Actin-related protein 2/3 complex subunit

Overview
NameActin-related protein 2/3 complex subunit
Smed IDSMED30005741
Length (bp)1387
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-related protein 2/3 complex subunit (SMED30005741) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-related protein 2/3 complex subunit (SMED30005741) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-related protein 2/3 complex subunit (SMED30005741) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-related protein 2/3 complex subunit (SMED30005741) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005741

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30005741SMESG000062666.1 Contig3501GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005741SMESG000062666.1 Contig3501GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005741SMESG000015778.1 Contig3501GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005741SMESG000015778.1 Contig3501GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005741SMESG000015778.1 Contig1955GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005741SMESG000015778.1 Contig1955GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30005741SMESG000015778.1 dd_Smed_v4_978_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Match: ARPC1A (actin related protein 2/3 complex subunit 1A [Source:HGNC Symbol;Acc:HGNC:703])

HSP 1 Score: 313.538 bits (802), Expect = 3.495e-103
Identity = 163/374 (43.58%), Postives = 238/374 (63.64%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  L+ E    G  GWVH V+FS  G++L W +H S + +A    S Q   V T+  E LP+L++ + +  +V+ AGHDC P    + D   L F + LD  ++ +   ++SA  +F+N+D+ AT E  N+ + + H+N+I ++ I +    + +   T G DG + +WD KTL   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKK---NGSQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRLAWVSHDSTVSVADASKSVQ---VSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDIPKQ-SIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Match: ARPC1B (actin related protein 2/3 complex subunit 1B [Source:HGNC Symbol;Acc:HGNC:704])

HSP 1 Score: 312.383 bits (799), Expect = 1.293e-102
Identity = 156/379 (41.16%), Postives = 236/379 (62.27%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CLA  D   +   V T+  E LP+L L + T+ +++ AGHDC P  +T       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADAD---KKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQ-SSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 371          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Match: ARPC1B (actin related protein 2/3 complex subunit 1B [Source:HGNC Symbol;Acc:HGNC:704])

HSP 1 Score: 312.383 bits (799), Expect = 1.293e-102
Identity = 156/379 (41.16%), Postives = 236/379 (62.27%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CLA  D   +   V T+  E LP+L L + T+ +++ AGHDC P  +T       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADAD---KKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQ-SSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 371          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Match: ARPC1B (actin related protein 2/3 complex subunit 1B [Source:HGNC Symbol;Acc:HGNC:704])

HSP 1 Score: 312.383 bits (799), Expect = 1.293e-102
Identity = 156/379 (41.16%), Postives = 236/379 (62.27%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CLA  D   +   V T+  E LP+L L + T+ +++ AGHDC P  +T       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADAD---KKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQ-SSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 371          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Match: ARPC1B (actin related protein 2/3 complex subunit 1B [Source:HGNC Symbol;Acc:HGNC:704])

HSP 1 Score: 312.383 bits (799), Expect = 1.293e-102
Identity = 156/379 (41.16%), Postives = 236/379 (62.27%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CLA  D   +   V T+  E LP+L L + T+ +++ AGHDC P  +T       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADAD---KKMAVATLASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQ-SSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 371          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Celegans
Match: arx-3 (Actin-related protein 2/3 complex subunit [Source:UniProtKB/TrEMBL;Acc:Q9U1R7])

HSP 1 Score: 289.271 bits (739), Expect = 3.966e-94
Identity = 159/358 (44.41%), Postives = 215/358 (60.06%), Query Frame = 1
Query:   52 FGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE-SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            FG   I CH++N + T++AVS +SND+ IF   E   G +  +H L EH   V  +DWG K +RIVSCS D+NA+VW     +WKP LV+++ NRAAT+V+WSPLENKFAVGS AKL+SVC ++  ND+W+SK +K+ I ST+TCLDWH +N ++A GS DF  RVF AY+K  D     + WG K+ F  L+ E S G  GWVH VAFS  G +L + +H S++    VD +     V+ +   +LP  T+ W T  +V+ AGHDC P       + LK    LD      ++T  SA   F+NIDR    E  N  + + H+N I +I    G VG     +T G DG + LWDLK
Sbjct:   12 FGIGPITCHAWNKDRTQIAVSASSNDIHIF---EWRNGDWQSIHTLSEHDLPVTGLDWGTKTNRIVSCSQDKNAFVWTFDKNVWKPELVLVRFNRAATYVKWSPLENKFAVGSGAKLVSVCYYEKENDWWVSKQIKKPIRSTVTCLDWHSNNVLLAVGSCDFKCRVFSAYVKEVDEKPSPNPWGQKMPFGQLMSEYSVG--GWVHRVAFSPSGCRLAFVSHDSSVSF--VDSTVDSQKVQNLLTIHLPFTTVEWITENSVVTAGHDCSPVLFVVSQDVLKEVCKLDVPSAAKSSTVNSALQLFKNIDRNNAAEKINVALKTLHQNRITQILPHSGTVGNVVKFTTCGTDGIVALWDLK 362          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Celegans
Match: arx-3 (Actin-related protein 2/3 complex subunit [Source:UniProtKB/TrEMBL;Acc:Q9U1R7])

HSP 1 Score: 288.886 bits (738), Expect = 6.894e-94
Identity = 159/358 (44.41%), Postives = 215/358 (60.06%), Query Frame = 1
Query:   52 FGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE-SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            FG   I CH++N + T++AVS +SND+ IF   E   G +  +H L EH   V  +DWG K +RIVSCS D+NA+VW     +WKP LV+++ NRAAT+V+WSPLENKFAVGS AKL+SVC ++  ND+W+SK +K+ I ST+TCLDWH +N ++A GS DF  RVF AY+K  D     + WG K+ F  L+ E S G  GWVH VAFS  G +L + +H S++    VD +     V+ +   +LP  T+ W T  +V+ AGHDC P       + LK    LD      ++T  SA   F+NIDR    E  N  + + H+N I +I    G VG     +T G DG + LWDLK
Sbjct:   12 FGIGPITCHAWNKDRTQIAVSASSNDIHIF---EWRNGDWQSIHTLSEHDLPVTGLDWGTKTNRIVSCSQDKNAFVWTFDKNVWKPELVLVRFNRAATYVKWSPLENKFAVGSGAKLVSVCYYEKENDWWVSKQIKKPIRSTVTCLDWHSNNVLLAVGSCDFKCRVFSAYVKEVDEKPSPNPWGQKMPFGQLMSEYSVG--GWVHRVAFSPSGCRLAFVSHDSSVSF--VDSTVDSQKVQNLLTIHLPFTTVEWITENSVVTAGHDCSPVLFVVSQDVLKEVCKLDVPSAAKSSTVNSALQLFKNIDRNNAAEKINVALKTLHQNRITQILPHSGTVGNVVKFTTCGTDGIVALWDLK 362          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Celegans
Match: pfs-2 (Polyadenylation Factor Subunit homolog [Source:UniProtKB/TrEMBL;Acc:U4PN22])

HSP 1 Score: 53.1434 bits (126), Expect = 3.320e-7
Identity = 50/182 (27.47%), Postives = 78/182 (42.86%), Query Frame = 1
Query:  169 FSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQL-----NRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLM 699
            F+F   LQ H + +R++ W   E  ++S   D+  YV     K W+P +    +     + A   + ++P + KFA  S      V  F      +  + + R   + + C+DWHP   +IA GS D    V     KS          GS LA    L E +     V +V F+K+GN L+
Sbjct:  176 FNFETILQAHDSAIRALKWASNEQWLLSA--DQGGYV-----KYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFAR----YTEERVLRGHGAEVRCIDWHPTKGLIATGSRDTQQPVKIWDPKS----------GSCLA---TLQEHKSS---VMAVEFNKNGNWLL 330          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Fly
Match: Arpc1 (gene:FBgn0001961 transcript:FBtr0080570)

HSP 1 Score: 272.322 bits (695), Expect = 2.402e-87
Identity = 150/371 (40.43%), Postives = 228/371 (61.46%), Query Frame = 1
Query:   34 MAYIHKFGQ--VSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDK-IWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRL----GWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            MA  + FG    SI CH++N + T++A+S N++++ I+         +     L +H   V  IDW K  +RIVSC+ DRNAYVW + D   WKP LV+L++NRAAT V+WSP ENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+T LDWHP+N ++  GS+D+ VRVF A++K  + P   + WG++     L+ E         GW++SV+FS DGN++ W  H S  C++  D ++   V+R      LP L+  W +  +V+ AG+ C+P     T + +L     LD K +   ++ I+A   FQ++DR    E+ +++++S H+NAI  +R+  G    A  +ST G DGQLV+W+++
Sbjct:    1 MAETYTFGTSLASITCHAWNKDRTQIALSPNNHEIHIYSRE---GSDWKLADVLNQHDLRVMGIDWAKNTNRIVSCAADRNAYVWTQGDDGKWKPALVLLRINRAATCVKWSPAENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVTSLDWHPNNVLLLAGSTDYKVRVFSAFIKDIEEPPTPTPWGNRKPLGQLMAEFRNSQTSGGGWINSVSFSSDGNKVCWVGHDS--CVSIADATNGNTVIR-CRTGYLPFLSCEWVSPTSVVVAGYSCVPLLYSLTADGKLVLSGKLD-KSQKKESSGITAMRIFQSMDRNMRTENTDTVVDSIHQNAITSVRLYAGDKASATKVSTSGVDGQLVIWNVE 364          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Fly
Match: Arpc1 (gene:FBgn0001961 transcript:FBtr0080569)

