGVLGKLRAQLRASTFLALDQQEDSKVTFPNSNSAVQEFVSTKHGAITMSLIRDFLTLFNLQFTLAVFDPE 90          
BLAST of FGFR1 oncogene partner vs. TrEMBL
Match: A0A0P6GNS1 (FGFR1 oncogene partner OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.006e-12
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELE 348
            MS EE    D ELRDLI + L   G++ +L+AQLRA   L L Q +DSK+   +    +Q  V+   G +  SL++DFL   NL+ TL+VF+ E
Sbjct:    1 MSTEE----DPELRDLIAKSLENNGVLGKLRAQLRASTFLALDQQEDSKVTFPNSNSAVQEFVSTKHGAITISLIRDFLTLFNLQFTLAVFDPE 90          
BLAST of FGFR1 oncogene partner vs. TrEMBL
Match: A0A0P5LMF5 (FGFR1 oncogene partner OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.168e-12
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELE 348
            MS EE    D ELRDLI + L   G++ +L+AQLRA   L L Q +DSK+   +    +Q  V+   G +  SL++DFL   NL+ TL+VF+ E
Sbjct:   23 MSTEE----DPELRDLIAKSLENNGVLGKLRAQLRASTFLALDQQEDSKVTFPNSNSAVQEFVSTKHGAITMSLIRDFLTLFNLQFTLAVFDPE 112          
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:103033038])

HSP 1 Score: 71.2478 bits (173), Expect = 3.596e-13
Identity = 53/137 (38.69%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   64 KMSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELN-LNDRDSILQNHQNVINDNEDCKS-PLLYSFLR 462
            KMS  E    D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L  SL+ DFLQ  NL  TL+VF+ E  +  LN L+ R+S+ +  +  ++++E  KS PLL   ++
Sbjct:   40 KMSATE---EDTELRDLLIQNLENNGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKCLNTKDGRLVASLITDFLQVFNLDFTLAVFQPE--INTLNGLDGRESLFR--ELGLSESEGNKSTPLLLEVIK 167          
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:103033038])

HSP 1 Score: 71.2478 bits (173), Expect = 3.740e-13
Identity = 53/137 (38.69%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   64 KMSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELN-LNDRDSILQNHQNVINDNEDCKS-PLLYSFLR 462
            KMS  E    D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L  SL+ DFLQ  NL  TL+VF+ E  +  LN L+ R+S+ +  +  ++++E  KS PLL   ++
Sbjct:   40 KMSATE---EDTELRDLLIQNLENNGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKCLNTKDGRLVASLITDFLQVFNLDFTLAVFQPE--INTLNGLDGRESLFR--ELGLSESEGNKSTPLLLEVIK 167          
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:103033038])

HSP 1 Score: 71.2478 bits (173), Expect = 3.752e-13
Identity = 53/137 (38.69%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   64 KMSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELN-LNDRDSILQNHQNVINDNEDCKS-PLLYSFLR 462
            KMS  E    D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L  SL+ DFLQ  NL  TL+VF+ E  +  LN L+ R+S+ +  +  ++++E  KS PLL   ++
Sbjct:   40 KMSATE---EDTELRDLLIQNLENNGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKCLNTKDGRLVASLITDFLQVFNLDFTLAVFQPE--INTLNGLDGRESLFR--ELGLSESEGNKSTPLLLEVIK 167          
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:103033038])

HSP 1 Score: 71.2478 bits (173), Expect = 3.943e-13
Identity = 53/137 (38.69%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   64 KMSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELN-LNDRDSILQNHQNVINDNEDCKS-PLLYSFLR 462
            KMS  E    D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L  SL+ DFLQ  NL  TL+VF+ E  +  LN L+ R+S+ +  +  ++++E  KS PLL   ++
Sbjct:   40 KMSATE---EDTELRDLLIQNLENNGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKCLNTKDGRLVASLITDFLQVFNLDFTLAVFQPE--INTLNGLDGRESLFR--ELGLSESEGNKSTPLLLEVIK 167          
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Match: fgfr1op (FGFR1 oncogene partner [Source:NCBI gene;Acc:103033038])

