Guanine nucleotide-binding protein G(I) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(I) subunit alpha
Smed IDSMED30005718
Length (bp)1784
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(I) subunit alpha (SMED30005718) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(I) subunit alpha (SMED30005718) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(I) subunit alpha (SMED30005718) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(I) subunit alpha (SMED30005718) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005718

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30005718SMESG000026774.1 Gpassmed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 Gpassmed_ncbi_20200123PMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30005718SMESG000026774.1 SmedASXL_012318SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005718SMESG000026774.1 dd_Smed_v4_12112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005718SMESG000026774.1 dd_Smed_v4_12112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005718SMESG000026774.1 dd_Smed_v4_12112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
lateral branchSMED30005718SMESG000026774.1 dd_Smed_v4_12112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
cilated neuronSMED30005718SMESG000026774.1 dd_Smed_v4_12112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005718SMESG000026774.1 Contig49565newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005718SMESG000026774.1 Contig49565uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30005718SMESG000026774.1 dd_Smed_v6_12112_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30005718SMESG000026774.1 HQ121519.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 HQ121519.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30005718SMESG000026774.1 HQ121519.1smed_ncbi_20200123PMID:21282632
Almuedo-Castillo et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30005718SMESG000026774.1 OX_Smed_1.0.06840ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005718SMESG000026774.1 Gpassmed_ncbi_20200123PMID:22125640
Evans et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 Gpassmed_ncbi_20200123PMID:22125640
Evans et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30005718SMESG000026774.1 HQ121519smed_ncbi_20200123PMID:23318635
Blassberg et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cholinergic neuronSMED30005718SMESG000026774.1 dd_Smed_v6_12112_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 502.286 bits (1292), Expect = 1.727e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 502.286 bits (1292), Expect = 1.727e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 502.286 bits (1292), Expect = 1.727e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 502.286 bits (1292), Expect = 1.727e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Match: GNAI1 (G protein subunit alpha i1 [Source:HGNC Symbol;Acc:HGNC:4384])

HSP 1 Score: 502.286 bits (1292), Expect = 1.727e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 454.521 bits (1168), Expect = 4.303e-157
Identity = 218/355 (61.41%), Postives = 272/355 (76.62%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   E+++ IE+ L++D  +A K++KLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N VQS+V IL AM  LG+S  +     ++K+V   +   E+ E F +EL S++  LW D  VQ+C++R+ EYQLNDSA Y+LD L+RL E  Y PTEQD+LR+RVKTTGIVE HF FK+L+FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRMHES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEY+G   Y EASAYIQ+QFE  NK    K IY H TCATDT NIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTMSQEERAALERSRMIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYSGRQDYHEASAYIQAQFEAKNKSA-NKEIYCHMTCATDTTNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Match: gpa-16 (Guanine nucleotide-binding protein alpha-16 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9N2V6])

HSP 1 Score: 448.743 bits (1153), Expect = 8.574e-155
Identity = 211/357 (59.10%), Postives = 272/357 (76.19%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKK---KETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  D+  + ++K+I++ L++D E +M+ +KLLLLGAGE GKSTILKQM IIH  GY  EERK +  ++Y N++ S+  I++AME L IS        +++ +  +    EE E P+EL   +  +W D  +Q    R++EYQLNDSAGYYL  LDR+  P+YIPT+ D+LR+R+KTTGIVET F +KD  F VFDVGGQRSERKKW+HCFE VTA++F VA+SEYD+ LVED  TNRM ES++LFDSICN++WFV TSIILFLNKKDLF EK+V+SPLT CFPEYTGAN YEEASAYIQ QFE++NK+   ++ + IYT FTCATDTNNI+ VFDAV D+II++NL+ CGL+
Sbjct:    1 MGCIMSQEDEAAKRRSKKIDRLLKEDGENSMRTIKLLLLGAGESGKSTILKQMRIIHDVGYTTEERKVFRGVVYGNIILSLNAIIHAMEQLKISFTTLDHESDARKLLMFSTTGEEDELPEELVVLMKSVWSDSGIQKALERSREYQLNDSAGYYLSQLDRICAPNYIPTQDDILRTRIKTTGIVETQFVYKDRLFLVFDVGGQRSERKKWIHCFEDVTALIFCVALSEYDMVLVEDCQTNRMRESLKLFDSICNNKWFVETSIILFLNKKDLFEEKIVRSPLTHCFPEYTGANNYEEASAYIQQQFEDMNKRTTGEKNQEIYTQFTCATDTNNIRFVFDAVTDIIIRDNLRTCGLY 357          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Match: gpa-4 (Guanine nucleotide-binding protein alpha-4 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9BIG5])

HSP 1 Score: 422.165 bits (1084), Expect = 2.066e-144
Identity = 203/360 (56.39%), Postives = 269/360 (74.72%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKY---MRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKET--KTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S    + ++++K I++QLR D E+ + E+KLLLLGAGE GKSTI++QM I+H  G+ ++E+  Y P++++N+VQSM+ IL AM+ L IS  + A  E++++   +   + NAE  E F  EL   +  LW D+ V+ C  RA EYQLNDSA YY ++LDR+S  SY+PT+ D+LR+RVK+TGIVET F +KDL FK+FDVGGQRSERKKW+HCF+ VTA++F VA+SEYDL+L ED + NRMHESM+LFDSI N+ WF  TSIILFLNK D+F E++  +PLTVCFPEY G     E S +IQS+FE LNK++    K IY+HFTCATDTNNI+ VFDAV D+II+NNL  CGL+
Sbjct:    1 MGCFHST-GSEAKKRSKLIDEQLRHDHERCVGEIKLLLLGAGESGKSTIVRQMRILHETGFNKQEQMAYRPVVFSNMVQSMLAILKAMQPLNISFTDAAREEDARMFISHFLHVNNAELSEAFSLELSDLMKQLWMDEGVKKCVKRAHEYQLNDSAEYYFNALDRISSSSYLPTQDDILRARVKSTGIVETTFMYKDLCFKMFDVGGQRSERKKWIHCFDSVTAVIFCVALSEYDLRLAEDQTMNRMHESMQLFDSIVNNCWFTETSIILFLNKMDIFEERIRYTPLTVCFPEYQGGMTITETSTFIQSRFEILNKRQTPAQKEIYSHFTCATDTNNIRFVFDAVTDIIIRNNLYLCGLY 359          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Match: gpa-7 (Guanine nucleotide-binding protein alpha-7 subunit [Source:UniProtKB/Swiss-Prot;Acc:Q21917])

HSP 1 Score: 388.652 bits (997), Expect = 2.132e-131
Identity = 185/352 (52.56%), Postives = 251/352 (71.31%), Query Frame = 2
Query:  317 GSVPDKDQQEK---NKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            G    KDQ+E    N+ I++Q+++D   +++ +KLLLLGAGE GKSTILKQM I+H  G+ +++ +   P++Y+N + SM++IL AM  L I       + +S++V   + +A + E  +EL +A+  LW D  V+ CY R+ EYQ++DSA Y+LD+L RLS P+Y+P+EQD+LR+R+KTTGI E  F  K L F+V DVGGQRSERKKW+HCF+ V AI+F+ ++SEYD  L ED+ TNRM ES++LFDSICNS WF +   ILFLNKKDLF EK+V+SPLTVCFPEY G     E   YIQ +FE+LN+  + + IY H TCATDTNN+Q V DA +D+II  NLK  GL
Sbjct:    2 GHCTSKDQKEGKRLNRRIDEQIKKDQSMSLRIIKLLLLGAGESGKSTILKQMRILHKDGFSQQDLEMIRPVVYSNCIHSMLSILRAMFHLQIEYGEPDRVRDSQLVFATV-HANKEELTEELAAAMQRLWHDPGVRECYRRSNEYQIDDSAKYFLDNLPRLSSPNYVPSEQDLLRTRIKTTGITEVLFELKGLTFRVIDVGGQRSERKKWIHCFDNVNAIIFISSLSEYDQTLREDNCTNRMQESLKLFDSICNSPWFADIHFILFLNKKDLFAEKIVRSPLTVCFPEYKGQQNQTECINYIQWKFEQLNRSSQ-REIYCHHTCATDTNNVQFVLDACLDMIIAKNLKSMGL 351          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Match: gpa-3 (Guanine nucleotide-binding protein alpha-3 subunit [Source:UniProtKB/Swiss-Prot;Acc:P28052])

HSP 1 Score: 387.882 bits (995), Expect = 4.762e-131
Identity = 184/354 (51.98%), Postives = 252/354 (71.19%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            MG   S  DK+   K+K I++++ Q+     K VKLLLLGAGECGKST+LKQM I+H  G+  EE ++   +++ N +Q+M  IL  ME L ++ +      ++K V +  +  +E + FP+EL +A+  LW D +VQ   A+  E+Q+ +SA ++L SLDR+  P Y PTEQD+L SR+KTTGIVE  F  K +DF+VFDVGGQRSERKKW+HCFE V AI+F+ A+SEYD  L ED +TNRM ESMRLF+SICNS+WF+NTS+ILFLNKKDLF EK+ ++ +   FP+Y GA  Y+E+  YI+ +F+ LN   E KTIY H TCATDT+ +Q++ D+VID+II+ NL+ CGL
Sbjct:    1 MGLCQSAEDKELTLKSKAIDKEMMQNHMSQQKVVKLLLLGAGECGKSTVLKQMRILHDHGFTAEEAEQQKSVVFNNTLQAMTAILKGMEALRMTFDKPIRENDAKFVMESHKMLQEAKVFPEELANAIQALWNDKAVQQVIAKGNEFQMPESAPHFLSSLDRIKLPDYNPTEQDILLSRIKTTGIVEVKFQMKSVDFRVFDVGGQRSERKKWIHCFEDVNAIIFIAAISEYDQVLFEDETTNRMIESMRLFESICNSRWFINTSMILFLNKKDLFAEKIKRTSIKSAFPDYKGAQTYDESCRYIEEKFDGLNANPE-KTIYMHQTCATDTDQVQMILDSVIDMIIQANLQGCGL 353          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Match: Galphai (gene:FBgn0001104 transcript:FBtr0076934)

