BAR domain-containing protein

Overview
NameBAR domain-containing protein
Smed IDSMED30005717
Length (bp)1305
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BAR domain-containing protein (SMED30005717) t-SNE clustered cells

Violin plots show distribution of expression levels for BAR domain-containing protein (SMED30005717) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BAR domain-containing protein (SMED30005717) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BAR domain-containing protein (SMED30005717) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005717

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
ovarySMED30005717SMESG000000639.1 SMED30005717smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30005717SMESG000000639.1 SMED30005717smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30005717SMESG000000639.1 SMED30005717smed_20140614PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
intestinal phagocyteSMED30005717SMESG000066154.1 Contig678GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005717SMESG000000639.1 Contig678GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30005717SMESG000000639.1 dd_Smed_v4_1387_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 194.897 bits (494), Expect = 1.528e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 184.111 bits (466), Expect = 3.314e-53
Identity = 109/276 (39.49%), Postives = 149/276 (53.99%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA---------------------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +                      +  ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSQLNSARLEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 273          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB1 (SH3 domain containing GRB2 like, endophilin B1 [Source:HGNC Symbol;Acc:HGNC:10833])

HSP 1 Score: 180.259 bits (456), Expect = 1.168e-51
Identity = 110/284 (38.73%), Postives = 150/284 (52.82%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA--------------IQI---------------ADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +               I +               ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSQLNSARLEGDNIMVNFSYMLNFLHVKWLKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 281          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 169.088 bits (427), Expect = 1.180e-47
Identity = 104/259 (40.15%), Postives = 149/259 (57.53%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA--------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDF  KK  S A     RAVQ TEE F QAEKTE D +F +L  + D T+ WTE I++  EV  +PNP++      R+E  + EKL+RK   R+   E L   +  A +E+G  T YGKTL+K  ++E  +G A++   +    +++  L+ FL  D K I+ ER+ L+N RLDLD  K ++KKAK  +A        +  A+ EL+ AQ +FD Q  + +L LEGI + H  HL    +F+  Q  YYA+C++ M DL
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA------RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDL 253          
BLAST of BAR domain-containing protein vs. Ensembl Human
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 162.925 bits (411), Expect = 3.008e-45
Identity = 100/280 (35.71%), Postives = 144/280 (51.43%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDL-------------------------AKNKMKKAKTE----QAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDF  KK  S A     RAVQ TEE F QAEKTE D +F +L  + D T+ WTE I++  EV  +PNP++      R+E  + EKL+RK   R+   E L   +  A +E+G  T YGKTL+K  ++E  +G A++   +    +++  L+ FL  D K I+ ER+ L+N RLDLD                           +N +  A         +  A+ EL+ AQ +FD Q  + +L LEGI + H  HL    +F+  Q  YYA+C++ M DL
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTEKILRQTEVLLQPNPSA------RVEEFLYEKLDRKVPSRVTNGELLAQYMADAASELGPTTPYGKTLIKVAEAEKQLGAAERDFIHTASISFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATTVPDFQETRPRNYILSASASALWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDL 274          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800045:3802767:-1 gene:WBGene00001335.1 transcript:F35A5.8c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 180.259 bits (456), Expect = 1.380e-52
Identity = 101/258 (39.15%), Postives = 153/258 (59.30%), Query Frame = 3
Query:   27 ISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTD--RMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            +  +FKK  S A    +RA Q TEETFL+AE+TE D +F +L ++ D T+  T  ++  IE + +PNP        RME +  EKLE K+    R N  E+L   + +AG + G  T YG  L+K  Q+E  +G+A+++L  +   N +  ++ FL  D+K I  ERK L + RLDLD  K+++KKAKT     +A+ +++ AQ +FD Q  I KL LEGI+T HN  L+  + F+  Q  +YA+ H++M DL  +L+
Sbjct:    1 MDFNFKKIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPNPTV------RMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELS 252          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800737:3802771:-1 gene:WBGene00001335.1 transcript:F35A5.8b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 174.096 bits (440), Expect = 4.421e-51
Identity = 102/271 (37.64%), Postives = 154/271 (56.83%), Query Frame = 3
Query:   27 ISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTD--RMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQ-------------AIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            +  +FKK  S A    +RA Q TEETFL+AE+TE D +F +L ++ D T+  T  ++  IE + +PNP        RME +  EKLE K+    R N  E+L   + +AG + G  T YG  L+K  Q+E  +G+A+++L  +   N +  ++ FL  D+K I  ERK L + RLDLD  K+++KKAKT                I+ A+ +++ AQ +FD Q  I KL LEGI+T HN  L+  + F+  Q  +YA+ H++M DL  +L+
Sbjct:    1 MDFNFKKIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPNPTV------RMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVTNSKTSGGFTIEQAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELS 265          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: F35A5.8 (pep chromosome:WBcel235:X:3800045:3802771:-1 gene:WBGene00001335.1 transcript:F35A5.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F35A5.8)