HSP 1 Score: 272.322 bits (695), Expect = 2.402e-87
Identity = 150/371 (40.43%), Postives = 228/371 (61.46%), Query Frame = 1
Query:   34 MAYIHKFGQ--VSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDK-IWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRL----GWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            MA  + FG    SI CH++N + T++A+S N++++ I+         +     L +H   V  IDW K  +RIVSC+ DRNAYVW + D   WKP LV+L++NRAAT V+WSP ENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+T LDWHP+N ++  GS+D+ VRVF A++K  + P   + WG++     L+ E         GW++SV+FS DGN++ W  H S  C++  D ++   V+R      LP L+  W +  +V+ AG+ C+P     T + +L     LD K +   ++ I+A   FQ++DR    E+ +++++S H+NAI  +R+  G    A  +ST G DGQLV+W+++
Sbjct:    1 MAETYTFGTSLASITCHAWNKDRTQIALSPNNHEIHIYSRE---GSDWKLADVLNQHDLRVMGIDWAKNTNRIVSCAADRNAYVWTQGDDGKWKPALVLLRINRAATCVKWSPAENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVTSLDWHPNNVLLLAGSTDYKVRVFSAFIKDIEEPPTPTPWGNRKPLGQLMAEFRNSQTSGGGWINSVSFSSDGNKVCWVGHDS--CVSIADATNGNTVIR-CRTGYLPFLSCEWVSPTSVVVAGYSCVPLLYSLTADGKLVLSGKLD-KSQKKESSGITAMRIFQSMDRNMRTENTDTVVDSIHQNAITSVRLYAGDKASATKVSTSGVDGQLVIWNVE 364          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Match: arpc1b (actin related protein 2/3 complex, subunit 1B [Source:ZFIN;Acc:ZDB-GENE-030131-7414])

HSP 1 Score: 317.39 bits (812), Expect = 8.460e-105
Identity = 161/376 (42.82%), Postives = 238/376 (63.30%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+         ++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW      WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LISVC F+ +ND+W+ KH+K+ I STI CLDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  +++ES G  GWVH V FS  GN++ W++H S + +A      +  V  ++  E LP+L + + T  +++ AGHDC P     D+N   L FG  LD  ++ +A   ++A+ +FQN+D+ AT ES  +++ S HKN+I++I +L G   +     T G DG + +WD+KTL   + +LKI
Sbjct:    1 MAY-HSFLLEPISCHAWNKDRTQIALCPNNHEVHIY---NKAGNNWNKIHVLKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGDAWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISVCYFEQDNDWWVCKHIKKPIRSTILCLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEEKPAPTAWGSKMPFGEVMFESTGTSGWVHGVCFSDSGNRVAWASHDSTVAVAE---GGKTAVCTSLTSETLPLLCVTFITENSLVAAGHDCYPVLFVYDSNNAALSFGGKLDVPKQ-SAQKGMTARERFQNLDKKATTESKEAVLESLHKNSISQISLLDGGKAKCSKFCTTGMDGGMTIWDVKTLESAMKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Match: arpc1b (actin related protein 2/3 complex, subunit 1B [Source:ZFIN;Acc:ZDB-GENE-030131-7414])

HSP 1 Score: 317.39 bits (812), Expect = 8.460e-105
Identity = 161/376 (42.82%), Postives = 238/376 (63.30%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+         ++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW      WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LISVC F+ +ND+W+ KH+K+ I STI CLDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  +++ES G  GWVH V FS  GN++ W++H S + +A      +  V  ++  E LP+L + + T  +++ AGHDC P     D+N   L FG  LD  ++ +A   ++A+ +FQN+D+ AT ES  +++ S HKN+I++I +L G   +     T G DG + +WD+KTL   + +LKI
Sbjct:    1 MAY-HSFLLEPISCHAWNKDRTQIALCPNNHEVHIY---NKAGNNWNKIHVLKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGDAWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISVCYFEQDNDWWVCKHIKKPIRSTILCLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEEKPAPTAWGSKMPFGEVMFESTGTSGWVHGVCFSDSGNRVAWASHDSTVAVAE---GGKTAVCTSLTSETLPLLCVTFITENSLVAAGHDCYPVLFVYDSNNAALSFGGKLDVPKQ-SAQKGMTARERFQNLDKKATTESKEAVLESLHKNSISQISLLDGGKAKCSKFCTTGMDGGMTIWDVKTLESAMKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Match: arpc1a (actin related protein 2/3 complex, subunit 1A [Source:ZFIN;Acc:ZDB-GENE-040116-1])

HSP 1 Score: 316.235 bits (809), Expect = 2.169e-104
Identity = 164/374 (43.85%), Postives = 237/374 (63.37%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++  +H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E    G  GWVHSV FS  GN+L W +H S + +     S  P  ++T   E L +L++ + +   ++ AGHDC P    F D   L F + LD  ++ +   +ISA  +F+N+D+ AT E  NS + + H+N+I ++ I +G   + +   T G DG + +WD KTL   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIAISPNNHEVHIYKK---SGNQWVKVHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPAPTPWGSKMPFGQVMTEFGGAGSGGWVHSVCFSASGNRLAWVSHDSTVTVVDPTISSTPSQLKT---EFLALLSVTFVSENNIVAAGHDCCPMLFSFDDGGTLTFTSKLDIPKQ-SIQRNISAMERFRNMDKRATTEDRNSTLETLHQNSITQVSIYEGDKRDCRKFCTTGIDGAMTIWDFKTLESSIQGLRI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Match: zgc:86896 (zgc:86896 [Source:ZFIN;Acc:ZDB-GENE-040625-80])

HSP 1 Score: 310.842 bits (795), Expect = 2.519e-102
Identity = 155/364 (42.58%), Postives = 243/364 (66.76%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLT 1131
            ++ FG   + CH++N + T++A+S NS+DV I+++   GK  +  +H L EH+  +  IDW  + +RIV+C++DRNAYVW   D +WKPTLV++++NRAAT V+WSPLENKFA+GS AKLIS+C F+  ND+W+SKH+K+ INST+  LDWHP+N ++A GS+D H R+F AY+K  +     + WGSK+ F  LL E +   GWVHSV FS  G+ L W +H+SAI +A  D S Q   V  +   +LP+L++++ +   ++ AGHDC PY   +     L+F   +D  ++ ++  ++SA   F+N+D+ AT E  ++ + S H+N+I ++ IL+G+  + +  S++G DG +V+WD K  +
Sbjct:    3 LYSFGLEPLSCHAWNKDRTQIAISPNSSDVHIYQMN--GK-EWIKIHELTEHSGRITGIDWAPESNRIVTCASDRNAYVWTLKDGVWKPTLVLVRINRAATCVKWSPLENKFALGSGAKLISICYFEKENDWWLSKHIKKPINSTVLSLDWHPNNMLLAAGSADLHCRIFSAYIKDIEDRPGPTPWGSKMPFGELLLEYKECGGWVHSVCFSPSGDSLAWVSHNSAINVA--DAS-QGKEVTQLTTRHLPLLSVLYVSETEIVAAGHDCCPYQFSYKGPGSLEFVKKVDIPKQ-SSKGNMSAMQHFRNLDKKATTEEEDTGLGSLHQNSITQLCILEGLKAKVEKFSSVGLDGAMVVWDFKVFS 359          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Match: zgc:86896 (zgc:86896 [Source:ZFIN;Acc:ZDB-GENE-040625-80])

HSP 1 Score: 309.686 bits (792), Expect = 5.679e-102
Identity = 155/361 (42.94%), Postives = 242/361 (67.04%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            ++ FG   + CH++N + T++A+S NS+DV I+++   GK  +  +H L EH+  +  IDW  + +RIV+C++DRNAYVW   D +WKPTLV++++NRAAT V+WSPLENKFA+GS AKLIS+C F+  ND+W+SKH+K+ INST+  LDWHP+N ++A GS+D H R+F AY+K  +     + WGSK+ F  LL E +   GWVHSV FS  G+ L W +H+SAI +A  D S Q   V  +   +LP+L++++ +   ++ AGHDC PY   +     L+F   +D  ++ ++  ++SA   F+N+D+ AT E  ++ + S H+N+I ++ IL+G+  + +  S++G DG +V+WD K
Sbjct:    3 LYSFGLEPLSCHAWNKDRTQIAISPNSSDVHIYQMN--GK-EWIKIHELTEHSGRITGIDWAPESNRIVTCASDRNAYVWTLKDGVWKPTLVLVRINRAATCVKWSPLENKFALGSGAKLISICYFEKENDWWLSKHIKKPINSTVLSLDWHPNNMLLAAGSADLHCRIFSAYIKDIEDRPGPTPWGSKMPFGELLLEYKECGGWVHSVCFSPSGDSLAWVSHNSAINVA--DAS-QGKEVTQLTTRHLPLLSVLYVSETEIVAAGHDCCPYQFSYKGPGSLEFVKKVDIPKQ-SSKGNMSAMQHFRNLDKKATTEEEDTGLGSLHQNSITQLCILEGLKAKVEKFSSVGLDGAMVVWDFK 356          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Match: parp14.4 (poly (ADP-ribose) polymerase family, member 14, gene 4 [Source:Xenbase;Acc:XB-GENE-5998663])

HSP 1 Score: 317.39 bits (812), Expect = 1.142e-104
Identity = 162/376 (43.09%), Postives = 239/376 (63.56%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A   NS+DV I+K       +++ +H L+EH   V  IDW    +RIV+C TDRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GSSDF  R+F AY+K  +     + WGSK+ F  L++ES    GWVHSV FS  G+++ W +H S IC+A  D   +  V  +I  + LP+L L + T  +++ AGHDC P  Y+       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ ++NN  ++S HKN+I++I +L G   +     T G DG + +WD+K L   + +LKI
Sbjct:    1 MAY-HSFLLEPITCHAWNKDATQIAFCPNSHDVHIYKK---DGDKWTKIHELKEHNGQVTGIDWAPDSNRIVTCGTDRNAYVWTLRNNVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSSDFKSRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHSVCFSHSGDRMAWVSHDSTICIA--DAPKKMRVTTSI-TDTLPLLCLTFITENSLVAAGHDCYPVLYSYVEAQGTLSFGGKLDIPKQ-SSQRGMTARERFQNLDKKASSDTNNVTLDSLHKNSISQISVLSGGKAKCSKFCTTGLDGGMCIWDVKILESAMKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Match: slco4a1 (solute carrier organic anion transporter family member 4A1 [Source:Xenbase;Acc:XB-GENE-5905026])