HSP 1 Score: 459.529 bits (1181), Expect = 5.255e-159
Identity = 219/355 (61.69%), Postives = 274/355 (77.18%), Query Frame = 2
Query:  305 MGCAGSVP-DKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S   DK+  E++K I++ LR + E+A  EVKLLLLGAGE GKSTI+KQM IIH  GY +EE +EY  ++++N VQS++ I+ AM  L I   + +  + ++    +   A+EG    E+   +  LW D  VQ  +AR++EYQLNDSAGYYL+SLDR+++P+YIPT+QDVLR+RVKTTGI+ETHF  K L FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRM ES++LFDSICNS+WFV TSIILFLNKKDLF EK+ +SPLT+CFPEYTG N +EEA+ YI+ +FE LNK+K+ K IYTH TCATDTNN++ VFDAV DVIIKNNLK  GLF
Sbjct:    1 MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGILLPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088267)

HSP 1 Score: 454.907 bits (1169), Expect = 3.897e-157
Identity = 217/355 (61.13%), Postives = 271/355 (76.34%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   +++K+IE+ L++D  +A K++KLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+V IL AM TL I   N     ++K+V    +   + E F +EL +A+  LW+D  VQ C++R+ EYQLNDSA Y+LD LDRL    Y PTEQD+LR+RVKTTGIVE HF FK+L+FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEYTG   Y EA+AYIQ+QFE  NK   +K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKST-SKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088269)

HSP 1 Score: 454.907 bits (1169), Expect = 3.897e-157
Identity = 217/355 (61.13%), Postives = 271/355 (76.34%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   +++K+IE+ L++D  +A K++KLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+V IL AM TL I   N     ++K+V    +   + E F +EL +A+  LW+D  VQ C++R+ EYQLNDSA Y+LD LDRL    Y PTEQD+LR+RVKTTGIVE HF FK+L+FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEYTG   Y EA+AYIQ+QFE  NK   +K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKST-SKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088264)

HSP 1 Score: 454.907 bits (1169), Expect = 3.897e-157
Identity = 217/355 (61.13%), Postives = 271/355 (76.34%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   +++K+IE+ L++D  +A K++KLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+V IL AM TL I   N     ++K+V    +   + E F +EL +A+  LW+D  VQ C++R+ EYQLNDSA Y+LD LDRL    Y PTEQD+LR+RVKTTGIVE HF FK+L+FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEYTG   Y EA+AYIQ+QFE  NK   +K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKST-SKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Match: Galphao (gene:FBgn0001122 transcript:FBtr0088268)

HSP 1 Score: 454.907 bits (1169), Expect = 3.897e-157
Identity = 217/355 (61.13%), Postives = 271/355 (76.34%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   +++K+IE+ L++D  +A K++KLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+V IL AM TL I   N     ++K+V    +   + E F +EL +A+  LW+D  VQ C++R+ EYQLNDSA Y+LD LDRL    Y PTEQD+LR+RVKTTGIVE HF FK+L+FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEYTG   Y EA+AYIQ+QFE  NK   +K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTTSAEERAAIQRSKQIEKNLKEDGIQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDFKQYRPVVYSNTIQSLVAILRAMPTLSIQYSNNERESDAKMVFDVCQRMHDTEPFSEELLAAMKRLWQDAGVQECFSRSNEYQLNDSAKYFLDDLDRLGAKDYQPTEQDILRTRVKTTGIVEVHFSFKNLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSPLTICFPEYTGGQEYGEAAAYIQAQFEAKNKST-SKEIYCHMTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1310])

HSP 1 Score: 498.819 bits (1283), Expect = 2.679e-174
Identity = 232/354 (65.54%), Postives = 282/354 (79.66%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +     +AEEG    EL   +  LWKD  VQ C++R++EYQLNDSA YYL+ LDR+S+ +YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KS LT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARADDARQLFVLAGSAEEGFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQATYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRKSTLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Match: gnai2b (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5861])

HSP 1 Score: 492.271 bits (1266), Expect = 1.228e-171
Identity = 228/355 (64.23%), Postives = 281/355 (79.15%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N +QS++ I+ AM  L I     A +++++ +      AEE G    +L + +  LW D  VQ C++R++EYQLNDSA YYL+ LDR++   YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+ +SPLT+CFPEY+GAN Y+EA++YIQ++FE+LNKKK+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMSNLKIDYGESARVDDARQLFALSAAAEEQGILTDDLANVIRRLWADSGVQGCFSRSREYQLNDSAAYYLNDLDRIARSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLTICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 486.878 bits (1252), Expect = 2.819e-169
Identity = 224/354 (63.28%), Postives = 281/354 (79.38%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK  QE++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   +    ++++ +     + +EG    EL   +  LW+D+ V+ C+ R++EYQLNDSA YYL+ LDR+S  SY+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVT+I+F V++S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+  SPL++CFPEY G+++YEEA+AYIQ QFE+LNK+K+TK IY+HFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:   24 MGCTLSSDDKSAQERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVDEGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 377          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Match: gnaia (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide a [Source:ZFIN;Acc:ZDB-GENE-030131-2229])

HSP 1 Score: 486.878 bits (1252), Expect = 2.819e-169
Identity = 224/354 (63.28%), Postives = 281/354 (79.38%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK  QE++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   +    ++++ +     + +EG    EL   +  LW+D+ V+ C+ R++EYQLNDSA YYL+ LDR+S  SY+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVT+I+F V++S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+  SPL++CFPEY G+++YEEA+AYIQ QFE+LNK+K+TK IY+HFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:   24 MGCTLSSDDKSAQERSKMIDRNLRDDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYRVVVYSNTIQSIIAIIRAMGRLRIDFADPERADDARQLFVMAGSVDEGFMTSELAGVIKRLWRDEGVRLCFHRSREYQLNDSASYYLNDLDRISNSSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTSIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIRMSPLSICFPEYPGSDVYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 377          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Match: gnai2a (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2a [Source:ZFIN;Acc:ZDB-GENE-030131-8365])

HSP 1 Score: 484.567 bits (1246), Expect = 1.175e-168
Identity = 229/355 (64.51%), Postives = 279/355 (78.59%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA KEVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++++N +QS++ I+ AM +L I  E+ A  ++++ +      AEE G  P EL + +  LW D  VQNC+ RA+EYQLNDSA YYL+ ++R+++  YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VAMS YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF +K+ +S L +CFPEY G + YEEAS YI+++FE+LNKKKETK IY HFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSQEDKAALERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECKQYRAVVFSNTIQSIMAIVKAMTSLKIEYEDSARADDARQLFALSGTAEEQGILPDELANVICRLWADRGVQNCFTRAREYQLNDSAAYYLNDMERIAKADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKITRSSLIICFPEYPGEDNYEEASEYIRTKFEDLNKKKETKEIYPHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 495.738 bits (1275), Expect = 6.780e-173
Identity = 231/354 (65.25%), Postives = 282/354 (79.66%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + +  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++ SYIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +SPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 495.738 bits (1275), Expect = 3.389e-172
Identity = 231/354 (65.25%), Postives = 282/354 (79.66%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + +  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++ SYIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +SPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:   44 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYPGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 397          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Match: gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [Source:NCBI gene;Acc:394861])

HSP 1 Score: 487.263 bits (1253), Expect = 1.475e-169
Identity = 223/355 (62.82%), Postives = 281/355 (79.15%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE ++Y  ++++N +QS++ I+ AM  L I   + A  ++++ +      AEE G  P +L   +  LW D  VQ C++R++EYQLNDSA YYL+ L+R++   Y+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+ +SPL++CFPEY+GAN Y+EA++YIQ++FE+LNK+++TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKNIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITRSPLSICFPEYSGANQYDEAASYIQTKFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Match: rgp1 (RGP1 homolog, RAB6A GEF complex partner 1 [Source:Xenbase;Acc:XB-GENE-997629])

HSP 1 Score: 485.723 bits (1249), Expect = 6.329e-169
Identity = 223/354 (62.99%), Postives = 285/354 (80.51%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA KEVKLLLLGAGE GKSTI+KQM IIH  GY EEE ++Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +     +AEEG    EL   +  LW+D  VQ C++R++EYQLNDSA YYL+ ++R+++ +YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF++TSIILFLNKKDLF EK+ +SPLT+C+PEY+G+N YEEA+AYIQ QFE+LN++K+TK IYTHFTCATDT N+Q VFDAV DVIIK+NL +CGL+
Sbjct:    1 MGCTLSAEDKAAAERSKMIDRNLREDGEKASKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYKVVVYSNTIQSIIAIIRAMGRLRIDFGDVARADDARQLFVLASSAEEGVMSPELAGVIQRLWEDPGVQACFSRSREYQLNDSASYYLNDIERIAQVNYIPTQQDVLRTRVKTTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLLLAEDEEMNRMHESMKLFDSICNNKWFIDTSIILFLNKKDLFEEKISRSPLTICYPEYSGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKSNLMECGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Match: gnao1 (G protein subunit alpha o1 [Source:NCBI gene;Acc:549749])