HSP 1 Score: 173.326 bits (438), Expect = 7.926e-50
Identity = 102/271 (37.64%), Postives = 154/271 (56.83%), Query Frame = 3
Query:   27 ISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTD--RMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQ-------------AIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            +  +FKK  S A    +RA Q TEETFL+AE+TE D +F +L ++ D T+  T  ++  IE + +PNP        RME +  EKLE K+    R N  E+L   + +AG + G  T YG  L+K  Q+E  +G+A+++L  +   N +  ++ FL  D+K I  ERK L + RLDLD  K+++KKAKT                I+ A+ +++ AQ +FD Q  I KL LEGI+T HN  L+  + F+  Q  +YA+ H++M DL  +L+
Sbjct:    1 MDFNFKKIASDAGGFFSRAKQLTEETFLKAERTELDSHFENLLQRADKTEDHTRRLLSAIEGYLQPNPTV------RMEEVFYEKLELKKDGAIRQNNLEQLSTAMTEAGEQFGETTPYGSALLKVAQTENRLGQAERELCGQAATNTLLPIRRFLEGDMKTIQKERKVLNSKRLDLDACKSRLKKAKTVDLQTVTNSKTSGGFTIEQAEADVRVAQAEFDKQSEITKLLLEGIQTAHNNQLKCLRDFVEAQMSFYAQSHQLMADLQRELS 265          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 66.6254 bits (161), Expect = 8.314e-12
Identity = 46/176 (26.14%), Postives = 82/176 (46.59%), Query Frame = 3
Query:   51 VSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKK 578
            +SG     N+A Q   ET   AE T+ D  F ++ K  D T      ++     + +PNPA+  K A ++ +L   +   K +        L + + K G ++G  +  GK+L  A ++   +   K Q+ + +  N++  L    N +LK++N  R  L+  RLD D  K + ++
Sbjct:    3 LSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQV-ALSKVRGTTKTSPYPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR 177          
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Match: unc-57 (Endophilin-A homolog [Source:UniProtKB/Swiss-Prot;Acc:B1V8A0])

HSP 1 Score: 66.6254 bits (161), Expect = 8.696e-12
Identity = 46/176 (26.14%), Postives = 82/176 (46.59%), Query Frame = 3
Query:   51 VSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKK 578
            +SG     N+A Q   ET   AE T+ D  F ++ K  D T      ++     + +PNPA+  K A ++ +L   +   K +        L + + K G ++G  +  GK+L  A ++   +   K Q+ + +  N++  L    N +LK++N  R  L+  RLD D  K + ++
Sbjct:    3 LSGLRKQFNKANQYLSETMGAAEPTKLDDVFNEMEKNVDTTYNLITDLVAGTNEYLQPNPATRAKMATQV-ALSKVRGTTKTSPYPQTEGMLADVMQKYGQQLGDNSDLGKSLNDAAETYRQMADIKYQMEDNVKQNFLDPLTHLQNNELKDVNHHRTKLKGRRLDYDCKKRQQRR 177          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0113098)