HSP 1 Score: 310.842 bits (795), Expect = 4.064e-102
Identity = 163/372 (43.82%), Postives = 240/372 (64.52%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEG--RLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISEL 1149
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E  G    GWVHSV+FS  GN+L W +H S + +A  D S    V + +  E LP+L++I+ +  +++ AGHDC P    + ++  L F + LD  ++ T   +ISA  +F+N+D+ AT E  N+ + + H+N+I ++ I  G   + +   T G DG + +WD K   +R+S L
Sbjct:    3 LHQFLLEPISCHAWNKDLTQIAISPNNHEVHIYKK---SGNQWVKGHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMSEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVA--DASKNMSVSQ-LKTEFLPLLSVIFVSENSLVAAGHDCCPMLFTYDEHGSLTFVSKLDIPKQSTQR-NISAMERFRNMDKRATAEDRNTTLETLHQNSITQVSIYDGDKTDCRKFCTTGIDGAMTIWDFK---ERLSHL 364          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Match: parp14.4 (poly (ADP-ribose) polymerase family, member 14, gene 4 [Source:Xenbase;Acc:XB-GENE-5998663])

HSP 1 Score: 310.842 bits (795), Expect = 6.159e-102
Identity = 159/367 (43.32%), Postives = 234/367 (63.76%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTL 1128
            MAY H F    I CH++N + T++A   NS+DV I+K       +++ +H L+EH   V  IDW    +RIV+C TDRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GSSDF  R+F AY+K  +     + WGSK+ F  L++ES    GWVHSV FS  G+++ W +H S IC+A  D   +  V  +I  + LP+L L + T  +++ AGHDC P  Y+       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ ++NN  ++S HKN+I++I +L G   +     T G DG + +WD+K L
Sbjct:    1 MAY-HSFLLEPITCHAWNKDATQIAFCPNSHDVHIYKK---DGDKWTKIHELKEHNGQVTGIDWAPDSNRIVTCGTDRNAYVWTLRNNVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSSDFKSRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHSVCFSHSGDRMAWVSHDSTICIA--DAPKKMRVTTSI-TDTLPLLCLTFITENSLVAAGHDCYPVLYSYVEAQGTLSFGGKLDIPKQ-SSQRGMTARERFQNLDKKASSDTNNVTLDSLHKNSISQISVLSGGKAKCSKFCTTGLDGGMCIWDVKYL 359          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Match: slco4a1 (solute carrier organic anion transporter family member 4A1 [Source:Xenbase;Acc:XB-GENE-5905026])

HSP 1 Score: 309.686 bits (792), Expect = 1.242e-101
Identity = 160/365 (43.84%), Postives = 236/365 (64.66%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEG--RLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTL 1128
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E  G    GWVHSV+FS  GN+L W +H S + +A  D S    V + +  E LP+L++I+ +  +++ AGHDC P    + ++  L F + LD  ++ T   +ISA  +F+N+D+ AT E  N+ + + H+N+I ++ I  G   + +   T G DG + +WD K +
Sbjct:    3 LHQFLLEPISCHAWNKDLTQIAISPNNHEVHIYKK---SGNQWVKGHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMSEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVA--DASKNMSVSQ-LKTEFLPLLSVIFVSENSLVAAGHDCCPMLFTYDEHGSLTFVSKLDIPKQSTQR-NISAMERFRNMDKRATAEDRNTTLETLHQNSITQVSIYDGDKTDCRKFCTTGIDGAMTIWDFKVI 360          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Match: slco4a1 (solute carrier organic anion transporter family member 4A1 [Source:Xenbase;Acc:XB-GENE-5905026])

HSP 1 Score: 309.686 bits (792), Expect = 1.449e-101
Identity = 160/365 (43.84%), Postives = 236/365 (64.66%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEG--RLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTL 1128
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E  G    GWVHSV+FS  GN+L W +H S + +A  D S    V + +  E LP+L++I+ +  +++ AGHDC P    + ++  L F + LD  ++ T   +ISA  +F+N+D+ AT E  N+ + + H+N+I ++ I  G   + +   T G DG + +WD K +
Sbjct:    3 LHQFLLEPISCHAWNKDLTQIAISPNNHEVHIYKK---SGNQWVKGHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMSEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVA--DASKNMSVSQ-LKTEFLPLLSVIFVSENSLVAAGHDCCPMLFTYDEHGSLTFVSKLDIPKQSTQR-NISAMERFRNMDKRATAEDRNTTLETLHQNSITQVSIYDGDKTDCRKFCTTGIDGAMTIWDFKVI 360          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Match: Arpc1a (actin related protein 2/3 complex, subunit 1A [Source:MGI Symbol;Acc:MGI:1928896])

HSP 1 Score: 317.39 bits (812), Expect = 8.191e-105
Identity = 165/374 (44.12%), Postives = 239/374 (63.90%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       +++  H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D IWKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  L+ E    G  GWVH V+FS  GN+L W +H S + +A    S Q   +RT   E LP+L++ + +  +V+ AGHDC P    + D   L F + LD  ++ +   ++SA  +F+N+D+ AT E  N+ + + H+N+I ++ I +    + +   T G DG + +WD KTL   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKK---NGSQWTKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGNRLAWVSHDSTVSVADASKSVQVSTLRT---EFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDVPKQ-SIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Match: Arpc1b (actin related protein 2/3 complex, subunit 1B [Source:MGI Symbol;Acc:MGI:1343142])

HSP 1 Score: 309.301 bits (791), Expect = 1.128e-101
Identity = 155/379 (40.90%), Postives = 234/379 (61.74%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CL   D   +   V T+  E LP+L + + T  +++ AGHDC P     DN    L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWNKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLVDAD---KKMAVATLASETLPLLAVTFITENSLVAAGHDCFPVLFTYDNAAVTLSFGGRLDVPKQ-SSQRGMTARERFQNLDKKASSEGGAATGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 371          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Match: Arpc1b (actin related protein 2/3 complex, subunit 1B [Source:MGI Symbol;Acc:MGI:1343142])

HSP 1 Score: 307.375 bits (786), Expect = 9.476e-101
Identity = 155/380 (40.79%), Postives = 233/380 (61.32%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPV-VRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXX---XKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N+++V I+   E    +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW    + WKPTLVIL++NRAA  VRW+P ENKFAVGS +++IS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  L++ES    GWVH V FS  G+++ W +H S +CL   D        V T+  E LP+L + + T  +++ AGHDC P     DN    L FG  LD  ++ ++   ++A+ +FQN+D+ A+ E   +      S HKN++++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLVEPISCHAWNKDRTQIAICPNNHEVHIY---EKSGAKWNKVHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLVDADKKMALSFSVATLASETLPLLAVTFITENSLVAAGHDCFPVLFTYDNAAVTLSFGGRLDVPKQ-SSQRGMTARERFQNLDKKASSEGGAATGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKI 375          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Match: Arpc1a (actin related protein 2/3 complex, subunit 1A [Source:MGI Symbol;Acc:MGI:1928896])

HSP 1 Score: 249.98 bits (637), Expect = 5.508e-80
Identity = 122/239 (51.05%), Postives = 164/239 (68.62%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQ 753
            +H+F    I CH++N + T++A+S N+++V I+K       +++  H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D IWKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  L+ E    G  GWVH V+FS  GN+L W +H S + +A    S Q
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKK---NGSQWTKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGNRLAWVSHDSTVSVADASKSVQ 238          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Match: Arpc1a (actin related protein 2/3 complex, subunit 1A [Source:MGI Symbol;Acc:MGI:1928896])