HSP 1 Score: 458.373 bits (1178), Expect = 3.542e-158
Identity = 217/355 (61.13%), Postives = 274/355 (77.18%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   E++K+IE+ L++D   A K+VKLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+  I+ AM+TLGI   ++    ++K+V   +   E+ E F  EL SA+  LW D  +Q C+ R++EYQLNDSA YYLDSLDR+    Y PTEQD+LR+RVKTTGIVETHF FK+L F++FDVGGQRSERKKW+HCFE VTAI+F VA+S YD  L ED +TNRMHES+ LFDSICN+++F++TSIILFLNKKDLF EK+ KSPLT+CFPEYTG N YE+A+AYIQ+QFE  N+    K IY H TCATDTNNIQVVFDAV D+II NNL+ CGL+
Sbjct:    1 MGCTLSAEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMMRLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFAEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSP-NKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Match: Gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting 1 [Source:MGI Symbol;Acc:MGI:95771])

HSP 1 Score: 502.286 bits (1292), Expect = 1.186e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Match: Gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting 3 [Source:MGI Symbol;Acc:MGI:95773])

HSP 1 Score: 492.656 bits (1267), Expect = 7.495e-172
Identity = 227/354 (64.12%), Postives = 284/354 (80.23%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA KEVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N +QS++ I+ AM  L I     A  ++++ +     +AEEG    EL   +  LW+D  VQ C++R++EYQLNDSA YYL+ LDR+S+ +YIPT+QDVLR+RVKTTGIVETHF FK+L FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +SPLT+C+PEYTG+N YEEA+AYIQ QFE+LN++K+TK +YTHFTCATDT N+Q VFDAV DVIIKNNLK+CGL+
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGESARADDARQLFVLAGSAEEGVMTSELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVKTTGIVETHFTFKELYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEVYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 487.263 bits (1253), Expect = 1.179e-169
Identity = 227/355 (63.94%), Postives = 281/355 (79.15%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE ++Y  ++Y+N +QS++ I+ AM  L I   +    ++++ +      AEE G  P++L   +  LW D  VQ C+ R++EYQLNDSA YYL+ L+R+++  YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +S LT+CFPEYTGAN Y+EA++YIQS+FE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Match: Gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting 2 [Source:MGI Symbol;Acc:MGI:95772])

HSP 1 Score: 487.263 bits (1253), Expect = 1.179e-169
Identity = 227/355 (63.94%), Postives = 281/355 (79.15%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE ++Y  ++Y+N +QS++ I+ AM  L I   +    ++++ +      AEE G  P++L   +  LW D  VQ C+ R++EYQLNDSA YYL+ L+R+++  YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +S LT+CFPEYTGAN Y+EA++YIQS+FE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPQRADDARQLFALSCAAEEQGMLPEDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITQSSLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Match: Gnao1 (guanine nucleotide binding protein, alpha O [Source:MGI Symbol;Acc:MGI:95775])

HSP 1 Score: 457.603 bits (1176), Expect = 4.426e-158
Identity = 217/355 (61.13%), Postives = 274/355 (77.18%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++   E++K IE+ L++D   A K+VKLLLLGAGE GKSTI+KQM IIH  G+  E+ K+Y P++Y+N +QS+  I+ AM+TLG+   ++    +SK+V   +   E+ E F  EL SA+  LW D  +Q C+ R++EYQLNDSA YYLDSLDR+    Y PTEQD+LR+RVKTTGIVETHF FK+L F++FDVGGQRSERKKW+HCFE VTAI+F VA+S YD  L ED +TNRMHES+ LFDSICN+++F++TSIILFLNKKDLFGEK+ KSPLT+CFPEY G+N YE+A+AYIQ+QFE  N+    K IY H TCATDTNNIQVVFDAV D+II NNL+ CGL+
Sbjct:    1 MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGVEYGDKERKTDSKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAGDYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYPGSNTYEDAAAYIQTQFESKNRSP-NKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Match: sp|P51876|GNAI_PLATR (Guanine nucleotide-binding protein G(i) subunit alpha OS=Planorbella trivolvis OX=283763 PE=2 SV=2)

HSP 1 Score: 513.842 bits (1322), Expect = 2.337e-179
Identity = 242/354 (68.36%), Postives = 285/354 (80.51%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K+I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH KGY +EE  +Y P++Y+N +QSM+ I+ AM  L I   +    EE++       +A+EGE  +EL   +  LWKD  VQ C++R++EYQLNDSA YYL++LDR+S P YIPTEQDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F+VAMSEYDL L ED   NRM ESM+LFDSICN++WF  TSIILFLNKKDLF EK+ KSPLT+CFPEYTGAN YEEA+AYIQ QFE LNKKK+TK IY+HFTCATDTNN+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCVTSQEDKAAVERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYNPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEEARQFFALAGHADEGEMSQELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Match: sp|P30676|GNAI_PATPE (Guanine nucleotide-binding protein G(i) subunit alpha OS=Patiria pectinifera OX=7594 PE=1 SV=3)

HSP 1 Score: 513.457 bits (1321), Expect = 3.901e-179
Identity = 237/354 (66.95%), Postives = 285/354 (80.51%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S  DK   E++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH +GY EE+ K+Y P++Y+N +QSM+ I+ AM +L +   +    ++++ +      AEEGE   EL + +  LW D  VQ C++R++EYQLNDSA YYL++LDRL+ P YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+ KSPLT+CFPEYTG+N YEEA+AYIQ QFE+LNK+K+ K IYTHFTCATDTNNIQ VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCATSAEDKAAAERSKAIDRNLRIDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEEGYSEEDCKQYKPVVYSNTIQSMIAIIRAMGSLKVDFGDGDRTDDARQLFALAGQAEEGELSPELAAVMKRLWADGGVQGCFSRSREYQLNDSASYYLNALDRLAAPGYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITKSPLTICFPEYTGSNTYEEAAAYIQMQFEDLNKRKDQKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Match: sp|P30682|GNAI_LYMST (Guanine nucleotide-binding protein G(i) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=3)

HSP 1 Score: 512.301 bits (1318), Expect = 9.965e-179
Identity = 241/354 (68.08%), Postives = 284/354 (80.23%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K+I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH KGY +EE  +Y P++Y+N +QSM+ I+ AM  L I   +    E+++       +A+EGE   EL   +  LWKD  VQ C++R++EYQLNDSA YYL++LDR+S P YIPTEQDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F+VAMSEYDL L ED   NRM ESM+LFDSICN++WF  TSIILFLNKKDLF EK+ KSPLT+CFPEYTGAN YEEA+AYIQ QFE LNKKK+TK IY+HFTCATDTNN+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCVTSQEDKAAVERSKQIDKSLRMDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEKGYSQEECLQYKPVVYSNAIQSMIAIIKAMGQLKIQFGHPDRAEDARQFFALAGHADEGEMSAELSGIMKRLWKDVGVQECFSRSREYQLNDSAEYYLNALDRISAPGYIPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFIVAMSEYDLTLAEDQEMNRMMESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKKSPLTICFPEYTGANTYEEAAAYIQLQFENLNKKKDTKEIYSHFTCATDTNNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Match: sp|B2RSH2|GNAI1_MOUSE (Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Mus musculus OX=10090 GN=Gnai1 PE=1 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 8.295e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Match: sp|P63096|GNAI1_HUMAN (Guanine nucleotide-binding protein G(i) subunit alpha-1 OS=Homo sapiens OX=9606 GN=GNAI1 PE=1 SV=2)