HSP 1 Score: 167.548 bits (423), Expect = 1.418e-47
Identity = 92/254 (36.22%), Postives = 143/254 (56.30%), Query Frame = 3
Query:   30 SMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            + + K  V  A + ++R VQ TEE     E+TEYD +F +LA++ D+T+ WTE I++D E    PNP       NR+E  + EK+E+ +  R++  E L   +++AG + G +  YG+ L+K GQ+E  +G+ +          +   L+ FL+ ++K I  ER  LE  RLDLD  KN++KKA++    Q A+ +L+ AQ +FD Q  I KL L+GI T    HL     F+  Q  YY +C  +M+ L  +L
Sbjct:    7 NFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQ------NRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 254          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086559)

HSP 1 Score: 167.548 bits (423), Expect = 2.383e-47
Identity = 92/254 (36.22%), Postives = 143/254 (56.30%), Query Frame = 3
Query:   30 SMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            + + K  V  A + ++R VQ TEE     E+TEYD +F +LA++ D+T+ WTE I++D E    PNP       NR+E  + EK+E+ +  R++  E L   +++AG + G +  YG+ L+K GQ+E  +G+ +          +   L+ FL+ ++K I  ER  LE  RLDLD  KN++KKA++    Q A+ +L+ AQ +FD Q  I KL L+GI T    HL     F+  Q  YY +C  +M+ L  +L
Sbjct:    7 NFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNPQ------NRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 254          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0113097)

HSP 1 Score: 161.77 bits (408), Expect = 2.773e-45
Identity = 92/266 (34.59%), Postives = 145/266 (54.51%), Query Frame = 3
Query:   30 SMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKT------------EQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            + + K  V  A + ++R VQ TEE     E+TEYD +F +LA++ D+T+ WTE I++D E    PNP       NR+E  + EK+E+ +  R++  E L   +++AG + G +  YG+ L+K GQ+E  +G+ +          +   L+ FL+ ++K I  ER  LE  RLDLD  KN++KKA++            E  ++ A+ +L+ AQ +FD Q  I KL L+GI T    HL     F+  Q  YY +C  +M+ L  +L
Sbjct:    7 NFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNP------QNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 266          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoB (gene:FBgn0034433 transcript:FBtr0086558)

HSP 1 Score: 161.77 bits (408), Expect = 4.263e-45
Identity = 92/266 (34.59%), Postives = 145/266 (54.51%), Query Frame = 3
Query:   30 SMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKT------------EQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            + + K  V  A + ++R VQ TEE     E+TEYD +F +LA++ D+T+ WTE I++D E    PNP       NR+E  + EK+E+ +  R++  E L   +++AG + G +  YG+ L+K GQ+E  +G+ +          +   L+ FL+ ++K I  ER  LE  RLDLD  KN++KKA++            E  ++ A+ +L+ AQ +FD Q  I KL L+GI T    HL     F+  Q  YY +C  +M+ L  +L
Sbjct:    7 NFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEKIVRDTESVLIPNP------QNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQALIKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNRVKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYYKQCGDVMEQLQREL 266          
BLAST of BAR domain-containing protein vs. Ensembl Fly
Match: EndoA (gene:FBgn0038659 transcript:FBtr0083699)