HSP 1 Score: 160.614 bits (405), Expect = 2.391e-47
Identity = 75/136 (55.15%), Postives = 102/136 (75.00%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISK 450
            +H+F    I CH++N + T++A+S N+++V I+K       +++  H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D IWKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SK
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKK---NGSQWTKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSK 135          
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Match: sp|Q8AVT9|AR1AA_XENLA (Actin-related protein 2/3 complex subunit 1A-A OS=Xenopus laevis OX=8355 GN=arpc1a-a PE=1 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 3.506e-105
Identity = 168/374 (44.92%), Postives = 241/374 (64.44%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEG--RLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E  G    GWVHSV+FS  GN+L W +H S + +A  D S    V + +  E LP+L++I+ +  ++I AGHDC P    + ++  L F + LD  ++ T   +ISA  +F+N+D+ AT E  N+ + + H+N+I ++ I  G   E +   T G DG + +WD KTL   I  LKI
Sbjct:    3 LHQFLLEPISCHAWNKDLTQIAISPNNHEVHIYKK---SGDQWVKGHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMAEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVA--DASKNMSVSQ-LKTEFLPLLSVIFVSENSLIAAGHDCCPMLFTYDEHGSLTFVSKLDIPKQSTQR-NISAMERFRNMDKRATTEDRNTTLETLHQNSITQVSIYDGDKTECRKFCTTGIDGAMTIWDFKTLESYIQGLKI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Match: sp|A0A1L8EXB5|AR1AB_XENLA (Actin-related protein 2/3 complex subunit 1A-B OS=Xenopus laevis OX=8355 GN=arpc1a-b PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 8.248e-105
Identity = 169/375 (45.07%), Postives = 243/375 (64.80%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEG--RLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E  G    GWVHSV+FS  GN+L W +H S + +A  D S    V + +  E LP+L++I+ +  ++I AGHDC P  +FT + Q  L F + LD  ++ T   +ISA  +F+N+D+ AT E  N+ + + H+N+I ++ I  G   + +   T G DG + +WD KTL   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNKDLTQIAISPNNHEVHIYKN---SGNQWVKCHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKTRVFSAYIKEVDEKPASTPWGSKMPFGQMMAEFGGVSSGGWVHSVSFSASGNKLAWVSHDSTVSVA--DASKNMSVSQ-LKTEFLPLLSVIFVSENSLIAAGHDCCPM-LFTYDEQGSLTFVSKLDIPKQSTQR-NISAMERFRNMDKRATTEDRNTTLETLHQNSITQVSIYDGDKTDCRKFCTTGIDGAMTIWDFKTLESYIQGLRI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Match: sp|Q9R0Q6|ARC1A_MOUSE (Actin-related protein 2/3 complex subunit 1A OS=Mus musculus OX=10090 GN=Arpc1a PE=1 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 5.729e-104
Identity = 165/374 (44.12%), Postives = 239/374 (63.90%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       +++  H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D IWKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  L+ E    G  GWVH V+FS  GN+L W +H S + +A    S Q   +RT   E LP+L++ + +  +V+ AGHDC P    + D   L F + LD  ++ +   ++SA  +F+N+D+ AT E  N+ + + H+N+I ++ I +    + +   T G DG + +WD KTL   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKK---NGSQWTKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGNRLAWVSHDSTVSVADASKSVQVSTLRT---EFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCLTFVSKLDVPKQ-SIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWDFKTLESSIQGLRI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Match: sp|Q6GNU1|AR1BB_XENLA (Actin-related protein 2/3 complex subunit 1B-B OS=Xenopus laevis OX=8355 GN=arpc1b-b PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.291e-103
Identity = 161/376 (42.82%), Postives = 242/376 (64.36%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MA+ H F    I CH++N + T++A   NS+DV I+K   V   +++ +H L+EH   V  IDW  + +RIV+C TDRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GSSDF  R+F +Y+K  +     + WGSK+ F  L++ES    GWVHSV FS  G+++ W +H S IC+A  D + +  V   I  + LP+L + + T  +++ AGHDC P  YT       L FG  LD  ++ ++   ++A+ +FQN+D+ A+ ++NN  ++S HKN+I++I +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAF-HSFLLEPITCHAWNKDATQIAFCPNSHDVHIYKKDGV---KWTKIHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLRNNVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSSDFKSRIFSSYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHSVCFSNSGDRMAWVSHDSTICIA--DATKKMRVTSLI-TDTLPLLCVTFITENSLVAAGHDCYPVLYTYDEAQGTLSFGGKLDVPKQ-SSQRGMTARERFQNLDKKASSDTNNITLDSLHKNSISQISVLSGGKAKCSKFCTTGLDGGMCIWDVKSLESALKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Match: sp|Q7ZXD5|AR1BA_XENLA (Actin-related protein 2/3 complex subunit 1B-A OS=Xenopus laevis OX=8355 GN=arpc1b-a PE=2 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.552e-103
Identity = 161/376 (42.82%), Postives = 241/376 (64.10%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A   NS+DV I+K       ++S +H L+EH   V  IDW  + +RIV+C TDRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I ST+  LDWHP+N ++A GSSDF  R+F AY+K  +     + WGSK+ F  L++ES    GWVHSV FS  G+++ W +H S IC++  D + +  V   I  + LP+L + + T  +++ AGHDC P     D  Q  L FG  LD  ++ ++   ++A+ +FQN+D+ A+ ++NN  ++S HKN+I+++ +L G   +     T G DG + +WD+K+L   + +LKI
Sbjct:    1 MAY-HSFLLEPITCHAWNKDATQIAFCPNSHDVHIYKK---DGDKWSKIHELKEHNGHVTGIDWAPESNRIVTCGTDRNAYVWTLKNNVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSSDFKSRIFSAYIKEVEERPAPTPWGSKMPFGELMFESSSSCGWVHSVCFSHSGDRMAWVSHDSTICIS--DATKKMRVTSLI-TDTLPLLCVTFITENSLVAAGHDCFPVLYIYDEAQGTLSFGGKLDIPKQ-SSQRGMTARERFQNLDKKASSDTNNITLDSLHKNSISQLSVLSGGKAKCSKFCTTGLDGGMCIWDVKSLESAMKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Match: A0A564Y9D0 (Actin-related protein 2/3 complex subunit OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4312 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 2.027e-118
Identity = 178/379 (46.97%), Postives = 260/379 (68.60%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARS-DKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWES-EGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ---LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MA  +  G  +++CH+FN + T MA+S+N+N+V+I  VP+    +F  +  L+EHTA V  +DW    ++IVSCS DRNAYVW ++ +  WKPTLV LQLNRAA  V+WSP  +KFAVGS +K++S+C F+   D+W+SKH+K+N+ STITC+DWHP+N +IACGS+D+ VRVF A +K  D+   +S WG K  F SLL+E+  G   W+HSV FS DGN+L W  H  ++ +A     + PPVV+TI ++ LP+L++IW    T++GAGHDC P  +F  N     +  G  +D K E    + +SA  KFQ+IDR+AT ++ ++ +++ H+N+INE+ ILKG   +A  +++IGRDGQLV+WDL +L  +I+ L I
Sbjct:    1 MAKSYWIGNDALVCHAFNKDATLMAISINTNNVYILSVPQTSGDKFKLVDTLKEHTALVMGLDWCSASNQIVSCSADRNAYVWKQTPEGKWKPTLVALQLNRAALCVQWSPKGDKFAVGSGSKVVSICFFEQEQDWWVSKHIKKNLKSTITCVDWHPNNTLIACGSTDYRVRVFSAVIKEIDSEGSDSVWGPKSPFQSLLFEAYAGHGTWIHSVRFSSDGNKLAWVGHDCSVSIADASAGN-PPVVQTIRIQCLPLLSVIWVAPNTILGAGHDCCPI-LFNYNGPTGGISAGTMIDLKNENQGESKLSAMRKFQHIDRMATTDTTDARLSTIHQNSINELAILKGNRSKAVQVTSIGRDGQLVIWDLVSLPSQIAGLSI 377          
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Match: A0A0R3UKM4 (Actin-related protein 2/3 complex subunit OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8155 PE=3 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.417e-117
Identity = 175/378 (46.30%), Postives = 258/378 (68.25%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARS-DKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWES-EGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MA  +  G  +++CH+FN + + MAVS+N+N+V+I  VP     RF  +  L+EH+A V  IDW    ++IVSCS DRNAYVW ++ +  WKPTLV LQLNRAA  VRWSPL NKFAVGS +K++SVC F+   D+W+SKH+K+ + ST+TC+DWHP+NN++ACGS+D+ VRVF A +K  D+   +S WG K  F +LL+E+  G   W+HS+ FS DGN+L W+ H  ++ +A       PPVV+TI  + LP+ + +W    +V+ AGHDC P     +  Q  +  G S+D K E  A +++SA  KFQ+IDR+AT ++  + +++ H+N+INE+ IL+G   +A  +S+IGRDGQLV+W++ +L+ +I+ L I
Sbjct:    1 MAKAYWIGNDALVCHAFNKDASLMAVSINTNNVYILSVPRSSGERFKLVDTLKEHSALVMGIDWSPTTNQIVSCSADRNAYVWKQTREGKWKPTLVALQLNRAAVCVRWSPLGNKFAVGSGSKVVSVCFFEQEQDWWVSKHIKKGLKSTVTCVDWHPNNNILACGSTDYRVRVFSAVIKEVDSEGADSIWGPKSPFQTLLFEAYNGHGSWIHSICFSADGNKLAWTGHDCSLSIADASNG-SPPVVQTIRHQFLPLTSCMWIAPSSVLAAGHDCCPILFKYNGPQGGISEGKSIDIKNESQAESTLSAMRKFQHIDRMATTDTTGARLSTIHQNSINELCILEGNRSKASQVSSIGRDGQLVVWNMVSLSSQIAGLTI 377          
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Match: A0A0R3WHW9 (Actin-related protein 2/3 complex subunit OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS159 PE=3 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 6.695e-117
Identity = 171/378 (45.24%), Postives = 257/378 (67.99%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARS-DKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWES-EGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIP--YTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MA     G  +++CH+FN + + MA+S+N+++V+I  VP+    RF  +  L+EH+A V  IDW    ++IVSCS DRNAYVW +S D  WKPTLV LQ+NRAA  V+WSPL NKFAVGS ++++SVC F+   D+W+ K +K+ + STITC+DWHP+N ++ACGS+D+HVRVF A++K  D+  ++S WG+K  F +LL+E+  G   W+HSV FS DGN+L W+ H+ ++ +A   G+ +PPVVRTI  + LP+L+ +W    +V+GAGHDC P  +  +     +  G   + K E      +SA  +FQNIDR+AT ++ ++ + + H+N+INE+ I+KG   +   +++IGRDGQLV+WD+ +L   I+ L I
Sbjct:    1 MANPFWIGNDALVCHAFNKDASLMAISINTSNVYILSVPKSPSDRFKLVDTLKEHSALVMGIDWCASSNQIVSCSADRNAYVWKQSSDGKWKPTLVALQINRAALCVKWSPLGNKFAVGSGSRIVSVCFFEKEQDWWVPKQIKKVMKSTITCVDWHPNNTILACGSADYHVRVFSAFIKETDSEDRDSAWGAKSPFQTLLFEAYNGHGSWIHSVCFSADGNKLAWTGHNCSLSIADA-GAGKPPVVRTISTQYLPLLSCVWVGQNSVLGAGHDCCPILFNYYGSEKGISEGKMFNVKSESQDAPKVSALRRFQNIDRMATTDNTDTRLTTIHQNSINELCIMKGDRSKTIQVTSIGRDGQLVIWDMVSLPSLIAGLTI 377          
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Match: A0A0R3SV99 (Actin-related protein 2/3 complex subunit OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9486 PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 3.151e-114
Identity = 175/379 (46.17%), Postives = 257/379 (67.81%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARS-DKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWES-EGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ---LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MA  +  G  +++CH+FN + T MA+S+N+N+V+I  VP+    +F  +  L+EHTA V  +DW    ++IVSCS DRNAYVW ++ +  WKPTL    LNRAA  V+WSP  +KFAVGS +K++S+C F+   D+W+SKH+K+N+ STITC+DWHP+N +IACGS+D+ VRVF A +K  D+   +S WG K  F SLL+E+  G   W+HSV FS DGN+L W  H  ++ +A     + PPVV+TI ++ LP+L++IW    T++GAGHDC P  +F  N     +  G  +D K E    + +SA  KFQ+IDR+AT ++ ++ +++ H+N+INE+ ILKG   +A  +++IGRDGQLV+WDL +L  +I+ L I
Sbjct:    1 MAKSYWIGNDALVCHAFNKDATLMAISINTNNVYILSVPQTSGDKFKLVDTLKEHTALVMGLDWCSASNQIVSCSADRNAYVWKQTPEGKWKPTL----LNRAALCVQWSPKGDKFAVGSGSKVVSICFFEQEQDWWVSKHIKKNLKSTITCVDWHPNNTLIACGSTDYRVRVFSAVIKEIDSEGSDSVWGPKSPFQSLLFEAYAGHGTWIHSVRFSSDGNKLAWVGHDCSVSIADASAGN-PPVVQTIRIQCLPLLSVIWVAPNTILGAGHDCCPI-LFNYNGPTGGISAGTMIDLKNENQGESKLSAMRKFQHIDRMATTDTTDARLSTIHQNSINELAILKGNRSKAVQVTSIGRDGQLVIWDLVSLPSQIAGLSI 373          
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Match: H2KSG4 (Actin-related protein 2/3 complex subunit OS=Clonorchis sinensis OX=79923 GN=CLF_109242 PE=3 SV=1)