HSP 1 Score: 502.286 bits (1292), Expect = 8.295e-175
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +      AEEG    EL   +  LWKD  VQ C+ R++EYQLNDSA YYL+ LDR+++P+YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMTAELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Match: A0A267G4Y9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018508g1 PE=4 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 287/355 (80.85%), Postives = 318/355 (89.58%), Query Frame = 2
Query:  305 MGCAGSVP-DKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S P DKDQ  KN++IE+QLR DAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGY EEERKEYV II+AN VQSM TI+ A+ETLGI   ++A  + +KIV  YM+ AEEGEFP EL  +L  LW D ++++C+ARAKEYQLNDSAGYYLDSLDRLS P Y+PTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVED STNRMHESMRLF+SICNSQWFVNTSIILFLNK+DLF EK+ KSPLTVCF EY+G++ Y+EAS YI+ +FE+LNK+K TKTIYTHFTCATDTNNI+VVFDAVID+IIKNNLKDCGLF
Sbjct:    1 MGCANSAPVDKDQDSKNRQIEKQLRADAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYTEEERKEYVAIIFANTVQSMYTIIQALETLGIEAGDQAKAD-AKIVSGYMKTAEEGEFPDELVDSLKRLWADQAIKDCFARAKEYQLNDSAGYYLDSLDRLSAPGYLPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDQSTNRMHESMRLFESICNSQWFVNTSIILFLNKRDLFEEKIKKSPLTVCFEEYSGSDNYDEASQYIRQKFEDLNKRKATKTIYTHFTCATDTNNIKVVFDAVIDIIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Match: A0A1I8GAA8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022180g1 PE=4 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 287/355 (80.85%), Postives = 318/355 (89.58%), Query Frame = 2
Query:  305 MGCAGSVP-DKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S P DKDQ  KN++IE+QLR DAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGY EEERKEYV II+AN VQSM TI+ A+ETLGI   ++A  + +KIV  YM+ AEEGEFP EL  +L  LW D ++++C+ARAKEYQLNDSAGYYLDSLDRLS P Y+PTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVED STNRMHESMRLF+SICNSQWFVNTSIILFLNK+DLF EK+ KSPLTVCF EY+G++ Y+EAS YI+ +FE+LNK+K TKTIYTHFTCATDTNNI+VVFDAVID+IIKNNLKDCGLF
Sbjct:    1 MGCANSAPVDKDQDSKNRQIEKQLRADAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYTEEERKEYVAIIFANTVQSMYTIIQALETLGIEAGDQAKAD-AKIVSGYMKTAEEGEFPDELVDSLKRLWADQAIKDCFARAKEYQLNDSAGYYLDSLDRLSTPGYLPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDQSTNRMHESMRLFESICNSQWFVNTSIILFLNKRDLFEEKIKKSPLTVCFEEYSGSDNYDEASQYIRQKFEDLNKRKATKTIYTHFTCATDTNNIKVVFDAVIDIIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Match: A0A1I8IVW7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 283/355 (79.72%), Postives = 318/355 (89.58%), Query Frame = 2
Query:  305 MGCAGSVP-DKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S P D +Q  KN++IE+QLR DAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGY EEERKEYV I+YAN VQSM TIL A+ETLGI   ++A+  ++KIV  Y+R+AEEGEFP+EL +AL  LW D  VQ C+ARAKEYQLNDSAGYYLDSLDRL+ P Y+PTEQDVLRSRVKTTGIVET+FHFKDLDFKV+DVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVED +TNRMHESMRLF+SICNSQWFVNTSIILFLNK+DLF EK+ +S LT+CF EY+GA+ Y+EAS YI+ +FE+LNK+K TKTIYTHFTCATDTNNI+VVFDAVID+IIKNNLKDCGLF
Sbjct:    1 MGCANSAPADHNQDNKNRQIERQLRADAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYSEEERKEYVAIVYANTVQSMSTILQALETLGIEA-SDAVKSDAKIVNGYVRSAEEGEFPQELVAALRRLWVDPIVQECFARAKEYQLNDSAGYYLDSLDRLAAPGYLPTEQDVLRSRVKTTGIVETNFHFKDLDFKVYDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDQTTNRMHESMRLFESICNSQWFVNTSIILFLNKRDLFEEKIKRSSLTICFEEYSGADNYDEASQYIRVKFEDLNKRKATKTIYTHFTCATDTNNIKVVFDAVIDIIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Match: A0A5K4F0S8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 264/354 (74.58%), Postives = 305/354 (86.16%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S P K QQ+K++ IE+Q+RQDAEK+MKEVKLLLLGAGECGKST+LKQM IIHG+GY EEERKEY PII+AN VQSMV IL AME+L I+ +     +E K +  Y+   EEG+FP++L   L  LW + SVQ C+AR+KEYQLNDSAGYYL S+DR+S P Y+PTEQDVLRSRVKTTGIVET+F FKDLDFKVFDVGGQR+ERKKW+HCFEGVTAILF+VAMSEYDLKL ED +TNRMHES++LFDSICNSQWFV TSIILFLNKKDLF EK+ KSPLT+CFPEYTG   YEEAS YI+ +FE++N++K TKTIYTHFTCATD NNI+VVFDAVIDVIIK+NLKDCGLF
Sbjct:    1 MGCAWSEPAKVQQDKSRAIEKQIRQDAEKSMKEVKLLLLGAGECGKSTVLKQMKIIHGEGYREEERKEYKPIIFANTVQSMVKILKAMESLDITADGFDQADELKHLNGYLATVEEGDFPEDLSKLLLKLWNNTSVQKCFARSKEYQLNDSAGYYLGSIDRISAPDYLPTEQDVLRSRVKTTGIVETNFRFKDLDFKVFDVGGQRAERKKWLHCFEGVTAILFIVAMSEYDLKLAEDQTTNRMHESLQLFDSICNSQWFVETSIILFLNKKDLFAEKIQKSPLTICFPEYTGGQTYEEASNYIREKFEDVNRRKTTKTIYTHFTCATDNNNIRVVFDAVIDVIIKSNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Match: A0A4Z2D2G0 (Guanine nucleotide-binding protein G(I) subunit alpha OS=Schistosoma japonicum OX=6182 GN=EWB00_005122 PE=4 SV=1)

HSP 1 Score: 561.607 bits (1446), Expect = 0.000e+0
Identity = 262/354 (74.01%), Postives = 303/354 (85.59%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCA S P K QQ+K++ IE+Q+RQDAEK+MKEVKLLLLGAGECGKST+LKQM IIHG+GY EEERKEY PII+AN +QSM+ IL AME+L I  ++    EE K +  Y+   EEG+FP+EL   L  LW   SVQ C+ R+KEYQLNDSAGYYL+S+DR+S   Y+PTEQDVLRSRVKTTGIVET+F FKDLDFKVFDVGGQR+ERKKW+HCFEGVTAILF+VAMSEYDLKL ED +TNRMHES++LFDSICNSQWFV TS+ILFLNKKDLF EK+ KSPLTVCFPEYTG   YEEAS YI+ +FE++N++K TKTIYTHFTCATD NNI+VVFDAVIDVIIK+NLKDCGLF
Sbjct:    1 MGCAWSEPAKVQQDKSRAIEKQIRQDAEKSMKEVKLLLLGAGECGKSTVLKQMKIIHGEGYREEERKEYKPIIFANTLQSMIKILKAMESLDIMADDFDHAEELKHLNSYLATVEEGDFPEELSKLLRTLWSSASVQKCFTRSKEYQLNDSAGYYLNSIDRISSSDYLPTEQDVLRSRVKTTGIVETNFRFKDLDFKVFDVGGQRAERKKWLHCFEGVTAILFIVAMSEYDLKLAEDQTTNRMHESLQLFDSICNSQWFVETSMILFLNKKDLFSEKISKSPLTVCFPEYTGGQTYEEASNYIREKFEDVNRRKTTKTIYTHFTCATDNNNIRVVFDAVIDVIIKSNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Match: gnaia (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:103035761])

HSP 1 Score: 499.59 bits (1285), Expect = 1.070e-174
Identity = 231/354 (65.25%), Postives = 282/354 (79.66%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK  QE++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A  ++++ +     +AEEG    EL   +  LWKD  VQ C++R++EYQLNDSA YYL+ LDR+S  +Y+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F V++S+YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+ +SPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSSEDKVAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFSDAARADDARQLFVLAGSAEEGYMTGELAGIIQRLWKDGGVQACFSRSREYQLNDSASYYLNDLDRISSAAYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVSLSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:111193748])

HSP 1 Score: 487.263 bits (1253), Expect = 8.964e-170
Identity = 226/355 (63.66%), Postives = 279/355 (78.59%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N +QS++ I+ AM  L I   + +  ++++ +      AEE G  P +L + +  LW D  VQ C+ R++EYQLNDSA YYL+ L+R++   YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+  SPL +CFPEY+GAN Y+EA++YIQ++FE+LNKKK+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMGNLKIEYSDASRADDARQLFALSAAAEEQGILPDDLSNVIRRLWADSGVQGCFGRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITSSPLNICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Match: gnai2a (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:103033963])

HSP 1 Score: 479.559 bits (1233), Expect = 8.201e-167
Identity = 227/355 (63.94%), Postives = 282/355 (79.44%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEF-PKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E+++ I++ LR+D EKA KEVKLLLLGAGE GKSTI+KQM IIH  GY E+E ++Y  ++++N +QS++ I+ AM  L I  E+ A  ++++ +      AEE    P++L SA+  LW D  VQ+C+ R++EYQLNDSA YYL+ LDR++  +YIP++ DVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VAMS YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+  SPLT+CFPEYTGA+ Y+EAS YI+++FE+LNKKK+TK IY+HFTCATDT NIQ VFDAV DVIIKNNL+DCGLF
Sbjct:    1 MGCTVSQEDKAAAERSRHIDKSLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECRQYRAVVFSNTIQSIMAIIKAMSNLKIDYEDPARADDARQLFALAAAAEEQGALPEDLSSAITRLWSDAGVQSCFTRSREYQLNDSAAYYLNDLDRIAMSNYIPSQPDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIAHSPLTICFPEYTGASKYDEASEYIRTKFEDLNKKKDTKEIYSHFTCATDTKNIQFVFDAVTDVIIKNNLRDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:111193748])