HSP 1 Score: 59.6918 bits (143), Expect = 1.669e-9
Identity = 52/243 (21.40%), Postives = 108/243 (44.44%), Query Frame = 3
Query:   54 SGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIE-TTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            +G    +N+A Q   E    AE T+ D  F+++ +K D+T    E +    + F +PNP +  K A  ++ +     + K          L   ++  G ++G + + + + L++ G++   +   K  L + I  N++  L      DLK +   RK L+  RLD D  + +          Q  D E++ A+  F + L +A++ +  +     +H+     F     +++++C  +++ L
Sbjct:    4 AGLKKQINKANQYMTEKMGGAEGTKLDMDFMEMERKTDVTVELVEELQLKTKEFLQPNPTARAKMA-AVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGEALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRR----------QAKDDEIRGAEDKFGESLQLAQVGMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGL 235          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 182.185 bits (461), Expect = 4.831e-53
Identity = 101/255 (39.61%), Postives = 144/255 (56.47%), Query Frame = 3
Query:   27 ISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            +  + ++  + A T L+RAVQ TEE F QAEKTE D +   L  + + T+ WTE I+K  EV  +PNP        R+E  + E L++K   R N  E LG  ++ +G E G  T YG  L+K G++E  +G A+K+  +    N++   + F+  D K I  ERK L+N RLDLD AKN+MKKA+   A   A+ EL+ AQ +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++   +L   L
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNV------RVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQL 249          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 182.185 bits (461), Expect = 5.287e-53
Identity = 103/255 (40.39%), Postives = 145/255 (56.86%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            M+F  ++  + A T L+RAVQ TEE F QAEKTE D +   L  + + T+ WTE I+K  EV  +PNP        R+E  + E L++K   R N  E LG  ++ +G E G  T YG  L+K G++E  +G A+K+  +    N++   + F+  D K I  ERK L+N RLDLD AKN+MKKA+   A   A+ EL+ AQ +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++   +L   L
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNV------RVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQL 249          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 180.259 bits (456), Expect = 2.395e-52
Identity = 108/251 (43.03%), Postives = 148/251 (58.96%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDF  K+F + A T  +RAVQ TEE F QAEKTE D +   L  + + T+ WTE I+K  EV  +PNP +      R+E L+ EKL++K   RMN  E +G +++ +G E G  T YG  L+K G++E  IG A+++       N++   + FL  D K I  ERK L+N RLDLD AK K+KKAK   A  +A+ +LK  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL
Sbjct:    1 MDFNVKRFAADAGTLFSRAVQFTEEKFGQAEKTELDAHLETLLTRAECTKHWTEKILKQTEVLLQPNPNA------RIEELLYEKLDKKAPPRMNNHELMGQSMIDSGNEFGPGTAYGNALIKCGETEKQIGGAEREFIQTSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMADARAVAEQDLKMTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMVDL 245          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 180.259 bits (456), Expect = 2.395e-52
Identity = 108/251 (43.03%), Postives = 148/251 (58.96%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDF  K+F + A T  +RAVQ TEE F QAEKTE D +   L  + + T+ WTE I+K  EV  +PNP +      R+E L+ EKL++K   RMN  E +G +++ +G E G  T YG  L+K G++E  IG A+++       N++   + FL  D K I  ERK L+N RLDLD AK K+KKAK   A  +A+ +LK  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL
Sbjct:    1 MDFNVKRFAADAGTLFSRAVQFTEEKFGQAEKTELDAHLETLLTRAECTKHWTEKILKQTEVLLQPNPNA------RIEELLYEKLDKKAPPRMNNHELMGQSMIDSGNEFGPGTAYGNALIKCGETEKQIGGAEREFIQTSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMADARAVAEQDLKMTQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMVDL 245          
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 166.777 bits (421), Expect = 7.351e-47
Identity = 101/284 (35.56%), Postives = 144/284 (50.70%), Query Frame = 3
Query:   27 ISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQI-----------------------------ADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            +  + ++  + A T L+RAVQ TEE F QAEKTE D +   L  + + T+ WTE I+K  EV  +PNP        R+E  + E L++K   R N  E LG  ++ +G E G  T YG  L+K G++E  +G A+K+  +    N++   + F+  D K I  ERK L+N RLDLD AKN+MKKA+   A                                A+ EL+ AQ +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++   +L   L
Sbjct:    1 MEFNVRRLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLEMLLSRAESTKHWTEKIMKQTEVVLQPNPNV------RVEEFLYEILDKKVPTRANNHEMLGQCMIDSGHEFGPGTAYGSALIKCGETEKLLGSAEKEFIHSSAINFLTPFRNFIEGDFKTILKERKLLQNKRLDLDAAKNRMKKARVADARSAELNCSPPLGEEYVAHFSYMLSFLHVRWLKAETELRIAQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVDAQAAYYAQCYQYTVNLQKQL 278          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 192.2 bits (487), Expect = 1.280e-56
Identity = 107/255 (41.96%), Postives = 149/255 (58.43%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE F QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E+L   +  AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K ++ E+K L+N RLDLD AK ++KKA+  +A   A+ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  Y+A+ ++ M DL   L
Sbjct:    1 MDFNVKKLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQYMLDLQKQL 249          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 182.185 bits (461), Expect = 1.119e-52
Identity = 107/274 (39.05%), Postives = 150/274 (54.74%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA-------------------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE F QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E+L   +  AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K ++ E+K L+N RLDLD AK ++KKA+  +A                   +  A+ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  Y+A+ ++ M DL   L
Sbjct:    1 MDFNVKKLAADAGTFLSRAVQFTEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAVTYVFSFNANQMWTEEVTKAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQYMLDLQKQL 268          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 176.022 bits (445), Expect = 1.333e-50
Identity = 96/235 (40.85%), Postives = 136/235 (57.87%), Query Frame = 3
Query:   87 QKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            Q TEE F QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E+L   +  AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K ++ E+K L+N RLDLD AK ++KKA+  +A   A+ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  Y+A+ ++ M DL   L
Sbjct:    8 QFTEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQYMLDLQKQL 236          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 175.252 bits (443), Expect = 2.116e-50
Identity = 95/234 (40.60%), Postives = 135/234 (57.69%), Query Frame = 3
Query:   93 TEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            TEE F QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E+L   +  AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K ++ E+K L+N RLDLD AK ++KKA+  +A   A+ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  Y+A+ ++ M DL   L 
Sbjct:    5 TEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQYMLDLQKQLG 232          
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Match: sh3glb1 (SH3 domain GRB2 like, endophilin B1 [Source:NCBI gene;Acc:548826])