HSP 1 Score: 350.132 bits (897), Expect = 3.841e-114
Identity = 179/385 (46.49%), Postives = 253/385 (65.71%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWAR-SDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLL---WESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQ-------PPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            M   H  G  S++ H+FNG+ + +AVSVN++DV++  VP+    ++  +  L+EHTA V  IDW  K +RIVSCS DRNAYVW + SD  WKPTLV+L ++RA+  VRWSPLE+ FAVGS  KL++VCSFD   D+W+SKH+K+N  ST+TCLDWHP+N V+ACGSSDFH+RV+ A LKS D+   +S WGS  +  SLL   +E EG  GWV   +FS DGN+L+W+ H+S + +A V  +         P VV     E LP ++ +W    T + AG+DC PY      + ++F   LD +++   +  ++A  KFQ+IDR+AT ++ +S + + H+N INE+RI  G    A  +S+IGRDG LV WDL +L ++IS+L I
Sbjct:    1 MTSAHAIGNDSLVSHAFNGDGSLLAVSVNTSDVYLLHVPKSPGNKWQIVDVLKEHTALVTGIDWAPKSNRIVSCSADRNAYVWTKQSDGKWKPTLVVLMIDRASICVRWSPLEDSFAVGSGCKLVAVCSFDQELDWWVSKHIKKNFKSTVTCLDWHPNNAVLACGSSDFHMRVYSARLKSGDS---QSAWGSHSSLGSLLFDHYECEG--GWVLGASFSADGNKLVWTKHNSLVFVADVSDTSSSRGAKCGPAVVTCYRSEFLPFISCLWVGPSTFLCAGYDCCPYAFRYSADGVQFVHQLDVRDQSRVSEKLTAMKKFQDIDRMATTDNTSSRLATVHQNCINELRIYSGDRKMASRVSSIGRDGYLVFWDLPSLCKQISQLSI 380          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Match: arpc1b (actin related protein 2/3 complex subunit 1B [Source:NCBI gene;Acc:103027911])

HSP 1 Score: 318.546 bits (815), Expect = 2.428e-105
Identity = 158/376 (42.02%), Postives = 238/376 (63.30%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N++DV I+K        ++  H L+EH   V  IDW  + +RIV+C TDRNAYVW     +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LISVC F+  ND+W+ KH+K+ I STI CLDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  +++ES G  GWVH V FS  GN++ W++H S + +A      +  VV ++  E LP+L + + T  +++ AGHDC P     D  +  + FG  LD  ++ +A   ++A+ +FQN+D+ AT ++  +++ S HKN+I++I +L G   +     T G DG + +WD+K++   + +LKI
Sbjct:    1 MAY-HSFLLEPISCHAWNKDRTQIALCPNNHDVHIYKK---AGNSWTKTHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGDVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISVCYFEQENDWWVCKHIKKPIRSTILCLDWHPNNILLAAGSCDFKCRIFSAYIKEVEEKPAPTPWGSKMPFGEVMFESTGTAGWVHGVCFSDSGNRVAWASHDSTVAVAE---GGKSAVVTSLTSETLPLLCVTFITENSLVAAGHDCYPALFVYDAGKGAITFGGKLDVPKQ-SAQKGMTARERFQNLDKKATSDTKEAVLESLHKNSISQISLLDGGKAKCTKFCTTGMDGGMAIWDVKSIESAMKDLKI 368          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Match: arpc1b (actin related protein 2/3 complex subunit 1B [Source:NCBI gene;Acc:103027911])

HSP 1 Score: 318.546 bits (815), Expect = 5.768e-105
Identity = 158/376 (42.02%), Postives = 237/376 (63.03%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            MAY H F    I CH++N + T++A+  N++DV I+K        ++  H L+EH   V  IDW  + +RIV+C TDRNAYVW     +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LISVC F+  ND+W+ KH+K+ I STI CLDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  +++ES G  GWVH V FS  GN++ W++H S + +A      +  VV ++  E LP+L + + T  +++ AGHDC P     D  +  + FG  LD  ++ +A   ++A+ +FQN+D+ AT ++  +++ S HKN+I++I +L G   +     T G DG + +WD+K L   + EL++
Sbjct:    1 MAY-HSFLLEPISCHAWNKDRTQIALCPNNHDVHIYKK---AGNSWTKTHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGDVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISVCYFEQENDWWVCKHIKKPIRSTILCLDWHPNNILLAAGSCDFKCRIFSAYIKEVEEKPAPTPWGSKMPFGEVMFESTGTAGWVHGVCFSDSGNRVAWASHDSTVAVAE---GGKSAVVTSLTSETLPLLCVTFITENSLVAAGHDCYPALFVYDAGKGAITFGGKLDVPKQ-SAQKGMTARERFQNLDKKATSDTKEAVLESLHKNSISQISLLDGGKAKCTKFCTTGMDGGMAIWDVKPLESSVGELRL 368          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Match: arpc1a (actin related protein 2/3 complex, subunit 1A [Source:ZFIN;Acc:ZDB-GENE-040116-1])

HSP 1 Score: 317.005 bits (811), Expect = 1.461e-103
Identity = 164/374 (43.85%), Postives = 236/374 (63.10%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ D +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGSK+ F  ++ E    G  GWVHSV FS  GN+L W +H S + +     S  P  ++T   E L +L++ + +   ++ AGHDC P    F D   L F + LD  ++ +   +ISA  +F+N+D+ AT E  NS + + H+N+I ++ I +G   + +   T G DG + +WD KTL   I  L+I
Sbjct:   95 LHQFLLEPITCHAWNRDRTQIAISPNNHEVHIYKK---SGNQWVKAHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPAPTPWGSKMPFGQVMAEFGGAGSGGWVHSVCFSASGNRLAWVSHDSTVTVVDPTKSSTPSPLKT---EFLALLSVTFVSENNIVAAGHDCCPMLFSFDDGGTLTFISKLDIPKQ-SIQRNISAMERFRNMDKRATTEDRNSTLETLHQNSITQVSIYEGDKRDCRKFCTTGIDGAMTIWDFKTLESSIQGLRI 461          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Match: zgc:86896 (actin-related protein 2/3 complex subunit 1A-like [Source:NCBI gene;Acc:103021341])

HSP 1 Score: 311.612 bits (797), Expect = 7.895e-103
Identity = 155/362 (42.82%), Postives = 241/362 (66.57%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGR-FSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            ++ FG   + CH++N + T++AVS NS+ V I++     KG+ +S +H L+EH+  +  IDW  + +RIV+C++DRNAYVW   D +WKPTLV++++NRAAT V+WSP ENKFA+GS AKLISVC F+  ND+W+SKH+K+ I ST+  LDWHP+N ++A GS+D H RVF AY+K  +     ++WG+K+ F  +L E +   GWVHSVAFS  G+ L W +H+SAI +A    + Q   V  +  E LP+L++++     ++ AGHDC PY   +    +L F   L   ++ T+  S+SA   F+N+D+ AT +  ++ +N+ H+N+I ++ +++G   + +  S++G DG LVLWD+K
Sbjct:    3 LYSFGLEPLSCHAWNKDRTQIAVSPNSSTVIIYQ----KKGKEWSKIHELKEHSGRITGIDWAPESNRIVTCASDRNAYVWTLKDGVWKPTLVLVRINRAATCVKWSPQENKFALGSGAKLISVCYFEKENDWWLSKHIKKGICSTVLSLDWHPNNILLAAGSADLHCRVFSAYIKEIEDKPGPTSWGAKMPFGEVLLEQKDVGGWVHSVAFSPSGDSLAWVSHNSAISVAD---AAQGKEVTQLTTEYLPLLSVLYVNETEIVAAGHDCCPYQFSYMGPGKLDFVKKLGISKQ-TSKNSMSAMQHFRNLDKKATTDEEDNELNTLHQNSITQLCVVEGQKAKVEKFSSVGLDGALVLWDVK 356          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Match: arpc1b (actin related protein 2/3 complex subunit 1B [Source:NCBI gene;Acc:103027911])