HSP 1 Score: 70.8626 bits (172), Expect = 4.562e-13
Identity = 53/137 (38.69%), Postives = 85/137 (62.04%), Query Frame = 1
Query:   64 KMSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTL-SQDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELN-LNDRDSILQNHQNVINDNEDCKS-PLLYSFLR 462
            KMS  E    D ELRDL+ + L   G++N++KA+LRA V L L  QDK ++K P+ ++   ++  +N  +G+L  SL+ DFLQ  NL  TL+VF+ E  +  LN L+ R+S+ +  +  ++++E  KS PLL   ++
Sbjct:   40 KMSATE---EDTELRDLLIQNLENNGVLNKIKAELRAAVFLALEEQDKVENKTPLVNE--NLKKCLNTKDGRLVASLITDFLQVFNLDFTLAVFQPE--INTLNGLDGRESLFR--ELGLSESEGNKSTPLLLEVIK 167          
BLAST of FGFR1 oncogene partner vs. Ensembl Sea Lamprey
Match: fgfr1op (FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-090417-1])

HSP 1 Score: 72.7886 bits (177), Expect = 1.628e-14
Identity = 48/134 (35.82%), Postives = 77/134 (57.46%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDK--DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLR 462
            MS EE    D ELRDL+ + L   G++N++KA+LRA V L L + +   +K P+ ++  +++N +N+ +G L  SLV +FLQ  NL  TL+VF  E     + L+DR  + Q    ++  +    +PLL   L+
Sbjct:    8 MSAEE----DTELRDLLVQTLEGNGVLNKIKAELRAAVFLALEEQEAVQNKTPLVNE--QLKNFLNSKDGLLIASLVTEFLQFFNLDFTLAVFTPETNT-AIGLDDRGGLTQK-LGIVETDSTKSAPLLLEILK 133          
BLAST of FGFR1 oncogene partner vs. Ensembl Nematostella
Match: EDO38339 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD82])

HSP 1 Score: 66.2402 bits (160), Expect = 3.100e-12
Identity = 41/120 (34.17%), Postives = 67/120 (55.83%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDS--KIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAG-----------VEELNLNDRDS 387
            MS +E    D ELRDL+ + L   G++ +++AQLRA V L L + + +  KIP+ +    ++  ++ +EG+L   LV++FL+   L  T++VF+ E+              ELNL D DS
Sbjct:    1 MSTDE----DTELRDLVAQSLESKGVLGKIRAQLRASVFLALEEQEGAENKIPLTN--GNLKKFISTSEGRLVAGLVREFLEFFELDFTIAVFDPESNFSDKYQGRNNLANELNLPDSDS 114          
BLAST of FGFR1 oncogene partner vs. Ensembl Medaka
Match: ENSORLT00000022728.2 (FGFR1 oncogene partner [Source:NCBI gene;Acc:101167012])

HSP 1 Score: 68.1662 bits (165), Expect = 2.680e-12
Identity = 43/144 (29.86%), Postives = 81/144 (56.25%), Query Frame = 1
Query:   85 SHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLS-QDK-DSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRXXXXXXKINDLSDKEI 510
            + +D ELRDL+ + L   G++N++KA++RA V L +  QD+ ++K+P+ ++   ++  +N+ +G+LA + + DFLQ  +L  +L+VF  E  +   N  D   ++     + +   D  SPLL   LR      +  +LS  ++
Sbjct:    4 AEDDTELRDLVIQNLENSGVLNKMKAEMRAAVFLAMEDQDRLENKVPLVNE--SLKKCLNSRDGRLAVAFIVDFLQVFSLDFSLAVFLPE--INSPNGVDSREVVCRELGLRDSEVDKSSPLLLELLRTAPRPPQQQELSQNQL 143          
BLAST of FGFR1 oncogene partner vs. Planmine SMEST
Match: SMESG000006505.1 (SMESG000006505.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 303/303 (100.00%), Postives = 303/303 (100.00%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRXXXXXXKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNLDRTSSTTRIPKFMSNSQKTSINSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNXXXXXXXXXXXXXXXXXXXXNGDITIDSERSLSLDYMEIA 975
            MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRNNNNNNKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNLDRTSSTTRIPKFMSNSQKTSINSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNDDKSDDESIKEEIDERSESRNGDITIDSERSLSLDYMEIA
Sbjct:    1 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRNNNNNNKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNLDRTSSTTRIPKFMSNSQKTSINSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNDDKSDDESIKEEIDERSESRNGDITIDSERSLSLDYMEIA 303          
BLAST of FGFR1 oncogene partner vs. Planmine SMEST
Match: SMESG000006505.1 (SMESG000006505.1)