HSP 1 Score: 174.866 bits (442), Expect = 3.933e-50
Identity = 95/234 (40.60%), Postives = 135/234 (57.69%), Query Frame = 3
Query:   93 TEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            TEE F QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E+L   +  AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K ++ E+K L+N RLDLD AK ++KKA+  +A   A+ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  Y+A+ ++ M DL   L 
Sbjct:   18 TEEKFGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRLNTEEQLAQYMTDAGNEFGPGTAYGNALIKCGETQKRIGVAHRELVQTAAINFLTPLRNFIEGDFKTMSKEKKLLQNKRLDLDAAKTRLKKARVTEARAAAEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYFAQSYQYMLDLQKQLG 245          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 194.512 bits (493), Expect = 1.040e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 194.512 bits (493), Expect = 1.269e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 183.726 bits (465), Expect = 2.608e-53
Identity = 109/276 (39.49%), Postives = 149/276 (53.99%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA---------------------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +                      +  ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSQLNSARPEGDNIMIWAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 273          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb1 (SH3-domain GRB2-like B1 (endophilin) [Source:MGI Symbol;Acc:MGI:1859730])

HSP 1 Score: 179.489 bits (454), Expect = 1.232e-51
Identity = 110/284 (38.73%), Postives = 150/284 (52.82%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA--------------IQI---------------ADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +               I +               ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSQLNSARPEGDNIMVNFSYMLNFLHVKWLKSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 281          
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Match: Sh3glb2 (SH3-domain GRB2-like endophilin B2 [Source:MGI Symbol;Acc:MGI:2385131])