HSP 1 Score: 310.842 bits (795), Expect = 8.068e-102
Identity = 156/365 (42.74%), Postives = 231/365 (63.29%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            MAY H F    I CH++N + T++A+  N++DV I+K        ++  H L+EH   V  IDW  + +RIV+C TDRNAYVW     +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LISVC F+  ND+W+ KH+K+ I STI CLDWHP+N ++A GS DF  R+F AY+K  +     + WGSK+ F  +++ES G  GWVH V FS  GN++ W++H S + +A    S    VV ++  E LP+L + + T  +++ AGHDC P     D  +  + FG  LD  ++ +A   ++A+ +FQN+D+ AT ++  +++ S HKN+I++I +L G   +     T G DG + +WD+K
Sbjct:    1 MAY-HSFLLEPISCHAWNKDRTQIALCPNNHDVHIYKK---AGNSWTKTHELKEHNGQVTGIDWAPESNRIVTCGTDRNAYVWTLKGDVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISVCYFEQENDWWVCKHIKKPIRSTILCLDWHPNNILLAAGSCDFKCRIFSAYIKEVEEKPAPTPWGSKMPFGEVMFESTGTAGWVHGVCFSDSGNRVAWASHDSTVAVAEGGKS---AVVTSLTSETLPLLCVTFITENSLVAAGHDCYPALFVYDAGKGAITFGGKLDVPKQ-SAQKGMTARERFQNLDKKATSDTKEAVLESLHKNSISQISLLDGGKAKCTKFCTTGMDGGMAIWDVK 357          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005938.1 (pep scaffold:Pmarinus_7.0:GL476493:396482:410070:1 gene:ENSPMAG00000005330.1 transcript:ENSPMAT00000005938.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.59 bits (758), Expect = 2.320e-97
Identity = 149/373 (39.95%), Postives = 236/373 (63.27%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYT-IFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKIY 1158
            ++ F    I CH++N + T++A+S N+++V I+   +    ++S +H L+EH   +  IDW  + +RIV+C +DRNAYVW   + +WKPTLVIL++NRAAT V+WSP ENKFAVGS A+LISVC F+  ND+W+SKH+K+ I ST+  LDWHP+N ++  GS DF  RV+ +Y+K  +     + WG K+ F S++ E  G  GWVH V FS  GN++ W +H S I +A    + +   ++T   E LP+L++I+ T  +++ AGHDC P   +  D   L F + LD  ++ +   ++SA  +F+N+D+ A+ E  ++ +++ H+N+I ++ + +G         T G DG L +WDLK+L   +  L+IY
Sbjct:   10 LYNFLLEPITCHAWNSDRTQIAISPNNHEVHIY---QRNGSQWSKVHELKEHNGHITGIDWASRSNRIVTCGSDRNAYVWTLKEGVWKPTLVILRINRAATCVKWSPRENKFAVGSGARLISVCYFEQENDWWVSKHIKKPIRSTVLSLDWHPNNVLLVAGSCDFKCRVYSSYIKEVEEKPSPTPWGIKMPFGSMMAEFGGGGGWVHGVCFSGSGNKVAWVSHDSTISIADATRNMESSHLKT---EFLPLLSIIFVTENSIVSAGHDCCPLLFVHDDRGVLSFSSKLDIPKQ-SLQRNLSAMERFRNMDKRASAEHQDTTLHTLHQNSITQLSLYEGDKSSCTKFCTTGMDGALAIWDLKSLEASVQGLRIY 375          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009233.1 (pep scaffold:Pmarinus_7.0:GL478809:196683:231527:-1 gene:ENSPMAG00000008323.1 transcript:ENSPMAT00000009233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.003 bits (676), Expect = 7.050e-85
Identity = 144/377 (38.20%), Postives = 221/377 (58.62%), Query Frame = 1
Query:   67 IICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKI---------------WKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGR---LGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTD-NNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHK---NAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLT 1131
            I C+++NG+ +++A+S N+  V I++    G G    +  L EH+  V  IDW    DRIV+C +DRNAYVW R                   W PTLV+L+ NRAAT VRWSP E+KFAVGS A+L+SVC F+ +N++W+SKH+K+ I+ST+  LDWHP+N ++A GS DF  RVF AY+K  D     + WGS++ F  L+ E  G     GWVH + FS+DGN+L W  H S +CLA        P V  +  + LP+LT+ + ++ +++ AGHDC P  + ++ +  L+    LD   +  A  ++SA+  F+   + A+ E  +S      K    ++ ++ +L+G   + +VL + G DG  V+W+L+ +T
Sbjct:   11 ITCYAWNGDRSQVALSPNNESVHIYQRSS-GSGWIK-VDELAEHSGRVTGIDWAPGTDRIVTCGSDRNAYVWTRRGAQQQQQGSAPAAGVTSGWGPTLVLLRFNRAATCVRWSPREDKFAVGSGARLVSVCYFEKDNNWWVSKHIKKPISSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYVKEVDEKPAPTPWGSRMPFGELMAELTGSHSAGGWVHGLCFSQDGNRLAWVAHDSTVCLADPRLDKDAP-VGVLKTDFLPLLTITFISDNSLVAAGHDCYPVLLTSEASGALRVAGKLDRGRQ-GATKNLSARDMFRTKGKKASAEEGDSAWTVTDKLNEESLKQLSVLEGDKAKCRVLCSSGMDGSFVIWNLEVMT 383          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Sea Lamprey
Match: ciao1 (cytosolic iron-sulfur assembly component 1 [Source:NCBI gene;Acc:795104])

HSP 1 Score: 49.2914 bits (116), Expect = 9.395e-7
Identity = 38/132 (28.79%), Postives = 54/132 (40.91%), Query Frame = 1
Query:  160 KGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLN-RAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVF 552
            KG    LHRL  H     S+ W      I SC  D+   VW R    W    V+   + R    V WSP   + A  S      V S   + DF ++  L+ + N  +  + W P  N++A  S D  V ++
Sbjct:    2 KGSLQVLHRLAGHQDRAWSVAWSPSGALIASCGGDKTVRVWGREGDGWVCRSVLADAHQRTVRNVAWSPCGTRLASASFDATTCVWSR-RDGDFEVTATLEGHENE-VKGVAWAPSGNLLATCSRDKSVWIW 131          

HSP 2 Score: 49.2914 bits (116), Expect = 9.734e-7
Identity = 32/119 (26.89%), Postives = 53/119 (44.54%), Query Frame = 1
Query:  196 HTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVF 552
            H  TVR++ W     R+ S S D    VW+R D  ++ T  +         V W+P  N  A  S  K + +   D   D+  +  L  +    +  + WHP++ V+A  S D  +R++
Sbjct:   59 HQRTVRNVAWSPCGTRLASASFDATTCVWSRRDGDFEVTATLEGHENEVKGVAWAPSGNLLATCSRDKSVWIWEVDEEEDYECASVLNSHTQD-VKHVVWHPNSEVLASASYDNSIRLY 176          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Yeast
Match: ARC40 (Subunit of the ARP2/3 complex; ARP2/3 is required for the motility and integrity of cortical actin patches [Source:SGD;Acc:S000000438])

HSP 1 Score: 186.808 bits (473), Expect = 3.093e-55
Identity = 124/390 (31.79%), Postives = 202/390 (51.79%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKV----PEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWAR-SDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDA--PFKESNWGSKLAFNSLLWE-SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKE--------------------EPTANTSISAKHKFQNID---RVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDL 1119
            ++K  +  I  H F+ + + +AV+  + D  +++V    P V          L++H  T+ ++D      RIV+CS DRNAYVW   SD  +KPTLV+L++NRAAT V W+P   KFAVGSSA++I+VC ++  N++W+SKH+K+ I STI CL WH +  ++A G +D  +RVF  ++K  D+      S WG K  F  L+ E  +G   ++H V +     ++ +  H     L  VD  +Q PV      E LP  +L+W  +  ++  G+ C P      +   KF  +LD  +                    + ++   ISA  KF+ +D   +V+T    ++     H+NAI E+R      G+   +S+ G DG++V++ +
Sbjct:   14 VYKLVKAPIYSHCFSQDKSILAVTCET-DCLVYRVSNNTPPV------LFATLKDHDKTITAVDI-SIHGRIVTCSQDRNAYVWEPLSDGTYKPTLVLLRINRAATSVTWAPNGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHANGVLLAAGGTDGFMRVFSGFIKGLDSKESVAGSPWGQKFPFGCLIREWYQG--SYIHDVEWRSQMERIAYVAHDGT--LNVVD--YQSPVQSVNAPEGLPYRSLVWINDHEIVCGGYSCHPVLFSEASEGWKFAKNLDKSDNNKSSALTASGNTDELSGNNDESSTFGISALRKFKELDLKGKVSTDVQESA-----HENAIVELRPFAESNGQITQVSSCGLDGKIVIYTI 384          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Nematostella
Match: EDO30959 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZA7])

HSP 1 Score: 286.96 bits (733), Expect = 2.426e-93
Identity = 156/376 (41.49%), Postives = 236/376 (62.77%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPF-KESNWGSKLAFNSLLWE-SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFT--DNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVA-TXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+     I C +FN    ++A S N + V I+K       +++    L EH   V  +DW ++ +R+V+C+ DRNAYVW   +  WKP LVIL++NRAAT VRWSP E+KFAVGS A+LISVC F+ +ND+W+SKH+K+ I ST+  +DWHP+N ++A GSSDF  RVF  ++K  D    +++ WG K +F + L E + GR GWVHSV+FS  G +L W  H S+I +  V+  H+  VV TI  + LP++  IW T  +++ AGH+ +PY +FT  DN++L     LD+ ++   + +ISA  KF+++D+   + E   S  N+ H+N+I+++ I  G         T G DG++V+WD+K+L   I+ LKI
Sbjct:    6 VHELAITPITCFTFNKARNQLAFSPNDHTVHIYKKS---GNKWTADVVLSEHGQRVTDMDWAQESNRLVTCAADRNAYVWTLQEGTWKPMLVILRINRAATCVRWSPKEDKFAVGSGARLISVCYFEKDNDWWVSKHIKKPIRSTVLGIDWHPNNLLLAAGSSDFKARVFSGFIKDVDGKTNRDTEWGKKASFGNCLAEFTNGRGGWVHSVSFSASGTKLAWVGHDSSISV--VNSGHEMKVV-TIQTDLLPLMQCIWITENSIVAAGHNNMPY-LFTHDDNDKLTLIGKLDAPKKKEDSGAISAMAKFRSLDKQGQSAEEGVSSSNTTHENSISKLDIYAGDKSNVSKFVTSGNDGRVVIWDVKSLESSIAGLKI 374          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Medaka
Match: arpc1b (actin-related protein 2/3 complex subunit 1B [Source:NCBI gene;Acc:101167426])