HSP 1 Score: 455.292 bits (1170), Expect = 1.971e-157
Identity = 216/355 (60.85%), Postives = 266/355 (74.93%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTI-LKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLG      S++ L    IIH  GY E+E K+Y  ++Y+N +QS++ I+ AM  L I   + +         K     E+G  P +L + +  LW D  VQ C+ R++EYQLNDSA YYL+ L+R++   YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+  SPL +CFPEY+GAN Y+EA++YIQ++FE+LNKKK+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGDTTYSVSSLNLLCFRIIHEDGYSEDECKQYRAVVYSNTIQSIMAIIKAMGNLKIEYSDASR-------AKVTSAEEQGILPDDLSNVIRRLWADSGVQGCFGRSREYQLNDSAAYYLNDLERIARADYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITSSPLNICFPEYSGANKYDEAASYIQTKFEDLNKKKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 348          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Match: ENSAMXT00000035109.1 (pep primary_assembly:Astyanax_mexicanus-2.0:7:25573338:25606043:1 gene:ENSAMXG00000018022.2 transcript:ENSAMXT00000035109.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 451.825 bits (1161), Expect = 7.086e-156
Identity = 210/318 (66.04%), Postives = 253/318 (79.56%), Query Frame = 2
Query:  419 LGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQ--KYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            L AGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   + A     + VQ  +    + EG    EL   +  LWKD  VQ C++R++EYQLNDSA YYL+ LDR+S+ +YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +SPLT+C+PEY G+N YEEA+AYIQ QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:   36 LCAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDAARAVRKREVQVSRTEDKSSEGFMTAELAGVIKRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISQTTYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYAGSNTYEEAAAYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 353          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 500.36 bits (1287), Expect = 1.259e-175
Identity = 231/354 (65.25%), Postives = 282/354 (79.66%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E+++ I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   +    ++++ +     +AE+G    EL   +  LW D  VQ C+ RA+EYQLNDSA YYL+ L+R+S+PSY+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF+ TSIILFLNKKDLF EKV++SPLT+C+PEYTG N YEEA+AYIQ+QFE LNK+KE+K IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSTEDKAAVERSRMIDRNLREDGEKASREVKLLLLGAGESGKSTIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAEDGLMTPELAQVIKRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKVIRSPLTICYPEYTGGNTYEEAAAYIQTQFENLNKRKESKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004355.1 (pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-1 gene:ENSPMAG00000003914.1 transcript:ENSPMAT00000004355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 445.662 bits (1145), Expect = 1.204e-154
Identity = 206/319 (64.58%), Postives = 251/319 (78.68%), Query Frame = 2
Query:  410 LLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
             +  GAGE GKSTI+KQM IIH  GY E+E K+Y  ++++N +QS++ I+ AM  L I   + +  E+++ +      AEEG    +L   +  LW D  VQ C+ R++EYQLNDSA YYL+ L+R+S  SYIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED  TNRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+ KSPL++CF EY G+N YEEA+AYIQ QFE+LNK+K+TK IY+HFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    4 FVFAGAGESGKSTIVKQMKIIHEDGYSEDECKQYTAVVFSNAIQSIIAIIRAMGKLKIDFGDVSRAEDARQLFVLAGVAEEGVMTPDLSEVIKRLWSDSGVQACFRRSREYQLNDSAAYYLNDLERISNLSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEETNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKINKSPLSICFAEYIGSNTYEEAAAYIQCQFEDLNKRKDTKEIYSHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 322          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 433.335 bits (1113), Expect = 1.500e-149
Identity = 206/339 (60.77%), Postives = 255/339 (75.22%), Query Frame = 2
Query:  350 NKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            +KE+E++L +DAEK  + VKLLLLGAGE GKSTI+KQM IIH  GY E E  E+  IIY+N +QS++ I+ AMET  I   + A   + + +     + EEG  P EL + +  LWKD  VQ  + RA EYQLNDSA YYL+ LDRL  PSY+P EQDVLRSRVKTTGI+E  F FKDL F++FDVGGQRSERKKW+HCFEGVT I+F  A+S YD+ LVED   NRMHES+ LF+SICN ++F +TSI+LFLNKKDLF EKV K  L +CFP+Y G N +++A AYI++QF +LN +KE K IY+H TCATDT N++ VFDAV D+IIKNNLKDCGLF
Sbjct:    3 SKELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSLEEGSMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVHLNICFPDYDGPNTFDDAGAYIKNQFLDLNLRKEAKEIYSHLTCATDTQNVKFVFDAVTDIIIKNNLKDCGLF 341          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.449 bits (781), Expect = 5.467e-100
Identity = 153/321 (47.66%), Postives = 214/321 (66.67%), Query Frame = 2
Query:  410 LLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASA--YIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            L  +G GE GKST +KQM IIHG GY E++++ ++ +++ NV  +M  ++ AMETLGI   N      ++++++   + E+     K    A+  LW D  ++ CY R +E+QL DSA YYL+ L R+S  +Y+PT+QD+LR R+ TTGI+E  F  +++ F++ DVGGQRSER+KW+HCFE VT+I+FLVA+SEYD  LVE  S NRM ES  LF +I    WF N+S+ILFLNKKDL  EK++ S L   FP++   N ++  +A  +I   F ELN   E K IY+HFTCATDT NI+ VF AV D I++ NLK+  L
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDVRNQFDPQAAREFILRMFVELNPDTE-KVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNL 318          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.064 bits (780), Expect = 8.583e-100
Identity = 153/320 (47.81%), Postives = 213/320 (66.56%), Query Frame = 2
Query:  410 LLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASA-YIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            L  +G GE GKST +KQM IIHG GY E++++ ++ +++ NV  +M  ++ AMETLGI   N      ++++++   + E+     K    A+  LW D  ++ CY R +E+QL DSA YYL+ L R+S  +Y+PT+QD+LR R+ TTGI+E  F  +++ F++ DVGGQRSER+KW+HCFE VT+I+FLVA+SEYD  LVE  S NRM ES  LF +I    WF N+S+ILFLNKKDL  EK++ S L   FP++ G     +A+  +I   F ELN   E K IY+HFTCATDT NI+ VF AV D I++ NLK+  L
Sbjct:    1 LFCVGTGESGKSTFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREV--DVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVDYFPDFDGPQQDPQAAREFILRMFVELNPDTE-KVIYSHFTCATDTENIRFVFAAVKDAILQLNLKEYNL 317          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 299.671 bits (766), Expect = 3.384e-96
Identity = 144/329 (43.77%), Postives = 220/329 (66.87%), Query Frame = 2
Query:  398 KEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEE---SKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCY--ARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHF-KDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            KE+K+LLLGAGE GKST+L+Q+ I+H  G+ E+E KEY+P+IY N+++    ++ A     +++E E  + +   S+ +   M N   G+FP+++   ++ LW   S Q+      A ++ L DS  Y++++  R++ P+Y PT+QD+LRSR  T+GI +T      D+   ++DVGGQRSERKKW+HCF+ VT ++F V++SEYD  L+ED + NR  ES+ LFD+I NS+WF  TS++LFLNK DLF EK+ K P+   FP+YTG +   +A+ YI  +F +LN+     +IY H T ATDT+NI++VF A+ + I++N LKD G+ 
Sbjct:  122 KELKVLLLGAGESGKSTVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSYEMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGIFDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKLSKVPMENYFPDYTGGSDINKAAKYILWRFVQLNRAN--LSIYPHVTQATDTSNIRLVFAAIKETILENTLKDSGVL 448          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 246.514 bits (628), Expect = 1.548e-75
Identity = 118/234 (50.43%), Postives = 158/234 (67.52%), Query Frame = 2
Query:  668 ELGSALALLWKDD-SVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEAS-AYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            ++  A+  LW +D  ++ C+AR+ E+QL  SA YY D++++ + P+Y+ T++D+L+ R+KTTGI ET F+     FKV D GGQRSERKKW+HCFEG+TA+LF++AMSEYD  L ED   NRMHES+ LFD++ NS+WF +T  ILFLNK DLF EKV   P+   FP+Y G     EA   Y +  F  LN  K  K IY   TCATDT  ++ V  AV D+II+ NLK  G+
Sbjct:  240 DIAKAIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNIGSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKSMPIRKYFPDYQGRVGDAEAGLKYFEKIFLSLN--KTNKPIYVKRTCATDTQTMKFVLSAVTDLIIQQNLKKIGI 471          