HSP 1 Score: 169.859 bits (429), Expect = 3.900e-48
Identity = 104/259 (40.15%), Postives = 150/259 (57.92%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA--------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDF  KK  S A     RAVQ TEE F QAEKTE D +F +L  + D T+ WTE I++  EV  +PNP++      R+E  + EKL+RK   R+   E L   + +A +E+G  T YGKTL+K  ++E  +G A++   +    +++  L+ FL  D K I+ ER+ L+N RLDLD  K ++KKAK  +A        +  A+ EL+ AQ +FD Q  + +L LEGI + H  HL    +F+  Q  YYA+C++ M DL
Sbjct:    1 MDFNMKKLASDAGIFFTRAVQFTEEKFGQAEKTELDAHFENLLARADSTKNWTERILRQTEVLLQPNPSA------RVEEFLYEKLDRKVPSRVTNGELLAQYMAEAASELGPSTPYGKTLIKVSEAEKRLGAAERDFIHTASLSFLTPLRNFLEGDWKTISKERRLLQNRRLDLDACKARLKKAKAAEAKATLWNDEVDKAEQELRVAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVKSQTTYYAQCYRHMLDL 253          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6AYE2|SHLB1_RAT (Endophilin-B1 OS=Rattus norvegicus OX=10116 GN=Sh3glb1 PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 5.174e-57
Identity = 110/255 (43.14%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T+VWTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKVWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R8P5|SHLB1_PONAB (Endophilin-B1 OS=Pongo abelii OX=9601 GN=SH3GLB1 PE=2 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 7.337e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y371|SHLB1_HUMAN (Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 PE=1 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 7.337e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRNSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JK48|SHLB1_MOUSE (Endophilin-B1 OS=Mus musculus OX=10090 GN=Sh3glb1 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 8.877e-57
Identity = 109/255 (42.75%), Postives = 148/255 (58.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T++WTE I+K  EV  +PNP +      R+E  V EKL+RK   R+N  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +    ++ EL+  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C++ M DL   L
Sbjct:    4 MDFNVKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNA------RIEEFVYEKLDRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFLTPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETKSSSEQELRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZIR1|SHLB1_CHICK (Endophilin-B1 OS=Gallus gallus OX=9031 GN=SH3GLB1 PE=2 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 9.710e-57
Identity = 110/255 (43.14%), Postives = 147/255 (57.65%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  KK  + A T L+RAVQ TEE   QAEKTE D +  +L  K + T+ WTE I+K  EV  +PNP +      R+E    EKL+RK   RMN  E LG  ++ AG E G  T YG  L+K G+++  IG A ++L      N++  L+ F+  D K I  ERK L+N RLDLD AK ++KKAK  +A   ++ E++  Q +FD Q  I +L LEGI + H  HL     F+  Q  YYA+C+K M DL   L
Sbjct:    4 MDFNMKKLAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLSKAECTKQWTEKIMKQTEVLLQPNPNA------RIEEFFYEKLDRKAPSRMNNPELLGQYMIDAGNEFGPGTAYGNALIKCGETQKQIGTADRELIQTSAINFLTPLRNFIEGDYKTITKERKLLQNKRLDLDAAKTRLKKAKVAEARAASEQEVRITQSEFDRQAEITRLLLEGISSTHAHHLRCLNDFVEAQMTYYAQCYKYMLDLQKQL 252          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A2C9KEP3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056742 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 6.589e-59
Identity = 107/252 (42.46%), Postives = 155/252 (61.51%), Query Frame = 3
Query:   39 FKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            FKK   GAST  NRAVQ TEE    AEKTE D +F +L ++ D T+ W+E ++K  +   +PNP        RME L+ EKL++K+ DR    E LGN++++AG + G  T+YG  L+K GQS+I IG A++      VNN++  L  FL  D+K I  E+K LE  RLDLD  K++++KAK++ + Q A+ +L+ AQ +FD Q  I K+ LEGI + H  HL+   +F+  Q  ++A+C + M DL   L 