HSP 1 Score: 312.383 bits (799), Expect = 5.349e-103
Identity = 161/377 (42.71%), Postives = 233/377 (61.80%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXK-HKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            M+Y H F    I CH++N + T++A+  N+++V I+K       +++ +H L+EH   V  IDW  + +RIV+C  DRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I STI  LDWHP+N ++A GS DF  RVF AY+K  +     + WGSK+ F  +L+ES G  GWVHSV FS  GN+L W +H S + +A      +   V ++  E LP+L + + T  ++I AGHDC P     D  +  L FG  LD  ++  A   ISA+ +FQN+DR A+         +  HKN+I++I +L+G   +     T G DG + +WD+KTL   + +LKI
Sbjct:    1 MSY-HSFLLEPISCHAWNKDRTQIALCPNNHEVHIYKKD---GAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGADRNAYVWTLKEGVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTILSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVEEKPSPTPWGSKMPFGEVLFESGGGGGWVHSVCFSHSGNRLAWVSHDSTVSVAE---GGKTGTVSSLSSETLPLLCVTFITENSLIAAGHDCYPMLFVYDGAKVSLTFGGKLDVPKQ-AAQKGISARERFQNLDRRASETQGTDKDLNTLHKNSISQISLLEGGRSQCTKFCTTGMDGGMSIWDVKTLESAMKDLKI 369          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Medaka
Match: arpc1a (actin related protein 2/3 complex subunit 1A [Source:NCBI gene;Acc:101163876])

HSP 1 Score: 308.531 bits (789), Expect = 1.865e-101
Identity = 164/374 (43.85%), Postives = 243/374 (64.97%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWE--SEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDN-NQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            +H+F    I CH++N + T++A+S N+++V I+K       ++   H L+EH   +  IDW  K DRIV+C  DRNAYVW++ + +WKPTLVIL++NRAATFV+WSPLENKFAVGS A+LISVC F+S ND+W+SKH+K+ I STI  LDWHP+N ++A GS DF  RVF AY+K  +     + WGSK+ F ++L E    G  GWVHSV+FS  GN+L W +H S + +  VD S      +T+  E LP+L++I+ +  +++ AGHDC P     D+   L F + LD  ++ +   +ISA  +F+N+D+ AT E  N+ +++ H+N+I ++ I +G   + +   T G DG + +WD K+L   I  L+I
Sbjct:    3 LHQFLLEPITCHAWNRDRTQIAISPNNHEVHIYKK---SGNQWVKTHELKEHNGHITGIDWAPKSDRIVTCGADRNAYVWSQKEGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKPIRSTILSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVEEKPGPTPWGSKMPFGAVLAEFGGAGGGGWVHSVSFSSSGNRLAWVSHDSTVTV--VDSS------KTLKTEFLPLLSVIFVSENSLVAAGHDCCPMLFRCDDMGTLSFVSKLDLPKQ-SIQRNISAMERFRNMDKRATTEDRNTALDTLHQNSITQVSIYEGDKRDCRKFCTTGIDGAMTIWDFKSLEASIQGLRI 364          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Medaka
Match: arpc1b (actin-related protein 2/3 complex subunit 1B [Source:NCBI gene;Acc:101167426])

HSP 1 Score: 302.368 bits (773), Expect = 7.852e-99
Identity = 161/388 (41.49%), Postives = 233/388 (60.05%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGR-----------LGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQ--LKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXK-HKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKI 1155
            M+Y H F    I CH++N + T++A+  N+++V I+K       +++ +H L+EH   V  IDW  + +RIV+C  DRNAYVW   + +WKPTLVIL++NRAA  V+WSP ENKFAVGS ++LIS+C F+  ND+W+ KH+K+ I STI  LDWHP+N ++A GS DF  RVF AY+K  +     + WGSK+ F  +L+ES G             GWVHSV FS  GN+L W +H S + +A      +   V ++  E LP+L + + T  ++I AGHDC P     D  +  L FG  LD  ++  A   ISA+ +FQN+DR A+         +  HKN+I++I +L+G   +     T G DG + +WD+KTL   + +LKI
Sbjct:    1 MSY-HSFLLEPISCHAWNKDRTQIALCPNNHEVHIYKK---DGAKWTKVHELKEHNGQVTGIDWAPESNRIVTCGADRNAYVWTLKEGVWKPTLVILRINRAARCVKWSPKENKFAVGSGSRLISICYFEQENDWWVCKHIKKPIRSTILSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVEEKPSPTPWGSKMPFGEVLFESGGSGAQVQTSGGGGGGWVHSVCFSHSGNRLAWVSHDSTVSVAE---GGKTGTVSSLSSETLPLLCVTFITENSLIAAGHDCYPMLFVYDGAKVSLTFGGKLDVPKQ-AAQKGISARERFQNLDRRASETQGTDKDLNTLHKNSISQISLLEGGRSQCTKFCTTGMDGGMSIWDVKTLESAMKDLKI 380          
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Medaka
Match: zgc:86896 (actin-related protein 2/3 complex subunit 1A [Source:NCBI gene;Acc:101158771])

HSP 1 Score: 293.508 bits (750), Expect = 1.070e-95
Identity = 150/361 (41.55%), Postives = 227/361 (62.88%), Query Frame = 1
Query:   43 IHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTI-FTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLK 1122
            +H FG   + CH++N + T++A+S N+N V I+   E     +     L EH+  +  IDW  + +RIV+C++DRNAYVW R D +WKPTLV+L++NRAAT V+WSP ENKFA+GS A+LISVC FD  ND+W+SKH+K+ I ST+  L WHP+N ++A GS+D H RVF AY+K  +     + WG+K+ F  +L E +   GWVHSV+FS  G+QL W  H+S+I +A      Q   V  +   +LP++++++A+   ++ AGHDC PY   F     L+F   LD  ++ T+  S+SA   F+N+D+ AT E    +    H+N+I ++ ++ G   +    S++G DG +V+W  K
Sbjct:    3 LHSFGLEPLSCHAWNKDRTQIALSPNNNVVNIY---EKKANDWVKTEELTEHSGRITGIDWAPESNRIVTCASDRNAYVWTRKDGVWKPTLVLLRINRAATCVKWSPQENKFALGSGARLISVCYFDKENDWWLSKHIKKPICSTVLSLSWHPNNILLAAGSADLHCRVFSAYIKDIEDKPGPTAWGAKMPFGEVLMEHKDCGGWVHSVSFSPAGDQLAWVAHNSSISVADATQGKQ---VTQLNTRHLPLVSVLFASASEIVAAGHDCCPYQFTFKSPGSLEFVKKLDMTKQ-TSKGSMSAMQHFRNLDKKATEEDEKDLNTL-HQNSITQLCVVSGDKSKVDKYSSVGLDGAMVIWTFK 355          
BLAST of Actin-related protein 2/3 complex subunit vs. Planmine SMEST
Match: SMESG000015778.1 (SMESG000015778.1)