HSP 2 Score: 79.337 bits (194), Expect = 3.236e-16
Identity = 40/104 (38.46%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  305 MGCAGSV--------PDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISME 592
            MGC  S         P    +  N  IEQ L+ + ++   E+KLLLLGAGE GKST+LKQ+ ++H  G+  +ER +Y  +I+A+ +QSM  ++     LGI ++
Sbjct:    1 MGCTVSTQTIGDESDPFLQNKRANDVIEQSLQLEKQRDKNEIKLLLLGAGESGKSTVLKQLKLLHQGGFSHQERLQYAQVIWADAIQSMKILIIQARKLGIQLD 104          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 53.1434 bits (126), Expect = 1.300e-8
Identity = 28/99 (28.28%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  827 LRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDL 1123
            +++   T G       +K++ F ++DVGGQ+  R  W H F   TA++F          +++ S+ NRM E+     SI   +   N  ++++ NK+DL
Sbjct:   42 IKTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIF----------VIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDL 130          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 45.0542 bits (105), Expect = 6.121e-6
Identity = 24/95 (25.26%), Postives = 44/95 (46.32%), Query Frame = 2
Query:  839 VKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDL 1123
            + T G       +K++ F V+DVGGQ   R  W H +     ++F          +V+ +  +R+ E+  +   + N     N + ++F NK+DL
Sbjct:   46 IPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIF----------VVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDL 130          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 501.516 bits (1290), Expect = 7.701e-176
Identity = 234/354 (66.10%), Postives = 281/354 (79.38%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR D E+A +EVKLLLLGAGE GKSTI+KQM IIH  GY +EE  +Y  ++Y+N +QSM+ I+ AM TL I   +    ++++ +     + E+ +F  EL S +  LW D  +Q C+AR++EYQLNDSA YYL++LDRL  P Y+PTEQDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRM ESM+LFDSICN++WF +TSIILFLNKKDLF EK+VKSPLT+CFPEYTG+N YEEA+AYIQ QFE LNK+K+TK IYTHFTCATDTNNIQ VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSAEDKAAAERSKMIDKNLRADGERAAREVKLLLLGAGESGKSTIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREMFALAGSMEDVKFTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKIVKSPLTICFPEYTGSNTYEEAAAYIQMQFENLNKRKDTKEIYTHFTCATDTNNIQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 417.927 bits (1073), Expect = 4.819e-143
Identity = 200/355 (56.34%), Postives = 263/355 (74.08%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++    ++K IE+ L+ +  +A ++VKLLLLGAGE GKSTI+KQM IIH  G+  E+  +Y P++++N + S++TI+ AM+ L I  EN+A + ++K+V   +  A++ E F  EL  ++  LWKD  VQ C+ R++EYQL DSA YYLDSL R+  P+Y  TEQD+LR+RVKTTGIVE  F +K L FK+FDVGGQRSERKKW+HCFE VTAI++ VA+S YDL L ED STNRM ES++LF+SI N++WFV+TS+ILFLNKKDLF EK+ K PLT+CFPEY+G + ++E + YI+ QFE  N   E K IYTH TCATDT NI  VF+AV D II NNLK CGL+
Sbjct:    1 MGCTLSAEERAAIARSKAIEKNLKLEGARAERDVKLLLLGAGESGKSTIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRIDFENDARLMDAKLVFDVIARADDTEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLFDVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKISKFPLTLCFPEYSGPSTFDEGAKYIRKQFESKNLNDE-KEIYTHLTCATDTQNINFVFNAVTDTIIANNLKGCGLY 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 352.829 bits (904), Expect = 1.155e-117
Identity = 178/357 (49.86%), Postives = 241/357 (67.51%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE---FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASA-YIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGL 1363
            M C  S   K+++  N EIE+Q+RQD     +E+KLLLLG GE GKST +KQM IIHG+GY +E+++ Y+P++Y N++ +M ++  AMETL I  ++ + +E++     Y+R  +      F +E   A   LW D  +Q CY R +EYQL+DSA YYL  LDRL++P Y+PTEQDVLR+R  T+GI+E  F  + + F++ DVGGQRSER+KW+HCFE VT+I+FLVA+SEYD  LVE  S NRM ES  LF +I    WF N+SIILFLNKKDL  EK++ S L   FPE+ G     +A+  +I   F +LN   + K IY+HFTCATDT NI+ VF AV D I++ NLK+  L
Sbjct:    1 MDCCLSEEAKERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKAS----YIRTVDPKNVTTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLETIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVEYFPEFDGPQCDAQAAREFILKMFVDLNPDTD-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL 352          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 287.345 bits (734), Expect = 4.329e-92
Identity = 148/352 (42.05%), Postives = 224/352 (63.64%), Query Frame = 2
Query:  308 GCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGI---SMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTG-ANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLK 1351
            GC  +  + +Q+ ++++I++Q+ Q+  +  ++VK+LLLGAGE GKST LKQM II+GK +  +  +EY P++Y+N+++ M  + +A   L I   + +NE   E    +Q   R   + EF  +   ++  LW D  +++ + R +E+QL DS  Y+LD LDR+    YIPT+QD+L SR  T GIVE  F  K + FK+ DVGGQRS+R KW  CF+ VT+ILFLV+ S YD  L+ED +TNR+ ES  +F++I N+++F N SIILFLNK DL  EKV  + +   FP + G  +  E+   +I   F+   +++ +K ++ HFT A DT NI+ VF AV D I++ NLK
Sbjct:    5 GCCLTQEEAEQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQAPPRI--DTEFFLQYAESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMVDVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKHTNIKDFFPAFQGDPHKLEDVQNFILQMFDS-KRRERSKALFHHFTTAVDTENIKFVFHAVKDTILQENLK 353          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 257.299 bits (656), Expect = 2.761e-80
Identity = 144/351 (41.03%), Postives = 208/351 (59.26%), Query Frame = 2
Query:  359 IEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHG-KGYPEEERKEYVPIIYANVVQSMVTILNAMETL--GISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVV--KSPLTVCFPEYTGANIYEEASA-------------YIQSQFEELNKKK--ETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLK 1351
            IE+QL++D        +LLLLGAGE GKSTI+KQM I+H   G+ E E+++ +  I  N+  +++TI  AM TL   + + N         V + +  A + ++P E      +LW+D  V  CY R+ EYQL D A Y+LD +D + +  Y+PTEQD+LR RV T+GI+ET F    + F +FDVGGQR ER+KW+ CF  VTAI+F+VA S Y+L L ED+S NR+ ES+ LF SI N++W    S+ILFLNK+DL  +KV   KS +   FP++       +A+A             +I+ +F  ++          Y HFTCA DT NI+ VF+   D+I + +L+
Sbjct:   26 IERQLKEDKIAYRATHRLLLLGAGESGKSTIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHE-VATAPDFDYPPEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEVDRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKSKIEDYFPDFARYRTPPDATAEPGDEEAVTRAKYFIRDEFLRISTASGDGKHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLR 375          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Match: gnai3 (Gi1 alpha subunit [Source:NCBI gene;Acc:100144384])

HSP 1 Score: 504.212 bits (1297), Expect = 1.600e-176
Identity = 233/354 (65.82%), Postives = 283/354 (79.94%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK  QE++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I   ++A  ++++ +     + EEG    EL   +  LWKD  VQ C++R++EYQLNDSA YYL+ LDR+S  SY+PT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLT+CFPEY G+N YEEA+AY+Q QFE+LNK+K+TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSTDDKAAQERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFADQARADDARQLFILAGSTEEGFMTGELAGVIQRLWKDGGVQACFSRSREYQLNDSAAYYLNDLDRISHASYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICFPEYAGSNTYEEAAAYVQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000020087.2 (guanine nucleotide-binding protein G(i) subunit alpha-1 [Source:NCBI gene;Acc:101157265])

HSP 1 Score: 502.286 bits (1292), Expect = 8.860e-176
Identity = 230/354 (64.97%), Postives = 284/354 (80.23%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY EEE K+Y  ++Y+N +QS++ I+ AM  L I  ++ +  E+++ +     +AEEG    EL   +  LW DD VQ C++R++EYQLNDSA YYL+ LDR+S+ +YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S+YDL L ED   NRMHESM+LFDSICN++WF +TSIILFLNKKDLF EK+ +SPL++C+PEY G+N YEEA+AYIQ QFE+LNK+++TK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTLSTEDKAAVERSKMIDRNLRDDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFKDSSRAEDARQLFVLAGSAEEGSMTTELAGVIKRLWSDDGVQACFSRSREYQLNDSAAYYLNDLDRISQANYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLSICYPEYAGSNTYEEAAAYIQCQFEDLNKRRDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Match: gnai2 (guanine nucleotide-binding protein G(i) subunit alpha 2 [Source:NCBI gene;Acc:100125814])

HSP 1 Score: 495.352 bits (1274), Expect = 5.109e-173
Identity = 234/355 (65.92%), Postives = 280/355 (78.87%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   +++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N VQS++ I+ AM  L +  E     E++K + K    AEE G+ P+EL + +  LW D  +Q+C  RA+EYQLNDSA YYL  L+R+S+P YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VAMS YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF +K+  SPLT+CFPEY G N Y+EA AYIQ++FE+LNKKKETK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSQEDKAAADRSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTVQSIMAIIKAMTILHLDYERPEREEDAKRLFKMAAEAEERGDLPEELANIIKDLWADSGIQHCLTRAREYQLNDSAAYYLKDLERISKPDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIAHSPLTICFPEYEGPNTYQEAQAYIQTKFEDLNKKKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Match: gnai2 (guanine nucleotide-binding protein G(i) subunit alpha 2 [Source:NCBI gene;Acc:100125814])

HSP 1 Score: 495.352 bits (1274), Expect = 5.109e-173
Identity = 234/355 (65.92%), Postives = 280/355 (78.87%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   +++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N VQS++ I+ AM  L +  E     E++K + K    AEE G+ P+EL + +  LW D  +Q+C  RA+EYQLNDSA YYL  L+R+S+P YIPT+QDVLR+RVKTTGIVETHF FKDL FK+FDVGGQRSERKKW+HCFEGVTAI+F VAMS YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF +K+  SPLT+CFPEY G N Y+EA AYIQ++FE+LNKKKETK IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSQEDKAAADRSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTVQSIMAIIKAMTILHLDYERPEREEDAKRLFKMAAEAEERGDLPEELANIIKDLWADSGIQHCLTRAREYQLNDSAAYYLKDLERISKPDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVAMSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEQKIAHSPLTICFPEYEGPNTYQEAQAYIQTKFEDLNKKKETKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Match: gnai2b (guanine nucleotide-binding protein G(i) subunit alpha-2 [Source:NCBI gene;Acc:105358374])