HSP 1 Score: 491.5 bits (1264), Expect = 1.630e-176
Identity = 282/303 (93.07%), Postives = 282/303 (93.07%), Query Frame = 1
Query:   67 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRXXXXXXKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNLDRTSSTTRIPKFMSNSQKTSINSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNXXXXXXXXXXXXXXXXXXXXNGDITIDSERSLSLDYMEIA 975
            MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRNNNNNNKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNL                     NSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNDDKSDDESIKEEIDERSESRNGDITIDSERSLSLDYMEIA
Sbjct:    1 MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKIPIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEELNLNDRDSILQNHQNVINDNEDCKSPLLYSFLRNNNNNNKINDLSDKEIIRGSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKNL---------------------NSEKIFNAYQTQPKHNSKGSMSNDISYEETFSDKSSSTKHNDDKSDDESIKEEIDERSESRNGDITIDSERSLSLDYMEIA 282          
The following BLAST results are available for this feature:
BLAST of FGFR1 oncogene partner vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
FGFR1OP2.099e-1233.07FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGN... [more]
FGFR1OP2.168e-1233.60FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGN... [more]
FGFR1OP2.274e-1233.60FGFR1 oncogene partner [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fgfr1op4.871e-1335.16FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-0... [more]
fgfr1op4.895e-1335.16FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fgfr1op2.834e-1133.58FGFR1 oncogene partner [Source:NCBI gene;Acc:54951... [more]
fgfr1op3.315e-1133.58FGFR1 oncogene partner [Source:NCBI gene;Acc:54951... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Fgfr1op7.830e-1334.40Fgfr1 oncogene partner [Source:MGI Symbol;Acc:MGI:... [more]
Fgfr1op9.210e-1334.40Fgfr1 oncogene partner [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of FGFR1 oncogene partner vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q66JX5|FR1OP_MOUSE6.442e-1234.40FGFR1 oncogene partner OS=Mus musculus OX=10090 GN... [more]
sp|O95684|FR1OP_HUMAN1.008e-1133.07FGFR1 oncogene partner OS=Homo sapiens OX=9606 GN=... [more]
sp|Q4R7V3|FR1OP_MACFA1.031e-1133.60FGFR1 oncogene partner OS=Macaca fascicularis OX=9... [more]
sp|Q4V7C1|FR1OP_RAT1.775e-1133.60FGFR1 oncogene partner OS=Rattus norvegicus OX=101... [more]
sp|Q2YDD1|FR1OP_BOVIN1.840e-1032.80FGFR1 oncogene partner OS=Bos taurus OX=9913 GN=FG... [more]
back to top
BLAST of FGFR1 oncogene partner vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Y2ADX11.130e-1338.28FGFR1 oncogene partner OS=Araneus ventricosus OX=1... [more]
A0A0P6F9S51.485e-1242.55FGFR1 oncogene partner (Fragment) OS=Daphnia magna... [more]
A0A164KTY91.819e-1242.55LisH domain-containing protein FOPNL OS=Daphnia ma... [more]
A0A0P6GNS12.006e-1242.55FGFR1 oncogene partner OS=Daphnia magna OX=35525 P... [more]
A0A0P5LMF52.168e-1242.55FGFR1 oncogene partner OS=Daphnia magna OX=35525 P... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr1op3.596e-1338.69FGFR1 oncogene partner [Source:NCBI gene;Acc:10303... [more]
fgfr1op3.740e-1338.69FGFR1 oncogene partner [Source:NCBI gene;Acc:10303... [more]
fgfr1op3.752e-1338.69FGFR1 oncogene partner [Source:NCBI gene;Acc:10303... [more]
fgfr1op3.943e-1338.69FGFR1 oncogene partner [Source:NCBI gene;Acc:10303... [more]
fgfr1op4.562e-1338.69FGFR1 oncogene partner [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fgfr1op1.628e-1435.82FGFR1 oncogene partner [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383393.100e-1234.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000022728.22.680e-1229.86FGFR1 oncogene partner [Source:NCBI gene;Acc:10116... [more]
back to top
BLAST of FGFR1 oncogene partner vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000006505.10.000e+0100.00SMESG000006505.1[more]
SMESG000006505.11.630e-17693.07SMESG000006505.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005744 ID=SMED30005744|Name=FGFR1 oncogene partner|organism=Schmidtea mediterranea sexual|type=transcript|length=1060bp
TTTAAACTTTATTTTAATACATTGCCTTGGATACATTTGTTTATATTTAA
TTTTGATTAATATAAAATGTCTAATGAAGAACTTTCTCATAATGATGCTG
AATTGAGAGATCTTATTACTGAAAGATTATCGAAATTGGGATTAATTAAC
GAACTAAAAGCACAACTGAGAGCTGGCGTTTTACTAACATTATCACAAGA
TAAAGATAGTAAAATTCCAATTTACGACCAGAAAAAGAAAATTCAGAATA
TTGTTAATAATGCCGAAGGCAAACTTGCTTTTTCATTAGTCAAAGATTTT
TTACAGCAGTTAAACTTGAAACATACATTATCAGTTTTTGAATTAGAAGC
TGGTGTAGAAGAATTAAACTTGAATGATCGAGACTCCATATTACAGAATC
ACCAAAACGTCATTAATGACAACGAGGACTGTAAATCACCGTTGTTATAC
AGCTTTCTGAGAAATAATAATAATAATAATAAAATTAATGATCTTTCGGA
TAAAGAAATAATCAGGGGATCAATGACAAATGGAACAACAAAGAATAAAA
GAATACTGCCAAGTGTAATGGATAATAAAGAAAAGGATCGAATTAGTTAC
AAATCGGATGATTCCAGCGACTTTAGTGAAACAATCGACATGCCGGATTT
ATCAGATAAGAAAAATTTGGATAGAACATCCAGTACAACTCGAATTCCTA
AATTCATGTCTAACAGTCAAAAGACCTCAATAAATTCCGAAAAAATATTC
AACGCATATCAAACTCAACCTAAGCATAATAGTAAAGGATCTATGAGCAA
TGACATTTCATATGAGGAAACGTTCAGTGATAAATCTTCCTCGACTAAAC
ACAATGATGATAAATCAGATGATGAAAGTATCAAGGAAGAGATTGATGAA
CGAAGCGAATCTCGGAATGGAGACATCACAATTGACTCAGAAAGAAGCCT
CTCACTTGATTATATGGAAATTGCCAAGAAGAAATAATAAAACATAATCA
TTTCTTGTGTTCCGTTAATTTATTATTATTTTATAATATAATTTCTTGAT
ATCAAAAAAA
back to top