Sbjct:   10 FKKVAGGASTVFNRAVQFTEEKLGTAEKTELDAHFENLMQRSDKTKYWSEILLKHTDTLLQPNPNL------RMEDLLYEKLDKKKKDRTTQYEILGNSMVEAGNDFGPGTSYGNALVKCGQSQIQIGNAERDFVTSTVNNFLQPLSNFLEGDMKTILKEKKILETKRLDLDACKSRVRKAKSQSSTQQAESDLRVAQSEFDRQAEITKILLEGINSTHAHHLKCLNEFIEAQMTFFAQCQQYMSDLQKQLG 255          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A2J7RKY1 (Endophilin-B1 OS=Cryptotermes secundus OX=105785 GN=SH3GLB1 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 8.409e-59
Identity = 110/258 (42.64%), Postives = 157/258 (60.85%), Query Frame = 3
Query:   24 KISMDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            K  MDF  KK V  A TAL+R VQ TEE    +EKTE D  F +LA++ D T+VWTE I++D E    PNP       NR+E  + EK+E+K+ +R++  E LG  +++AG E G  T YG  L+K GQ E  +G+ ++   +   + Y+  L+ FL  ++K I  ER  LE+ RLDLD  KN+++KA++ Q  Q A+ EL+ AQ +FD Q  I KL LEG+ + H  HL    +F+  Q  +YA+CH +MQDL  D+
Sbjct:    5 KAEMDFNMKKLVRDAGTALSRVVQLTEEKLGTSEKTELDARFENLAERSDTTKVWTEKILRDTEAVLTPNPG------NRVEDFLFEKIEKKRPNRLSNLEYLGLDMIEAGNEFGPGTAYGSALIKVGQCEQRLGQTERDFISSAGHCYVQPLRKFLEGEMKTILKERSLLESKRLDLDACKNRLRKARSMQGQQSAEKELRVAQSEFDRQAEITKLLLEGVSSSHANHLRCLHEFVDTQVRFYAQCHSVMQDLQRDM 256          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A210PSL1 (Endophilin-B1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT03701 PE=4 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 1.831e-58
Identity = 110/269 (40.89%), Postives = 155/269 (57.62%), Query Frame = 3
Query:   39 FKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKT------------------EQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
             KKF + A T  NRAVQ TEE    AEKTE D +F +L ++ D T++WTE +++  E   +PNP        RME    EKL++K+ DR N  E+LGN ++ AG + G  T+YG  L+K+GQ++I IG  +++     VNN++  LK+FL  D+K I  E+K LE  RLDLD +KN+++KAK+                  +  I  A+ +L+ AQ +FD Q  I KL LEG+ + H  HL     F+  Q  YYA+C K MQDL   L
Sbjct:    9 MKKFAADAGTLFNRAVQFTEEKLGSAEKTELDAHFENLLQRADKTKLWTERVLRQTEAVLQPNPNI------RMEDFFYEKLDKKKRDRNNHQEQLGNAMVDAGNDYGPGTSYGNALVKSGQTQIQIGNTEREFTQATVNNFLQPLKSFLEGDMKTIQKEKKILEVKRLDLDASKNRLRKAKSTASQQQPNSTTNTLTLVEDDVIARAEADLRVAQAEFDRQAEITKLLLEGVSSAHAHHLRCLNDFIEAQTTYYAQCLKYMQDLQRQL 271          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: A0A1S3IQ19 (endophilin-B1 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106166222 PE=4 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 2.555e-58
Identity = 110/249 (44.18%), Postives = 156/249 (62.65%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            MDFKK  + AST  NRAVQ TEE F  AEKTE D +F +L ++ D T++ TE I+   E   +PNP +      R+E  + +KL+RK+ +R N  E LG  ++ AG + G  T+YG +L+K GQ++  +G+A+K   +   NN++  LK FL  D+K I  ERK LE  RLDLD AK++++KA+++ A Q A+ +L+ AQ +FD Q  I KL LEGI + H  HL     F+  Q  YYA+C + MQDL
Sbjct:    1 MDFKKLAADASTVFNRAVQFTEEKFGHAEKTELDAHFENLMQRADTTRINTEKILGATESVLQPNPNA------RVEDFLYDKLDRKKRERQNNLERLGQFMVDAGNDFGPGTSYGNSLVKCGQTQQRLGQAEKDFVSTSANNFLTPLKNFLEGDMKTIQKERKLLETKRLDLDAAKSRVRKARSQAAQQQAETDLRNAQSEFDRQSEITKLLLEGISSTHAHHLRCLNDFIEAQTTYYAQCQQYMQDL 243          
BLAST of BAR domain-containing protein vs. TrEMBL
Match: W4Z6W9 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 8.202e-58
Identity = 112/252 (44.44%), Postives = 158/252 (62.70%), Query Frame = 3
Query:   27 ISMD-FKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            ++MD  KKF   A T L+RA Q TEE    AEKTE D  F +L ++ D T++WTE I+  +    EPNP S      RME  VN KL+R+  DR + +E+ G+ ++  G E+G  T YG TL++ GQS+  IG+ +++     + NYI  L+ FL  D+K I  ERK LEN+RLDLD AK K++KA++ +A + A+ EL+KAQ DFD Q  I  L LEGI + H+ HLE  K F+  ++ YYA+C + M +L
Sbjct:    1 MAMDNVKKFAGQAGTFLSRAKQYTEEKLGNAEKTELDARFENLLQRADRTRLWTEQILAKMGAVLEPNPNS------RMEDFVNTKLDRRARDRESNSEQFGSAMIDGGNELGPGTQYGATLIQVGQSQRKIGQIQREYVQSSLTNYIVPLRTFLEGDMKTITKERKILENVRLDLDAAKGKVRKARSAEASKAAEAELRKAQADFDRQYEITTLLLEGITSAHSTHLERLKDFVEAEQTYYAQCSQTMTEL 246          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb1b (SH3-domain GRB2-like endophilin B1b [Source:ZFIN;Acc:ZDB-GENE-030131-6851])