HSP 1 Score: 485.337 bits (1248), Expect = 4.565e-169
Identity = 223/355 (62.82%), Postives = 283/355 (79.72%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEE-GEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  DK   E++K I++ LR+D EKA +EVKLLLLGAGE GKSTI+KQM IIH  GY E+E K+Y  ++Y+N +QS++ I+ AM +L I   + A +++++ +      AEE G  P +L + +  LW D  +Q+C+ R++EYQLNDSA YYL+ L+R+++  YIPT+QDVLR+RVKTTGIVETHF FK+L FK+FDVGGQRSERKKW+HCFEGVTAI+F VA+S YDL L ED   NRMHESM+LFDSICN++WF  TSIILFLNKKDLF EK+  SPL++CFPEY+GAN ++EA++YIQ++FE+LNKKK+T  IYTHFTCATDT N+Q VFDAV DVIIKNNLKDCGLF
Sbjct:    1 MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYRAVVYSNTIQSIMAIVKAMASLKIDYSDPARMDDAQQLFALSAAAEEQGILPDDLANVMRRLWADSGIQSCFTRSREYQLNDSAAYYLNDLERIAKADYIPTQQDVLRTRVKTTGIVETHFTFKELHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKITHSPLSICFPEYSGANKFDEAASYIQTKFEDLNKKKDTNEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF 355          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Match: SMESG000026774.1 (SMESG000026774.1)

HSP 1 Score: 738.413 bits (1905), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF
Sbjct:    1 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Match: SMESG000054823.1 (SMESG000054823.1)

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 252/354 (71.19%), Postives = 304/354 (85.88%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  +  D+DQQ++N+EIE+Q+R DAEK+MKEVKLLLLG GECGKSTILKQMTIIHGKG+ E++R++Y+PII +N++ S+  I+NAM++L IS+ENE+++E   ++Q+Y +     E PK+LG +L  LW D  +  CY+R+ EYQLNDSA Y+LDS++R+ EP+YIPTEQD+LRSRVKTTGI+ETHFHFKDL+F+VFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKL ED + NRMHESM+LFDSI NS+WFV+TSIILFLNKKDLF EK++ SPL  CF +YTG N Y EAS YIQ  FE LNKKK +KTIYTHFTCATDTNN+QVVFDAVIDVIIKNNLKDCGLF
Sbjct:    1 MGCLNTTLDQDQQDRNREIEKQIRCDAEKSMKEVKLLLLGTGECGKSTILKQMTIIHGKGFSEDDRRQYIPIIISNLIDSINVIINAMDSLEISLENESLLESIYLIQRYSKFNNLMELPKDLGQSLISLWLDRGILKCYSRSSEYQLNDSAAYFLDSVERIIEPTYIPTEQDILRSRVKTTGIIETHFHFKDLNFQVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLKEDPNINRMHESMKLFDSISNSKWFVSTSIILFLNKKDLFAEKILVSPLKECFEDYTGNNSYNEASRYIQETFEMLNKKKLSKTIYTHFTCATDTNNVQVVFDAVIDVIIKNNLKDCGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Match: SMESG000017017.1 (SMESG000017017.1)

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 248/354 (70.06%), Postives = 291/354 (82.20%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  +  Q+E +KEIE+QLR D EKAM+E+KLLLLGAGECGKSTILKQM+IIHG GY +EE+KE++PIIYAN+VQSM  IL AM+ L I +EN  +  E   V + M+NAEEG        AL +LWKD  VQ  + R+KEYQLNDSA YYL  L+R++  +YIPT QD+LRSR+KTTGI+ET+FHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVA+SEYDL+LVEDS+TNRMHESM+LFDSICNS WFVNTS+ILFLNK DLF  K+ +SPLT+CFPEY G N + + S YI+ +FE LNKKK +K IYTHFTCATDT N+QVVFDAVID+IIKNNLKD GLF
Sbjct:    1 MGCINSTKNVVQEEAHKEIEKQLRIDQEKAMREIKLLLLGAGECGKSTILKQMSIIHGGGYSDEEKKEFIPIIYANIVQSMGAILKAMDILEIPLENANLGTEKNTVHESMKNAEEGGMTINTIKALTVLWKDTGVQEAFNRSKEYQLNDSAEYYLIDLERIASDNYIPTVQDILRSRIKTTGIIETYFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVALSEYDLRLVEDSTTNRMHESMKLFDSICNSPWFVNTSVILFLNKVDLFEIKIQRSPLTICFPEYLGPNTFVDTSNYIREKFEGLNKKKNSKVIYTHFTCATDTTNVQVVFDAVIDIIIKNNLKDVGLF 354          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Match: SMESG000075477.1 (SMESG000075477.1)