protein sequence of SMED30005744-orf-1

>SMED30005744-orf-1 ID=SMED30005744-orf-1|Name=SMED30005744-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MSNEELSHNDAELRDLITERLSKLGLINELKAQLRAGVLLTLSQDKDSKI
PIYDQKKKIQNIVNNAEGKLAFSLVKDFLQQLNLKHTLSVFELEAGVEEL
NLNDRDSILQNHQNVINDNEDCKSPLLYSFLRNNNNNNKINDLSDKEIIR
GSMTNGTTKNKRILPSVMDNKEKDRISYKSDDSSDFSETIDMPDLSDKKN
LDRTSSTTRIPKFMSNSQKTSINSEKIFNAYQTQPKHNSKGSMSNDISYE
ETFSDKSSSTKHNDDKSDDESIKEEIDERSESRNGDITIDSERSLSLDYM
EIAKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0019901protein kinase binding
GO:0030292protein tyrosine kinase inhibitor activity
GO:0042803protein homodimerization activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR018993FOP_dimerisation-dom_N
IPR006594LisH
Vocabulary: biological process
TermDefinition
GO:0034453microtubule anchoring
GO:0006469negative regulation of protein kinase activity
GO:0008284positive regulation of cell proliferation
GO:0030307positive regulation of cell growth
GO:0030335positive regulation of cell migration
GO:0061099negative regulation of protein tyrosine kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005815microtubule organizing center
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005856cytoskeleton
GO:0048471perinuclear region of cytoplasm