HSP 1 Score: 743.421 bits (1918), Expect = 0.000e+0
Identity = 370/375 (98.67%), Postives = 371/375 (98.93%), Query Frame = 1
Query:   34 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKEEPTANTSISAKHKFQNIDRVATXXXXXXXXXXKHKNAINEIRILKGVVGEAQVLSTIGRDGQLVLWDLKTLTQRISELKIY 1158
            MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTV+GAGHDCIPYTIFTDNNQLK GASLDSKEE TANTSISAKHKFQNIDRVATIESNNSIINSKHKNAINEIRILKG VGEAQVLSTIGRDGQLVLWDLKTLTQRI ELKIY
Sbjct:    1 MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPMENLPILTLIWATNKTVVGAGHDCIPYTIFTDNNQLKLGASLDSKEESTANTSISAKHKFQNIDRVATIESNNSIINSKHKNAINEIRILKGAVGEAQVLSTIGRDGQLVLWDLKTLTQRICELKIY 375          
BLAST of Actin-related protein 2/3 complex subunit vs. Planmine SMEST
Match: SMESG000005136.1 (SMESG000005136.1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.060e-8
Identity = 54/228 (23.68%), Postives = 92/228 (40.35%), Query Frame = 1
Query:   70 ICHSFNGNCTEMAVSVNSNDVFI---------FKVPEVGKGRFSFLHRLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLNRAATF--------VRWSPL-ENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTITCLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLWESEGRLGWVHSVAFSKDGNQLM 699
            IC +F+ +C  +AV   + D+++         +        +F  +     H+  V  + W K +  ++S S+D     W  + K           +  ATF        V  SPL EN    G++ + I+V + D  N     +   R+I+  +TC+ +H ++N IA G  D  VR+F                   +   +L+    G  G V S+ FS DG  L+
Sbjct:  266 ICAAFSKDCDFLAVGTVTGDIYVNWHRTSCRDYPPDNADNAQFDLI---SGHSGAVYEMSWSKNQQLLISASSDGTVKCWRTATK-----------DCIATFSAPGPIWSVDLSPLSENLLVCGTNKESINVYALDHPNPI---RQFSRDIHGAVTCVRFHGNDNYIASGGVDRTVRLF------------------DIRSGTLVRSFTGHKGIVSSLRFSLDGKYLI 458          
The following BLAST results are available for this feature:
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARPC1A3.495e-10343.58actin related protein 2/3 complex subunit 1A [Sour... [more]
ARPC1B1.293e-10241.16actin related protein 2/3 complex subunit 1B [Sour... [more]
ARPC1B1.293e-10241.16actin related protein 2/3 complex subunit 1B [Sour... [more]
ARPC1B1.293e-10241.16actin related protein 2/3 complex subunit 1B [Sour... [more]
ARPC1B1.293e-10241.16actin related protein 2/3 complex subunit 1B [Sour... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arx-33.966e-9444.41Actin-related protein 2/3 complex subunit [Source... [more]
arx-36.894e-9444.41Actin-related protein 2/3 complex subunit [Source... [more]
pfs-23.320e-727.47Polyadenylation Factor Subunit homolog [Source:Un... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Arpc12.402e-8740.43gene:FBgn0001961 transcript:FBtr0080570[more]
Arpc12.402e-8740.43gene:FBgn0001961 transcript:FBtr0080569[more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arpc1b8.460e-10542.82actin related protein 2/3 complex, subunit 1B [Sou... [more]
arpc1b8.460e-10542.82actin related protein 2/3 complex, subunit 1B [Sou... [more]
arpc1a2.169e-10443.85actin related protein 2/3 complex, subunit 1A [Sou... [more]
zgc:868962.519e-10242.58zgc:86896 [Source:ZFIN;Acc:ZDB-GENE-040625-80][more]
zgc:868965.679e-10242.94zgc:86896 [Source:ZFIN;Acc:ZDB-GENE-040625-80][more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
parp14.41.142e-10443.09poly (ADP-ribose) polymerase family, member 14, ge... [more]
slco4a14.064e-10243.82solute carrier organic anion transporter family me... [more]
parp14.46.159e-10243.32poly (ADP-ribose) polymerase family, member 14, ge... [more]
slco4a11.242e-10143.84solute carrier organic anion transporter family me... [more]
slco4a11.449e-10143.84solute carrier organic anion transporter family me... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arpc1a8.191e-10544.12actin related protein 2/3 complex, subunit 1A [Sou... [more]
Arpc1b1.128e-10140.90actin related protein 2/3 complex, subunit 1B [Sou... [more]
Arpc1b9.476e-10140.79actin related protein 2/3 complex, subunit 1B [Sou... [more]
Arpc1a5.508e-8051.05actin related protein 2/3 complex, subunit 1A [Sou... [more]
Arpc1a2.391e-4755.15actin related protein 2/3 complex, subunit 1A [Sou... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8AVT9|AR1AA_XENLA3.506e-10544.92Actin-related protein 2/3 complex subunit 1A-A OS=... [more]
sp|A0A1L8EXB5|AR1AB_XENLA8.248e-10545.07Actin-related protein 2/3 complex subunit 1A-B OS=... [more]
sp|Q9R0Q6|ARC1A_MOUSE5.729e-10444.12Actin-related protein 2/3 complex subunit 1A OS=Mu... [more]
sp|Q6GNU1|AR1BB_XENLA1.291e-10342.82Actin-related protein 2/3 complex subunit 1B-B OS=... [more]
sp|Q7ZXD5|AR1BA_XENLA1.552e-10342.82Actin-related protein 2/3 complex subunit 1B-A OS=... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Y9D02.027e-11846.97Actin-related protein 2/3 complex subunit OS=Hymen... [more]
A0A0R3UKM41.417e-11746.30Actin-related protein 2/3 complex subunit OS=Mesoc... [more]
A0A0R3WHW96.695e-11745.24Actin-related protein 2/3 complex subunit OS=Hydat... [more]
A0A0R3SV993.151e-11446.17Actin-related protein 2/3 complex subunit OS=Hymen... [more]
H2KSG43.841e-11446.49Actin-related protein 2/3 complex subunit OS=Clono... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arpc1b2.428e-10542.02actin related protein 2/3 complex subunit 1B [Sour... [more]
arpc1b5.768e-10542.02actin related protein 2/3 complex subunit 1B [Sour... [more]
arpc1a1.461e-10343.85actin related protein 2/3 complex, subunit 1A [Sou... [more]
zgc:868967.895e-10342.82actin-related protein 2/3 complex subunit 1A-like ... [more]
arpc1b8.068e-10242.74actin related protein 2/3 complex subunit 1B [Sour... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005938.12.320e-9739.95pep scaffold:Pmarinus_7.0:GL476493:396482:410070:1... [more]
ENSPMAT00000009233.17.050e-8538.20pep scaffold:Pmarinus_7.0:GL478809:196683:231527:-... [more]
ciao19.395e-728.79cytosolic iron-sulfur assembly component 1 [Source... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARC403.093e-5531.79Subunit of the ARP2/3 complex; ARP2/3 is required ... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO309592.426e-9341.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arpc1b5.349e-10342.71actin-related protein 2/3 complex subunit 1B [Sour... [more]
arpc1a1.865e-10143.85actin related protein 2/3 complex subunit 1A [Sour... [more]
arpc1b7.852e-9941.49actin-related protein 2/3 complex subunit 1B [Sour... [more]
zgc:868961.070e-9541.55actin-related protein 2/3 complex subunit 1A [Sour... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000015778.10.000e+098.67SMESG000015778.1[more]
SMESG000005136.11.060e-823.68SMESG000005136.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005741 ID=SMED30005741|Name=Actin-related protein 2/3 complex subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1387bp
GGAAATAGATTTAGGAACTATTTATAAGTTCAAATGGCATATATTCATAA
ATTTGGACAAGTTTCTATTATATGCCATTCATTTAATGGCAATTGCACAG
AAATGGCAGTGTCCGTTAATTCAAATGACGTGTTTATTTTCAAAGTTCCA
GAAGTAGGGAAAGGAAGATTTTCTTTTTTGCACAGACTACAAGAGCATAC
GGCCACTGTTCGTTCAATTGATTGGGGTAAAAAAGAAGATAGAATCGTCA
GTTGTTCCACTGATCGAAATGCATATGTCTGGGCACGGTCTGATAAGATA
TGGAAACCAACATTAGTGATTTTACAGTTAAATCGAGCGGCTACATTTGT
GAGATGGTCTCCTCTAGAAAACAAATTTGCAGTTGGCAGTAGCGCAAAGC
TAATATCTGTTTGTTCTTTTGATTCCAATAACGACTTTTGGATTAGTAAA
CATCTGAAACGAAATATAAATTCAACAATAACCTGTTTGGATTGGCATCC
AGACAATAATGTCATTGCTTGTGGTTCATCAGATTTCCATGTCCGAGTCT
TTTGTGCTTATCTTAAGTCTCATGACGCACCATTTAAAGAAAGCAATTGG
GGTAGTAAATTAGCTTTCAATTCTCTTTTATGGGAAAGTGAAGGGCGTCT
TGGTTGGGTTCATTCTGTCGCATTTTCGAAAGATGGCAATCAATTGATGT
GGAGTACTCATTCGAGTGCGATTTGCTTGGCAACAGTGGATGGATCTCAT
CAGCCTCCTGTCGTGAGAACCATTCCTATGGAGAACCTACCTATCTTGAC
ATTAATTTGGGCAACCAATAAAACTGTAATTGGGGCCGGTCATGACTGTA
TTCCATACACAATCTTCACGGACAACAATCAATTGAAATTTGGCGCTAGT
CTAGACAGCAAGGAAGAACCAACGGCTAATACAAGTATTTCGGCTAAACA
TAAATTTCAAAATATAGATCGAGTCGCAACTATCGAATCCAATAATTCCA
TTATTAATTCCAAACACAAAAATGCTATAAATGAGATTCGAATTCTTAAA
GGAGTTGTTGGAGAGGCTCAAGTGCTTTCGACAATTGGTCGGGATGGACA
GCTTGTTTTATGGGACCTGAAAACTTTAACCCAAAGAATAAGTGAACTAA
AAATTTACTGATTTGCTATTTTCCCAATGCTGTTCTGAAATTATGAGAAA
ACGAGCCACTTTTTCTAGTGTTAATTTCAATAGTGCTAATTATAACGAAC
TTTTCTATTGATTTTTCTCGGCTAAATTGTTTTTGCTGTGTGACGGTGTG
TGTGTGCGTGTGATTGCGTATACATGCTGTGTTTATCCAATGAATGACTA
ATTTCGTTTCATTTTCGATTAATATATTTTCCAACTA
back to top

protein sequence of SMED30005741-orf-1

>SMED30005741-orf-1 ID=SMED30005741-orf-1|Name=SMED30005741-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=376bp
MAYIHKFGQVSIICHSFNGNCTEMAVSVNSNDVFIFKVPEVGKGRFSFLH
RLQEHTATVRSIDWGKKEDRIVSCSTDRNAYVWARSDKIWKPTLVILQLN
RAATFVRWSPLENKFAVGSSAKLISVCSFDSNNDFWISKHLKRNINSTIT
CLDWHPDNNVIACGSSDFHVRVFCAYLKSHDAPFKESNWGSKLAFNSLLW
ESEGRLGWVHSVAFSKDGNQLMWSTHSSAICLATVDGSHQPPVVRTIPME
NLPILTLIWATNKTVIGAGHDCIPYTIFTDNNQLKFGASLDSKEEPTANT
SISAKHKFQNIDRVATIESNNSIINSKHKNAINEIRILKGVVGEAQVLST
IGRDGQLVLWDLKTLTQRISELKIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0015629actin cytoskeleton
GO:0005885Arp2/3 protein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR017383ARPC1
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: biological process
TermDefinition
GO:0030833regulation of actin filament polymerization
GO:0034314Arp2/3 complex-mediated actin nucleation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 138..174
e-value: 4.4E-4
score: 29.6
coord: 89..128
e-value: 98.0
score: 4.4
coord: 195..234
e-value: 79.0
score: 5.0
coord: 45..84
e-value: 1.0E-4
score: 31.7
coord: 319..361
e-value: 250.0
score: 1.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 48..83
e-value: 0.094
score: 13.6
coord: 139..173
e-value: 2.2E-5
score: 25.1
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 52..83
score: 10.709
IPR017383Actin-related protein 2/3 complex subunit 1PIRSFPIRSF038093ARPC1coord: 1..368
e-value: 4.9E-121
score: 401.8
IPR017383Actin-related protein 2/3 complex subunit 1PANTHERPTHR10709ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 1coord: 4..363
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..362
e-value: 1.2E-117
score: 394.9
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 348..362
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 52..173
score: 9.573
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 12..368