HSP 1 Score: 511.916 bits (1317), Expect = 1.199e-179
Identity = 242/354 (68.36%), Postives = 294/354 (83.05%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  D+ QQE NK IE+QLR DAEKAMKEVKLLLLGAGECGKSTILKQM+IIHG GY E ERK+++PIIY+N++QS+VTIL AMETL I + NE +  +  +V   +++ + G   ++   ++  LW++  VQ C  RAKEY LNDSA YYL+ +DRL   +Y+P +QD+LRSRVKTTGI+ET FHFK+LDFKV+DVGGQRSERKKWMHCFEGVTAILFL+AMSEYDLKLVED +TNRMHESM+LF+SICNSQWF +TSIILFLNKKDLF +K+  SP+T+CF +Y G + YEE S +I+ +FE+LNK K+TKTIY+HFTCATDTNNI+VVF+AVIDVIIKNNLKD GLF
Sbjct:    1 MGCINSSHDEPQQELNKNIEKQLRIDAEKAMKEVKLLLLGAGECGKSTILKQMSIIHGDGYSESERKKFIPIIYSNIIQSVVTILKAMETLEIKL-NEHLHSDKLLVIDQVKDVDNGVLRQDAVESIKKLWQNVEVQQCVQRAKEYNLNDSAEYYLNDIDRLRGDNYLPNDQDILRSRVKTTGIIETEFHFKNLDFKVYDVGGQRSERKKWMHCFEGVTAILFLIAMSEYDLKLVEDQTTNRMHESMKLFESICNSQWFTSTSIILFLNKKDLFMKKIEISPITICFKDYNGPHNYEETSNFIRLKFEDLNKSKDTKTIYSHFTCATDTNNIEVVFNAVIDVIIKNNLKDVGLF 353          
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 455.677 bits (1171), Expect = 1.487e-157
Identity = 218/355 (61.41%), Postives = 271/355 (76.34%), Query Frame = 2
Query:  305 MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTILKQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAMIEESKIVQKYMRNAEEGE-FPKELGSALALLWKDDSVQNCYARAKEYQLNDSAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFDVGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLFDSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEASAYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKDCGLF 1366
            MGC  S  ++D  +K++ I+++L++D  +A K+VKLLLLGAGE GKSTI+KQM IIH  G+ +E+ K+Y P++Y+N  QSM+ IL AM TLGIS  +     ++K+V   ++  E+ E F +EL  A+  LW D  VQ C+ R+ EYQLNDSA Y+LD LDRL    Y+PTEQD+LR+RVKTTGIVE HF FK+++FK+FDVGGQRSERKKW+HCFE VTAI+F VAMSEYD  L ED +TNRM ES++LFDSICN++WF +TSIILFLNKKDLF EK+ KSPLTVCFPEY G   YEEA+AYIQ+ FE  N     K IY H TCATDTNNIQ VFDAV DVII NNL+ CGL+
Sbjct:    1 MGCTMSKDERDALDKSRNIDKKLKEDGMQAAKDVKLLLLGAGESGKSTIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIKKSPLTVCFPEYPGKQTYEEAAAYIQASFEAKNNSP-NKEIYCHQTCATDTNNIQFVFDAVTDVIIANNLRGCGLY 354          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAI11.727e-17565.82G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.727e-17565.82G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.727e-17565.82G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.727e-17565.82G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
GNAI11.727e-17565.82G protein subunit alpha i1 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
goa-14.303e-15761.41Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-168.574e-15559.10Guanine nucleotide-binding protein alpha-16 subuni... [more]
gpa-42.066e-14456.39Guanine nucleotide-binding protein alpha-4 subunit... [more]
gpa-72.132e-13152.56Guanine nucleotide-binding protein alpha-7 subunit... [more]
gpa-34.762e-13151.98Guanine nucleotide-binding protein alpha-3 subunit... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphai5.255e-15961.69gene:FBgn0001104 transcript:FBtr0076934[more]
Galphao3.897e-15761.13gene:FBgn0001122 transcript:FBtr0088267[more]
Galphao3.897e-15761.13gene:FBgn0001122 transcript:FBtr0088269[more]
Galphao3.897e-15761.13gene:FBgn0001122 transcript:FBtr0088264[more]
Galphao3.897e-15761.13gene:FBgn0001122 transcript:FBtr0088268[more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai12.679e-17465.54guanine nucleotide binding protein (G protein), al... [more]
gnai2b1.228e-17164.23guanine nucleotide binding protein (G protein), al... [more]
gnaia2.819e-16963.28guanine nucleotide binding protein (G protein), al... [more]
gnaia2.819e-16963.28guanine nucleotide binding protein (G protein), al... [more]
gnai2a1.175e-16864.51guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai16.780e-17365.25guanine nucleotide binding protein (G protein), al... [more]
gnai13.389e-17265.25guanine nucleotide binding protein (G protein), al... [more]
gnai21.475e-16962.82guanine nucleotide binding protein (G protein), al... [more]
rgp16.329e-16962.99RGP1 homolog, RAB6A GEF complex partner 1 [Source:... [more]
gnao13.542e-15861.13G protein subunit alpha o1 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnai11.186e-17565.82guanine nucleotide binding protein (G protein), al... [more]
Gnai37.495e-17264.12guanine nucleotide binding protein (G protein), al... [more]
Gnai21.179e-16963.94guanine nucleotide binding protein (G protein), al... [more]
Gnai21.179e-16963.94guanine nucleotide binding protein (G protein), al... [more]
Gnao14.426e-15861.13guanine nucleotide binding protein, alpha O [Sourc... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51876|GNAI_PLATR2.337e-17968.36Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P30676|GNAI_PATPE3.901e-17966.95Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P30682|GNAI_LYMST9.965e-17968.08Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|B2RSH2|GNAI1_MOUSE8.295e-17565.82Guanine nucleotide-binding protein G(i) subunit al... [more]
sp|P63096|GNAI1_HUMAN8.295e-17565.82Guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G4Y90.000e+080.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GAA80.000e+080.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IVW70.000e+079.72Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K4F0S80.000e+074.58Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4Z2D2G00.000e+074.01Guanine nucleotide-binding protein G(I) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnaia1.070e-17465.25guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b8.964e-17063.66guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2a8.201e-16763.94guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b1.971e-15760.85guanine nucleotide-binding protein G(i) subunit al... [more]
ENSAMXT00000035109.17.086e-15666.04pep primary_assembly:Astyanax_mexicanus-2.0:7:2557... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai31.259e-17565.25guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000004355.11.204e-15464.58pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-... [more]
gnat21.500e-14960.77guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000007349.15.467e-10047.66pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007354.18.583e-10047.81pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GPA23.384e-9643.77Nucleotide binding alpha subunit of the heterotrim... [more]
GPA11.548e-7550.43Subunit of the G protein involved in pheromone res... [more]
ARF31.300e-828.28Glucose-repressible ADP-ribosylation factor; GTPas... [more]
ARF16.121e-625.26ADP-ribosylation factor; GTPase of the Ras superfa... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496927.701e-17666.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325404.819e-14356.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414651.155e-11749.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479934.329e-9242.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491932.761e-8041.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnai31.600e-17665.82Gi1 alpha subunit [Source:NCBI gene;Acc:100144384][more]
ENSORLT00000020087.28.860e-17664.97guanine nucleotide-binding protein G(i) subunit al... [more]
gnai25.109e-17365.92guanine nucleotide-binding protein G(i) subunit al... [more]
gnai25.109e-17365.92guanine nucleotide-binding protein G(i) subunit al... [more]
gnai2b4.565e-16962.82guanine nucleotide-binding protein G(i) subunit al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(I) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026774.10.000e+0100.00SMESG000026774.1[more]
SMESG000054823.10.000e+071.19SMESG000054823.1[more]
SMESG000017017.10.000e+070.06SMESG000017017.1[more]
SMESG000075477.11.199e-17968.36SMESG000075477.1[more]
SMESG000055191.11.487e-15761.41SMESG000055191.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005718 ID=SMED30005718|Name=Guanine nucleotide-binding protein G(I) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1784bp
TCTTCCGATCTCATTGATTTTTAGTAACGCTTCCTAGCTGGATGGTGAAG
CCTGTGGAAAAAGGGGCAAGAGAAACCCCAATACGAAACAATTCGCTACT
CACAACAGCGTATGATGTAACTCAAATTCGAGGAGGAAATTTCATCTGGC
AACACACAATATCAAACGATGGGATATATTCACTGGGAATCCTGCATCAC
TCCGATTGGAGATTGGTCGAATGTTTGTTTACTTTTAACAAACAAAAGTT
ATCAGCAATTTATTGAAAAAACGAAAACTTCTTTTGTACAATTTGCAACT
CAATATGGGATGTGCTGGCAGCGTACCTGATAAGGATCAGCAAGAGAAAA
ATAAGGAAATCGAACAACAGCTTCGACAGGATGCGGAAAAAGCCATGAAA
GAAGTCAAACTGTTGCTGTTGGGAGCCGGAGAGTGCGGCAAATCGACAAT
TCTCAAACAAATGACCATCATTCACGGAAAAGGTTATCCGGAAGAGGAAA
GAAAGGAATATGTACCGATTATCTATGCAAACGTCGTTCAAAGTATGGTT
ACGATTCTCAATGCAATGGAAACTCTTGGAATCTCCATGGAAAACGAGGC
CATGATTGAAGAATCGAAAATCGTCCAAAAATATATGCGCAACGCCGAAG
AGGGAGAATTCCCGAAAGAATTAGGAAGTGCACTTGCATTGTTATGGAAA
GACGATAGTGTTCAGAACTGTTATGCTCGAGCGAAAGAGTATCAGTTAAA
TGATTCCGCCGGTTACTATTTAGACTCTCTGGATCGTTTATCAGAACCTT
CATACATTCCGACAGAACAGGATGTGCTACGAAGTCGAGTTAAAACTACC
GGAATTGTCGAAACTCATTTCCATTTCAAAGATCTCGATTTCAAAGTTTT
TGATGTCGGTGGTCAACGATCTGAAAGAAAGAAATGGATGCACTGTTTTG
AAGGAGTAACGGCCATTCTATTCTTAGTGGCGATGTCAGAGTATGACCTA
AAACTTGTTGAAGACTCCAGCACGAATCGAATGCACGAATCTATGAGACT
GTTTGATTCCATTTGTAACAGTCAATGGTTTGTCAATACAAGCATTATTT
TATTTTTGAATAAGAAAGATTTGTTTGGCGAGAAAGTTGTCAAATCTCCT
TTGACAGTTTGTTTTCCGGAATACACTGGAGCAAATATCTATGAAGAAGC
CAGTGCTTATATTCAGTCTCAATTCGAAGAACTGAATAAGAAAAAAGAAA
CGAAAACGATTTACACTCATTTTACTTGCGCCACAGACACCAACAATATC
CAGGTTGTGTTTGACGCTGTCATAGATGTCATCATCAAGAATAATCTTAA
AGATTGCGGTCTATTCTAAATTGGAAACCAAACCGAAAAAAAGAATATTT
TTACACTCGTATTGTAGAAAACTTTAGATGAGAACATTTTTTTCGAATAA
TTTTCTTTAACCTGTTTGCATATCAGCCTAATGGTATGCTAAAGCATATC
TTTATATATATGATTATTATCATTTTTGTATCTTGCACCGCTTGCTAAAA
TGCATTCCTGACTTTCTTGGCATTTGAATTATTTTTTAAAAAATTTTTTT
TATTAGTTAAAAAAAGTTGAGAATTTATTTATTTATAACACCCCCCTCAC
TGTGTAATGAACGCTTTCACAGCCTCTGTGTATAAAATTATCGTTGGGAA
TCAAGTCCATCATTTACAATTGCCGTCCAAAATCGTATTTTGAGTTTTTT
TATTGTGAAATTCAATAAATTATTTAAGAAAAAT
back to top

protein sequence of SMED30005718-orf-1

>SMED30005718-orf-1 ID=SMED30005718-orf-1|Name=SMED30005718-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MGCAGSVPDKDQQEKNKEIEQQLRQDAEKAMKEVKLLLLGAGECGKSTIL
KQMTIIHGKGYPEEERKEYVPIIYANVVQSMVTILNAMETLGISMENEAM
IEESKIVQKYMRNAEEGEFPKELGSALALLWKDDSVQNCYARAKEYQLND
SAGYYLDSLDRLSEPSYIPTEQDVLRSRVKTTGIVETHFHFKDLDFKVFD
VGGQRSERKKWMHCFEGVTAILFLVAMSEYDLKLVEDSSTNRMHESMRLF
DSICNSQWFVNTSIILFLNKKDLFGEKVVKSPLTVCFPEYTGANIYEEAS
AYIQSQFEELNKKKETKTIYTHFTCATDTNNIQVVFDAVIDVIIKNNLKD
CGLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000461lateral branch
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR001019Gprotein_alpha_su
IPR001408Gprotein_alpha_I
IPR011025GproteinA_insert
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0004871signal transducer activity
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0019001guanyl nucleotide binding
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007188adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 9..30
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 18..344
e-value: 1.2E-145
score: 486.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..24
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..24
NoneNo IPR availablePANTHERPTHR10218:SF73GUANINE NUCLEOTIDE-BINDING PROTEIN G(I) SUBUNIT ALPHA-2coord: 1..353
NoneNo IPR availablePROSITEPS51882G_ALPHAcoord: 32..354
score: 104.502
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPRINTSPR00318GPROTEINAcoord: 167..189
score: 71.19
coord: 264..273
score: 85.36
coord: 218..246
score: 61.03
coord: 196..213
score: 75.87
coord: 35..50
score: 81.85
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitSMARTSM00275galpha_1coord: 13..353
e-value: 1.9E-213
score: 725.1
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPFAMPF00503G-alphacoord: 14..343
e-value: 3.1E-120
score: 401.6
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 1..353
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitCDDcd00066G-alphacoord: 34..348
e-value: 0.0
score: 554.829
IPR001408G-protein alpha subunit, group IPRINTSPR00441GPROTEINAIcoord: 343..354
score: 82.31
coord: 278..290
score: 66.53
coord: 296..307
score: 70.18
coord: 79..88
score: 52.63
coord: 185..195
score: 70.18
IPR011025G protein alpha subunit, helical insertionGENE3DG3DSA:1.10.400.10coord: 62..180
e-value: 1.2E-145
score: 486.7
IPR011025G protein alpha subunit, helical insertionSUPERFAMILYSSF47895Transducin (alpha subunit), insertion domaincoord: 61..181
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 14..351