HSP 1 Score: 172.555 bits (436), Expect = 1.243e-49
Identity = 99/256 (38.67%), Postives = 144/256 (56.25%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            M+F  ++  + A T  +RAVQ TEE   QAE+TE D +  +L  + + T+ WTE ++K  EV  +PNP        RME  + EKL+RK   R N  E LG  ++ AG E G  T YG  L+K G+ E  +G ++K+  +    N++   + F+  D K I+ ERK L+  RLDLD AK ++KKA+   A   A+ EL+ AQ +FD Q  I +L LEG+ + H  HL     F+  Q  YYA+C++ M +L   L 
Sbjct:    4 MEFSVRRLAADAGTLFSRAVQFTEEKLGQAERTELDAHLENLLGRAEATKHWTERVMKQTEVLLQPNPNV------RMEEFLYEKLDRKLPTRANNHELLGECMIDAGHEFGPGTAYGSALIKCGEVEKQLGSSEKEFIHSSAINFLTPFRNFIEGDYKTISKERKLLQIKRLDLDAAKTRVKKARAADARSAAETELRIAQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDFVDAQASYYAQCYQYMVNLQKQLG 253          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb2a (SH3-domain GRB2-like endophilin B2a [Source:ZFIN;Acc:ZDB-GENE-061201-8])

HSP 1 Score: 168.703 bits (426), Expect = 5.762e-48
Identity = 102/256 (39.84%), Postives = 144/256 (56.25%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  KK    A    +RAVQ TEE   QAEKTE D +F  L  + D T+ WTE I +  EV  +PNP++      R+E  + EKL+RK   R    E LG  +++A  E G  T YG TL++ G  +  +G A+++       +++  L+ FL  D + I  ER+ LEN RLDLD  K ++KKAK  +A   A+ EL+ AQ +FD Q  + +L LEGI + H  HL    +F+  Q  YY +CH  MQ+L  +L+
Sbjct:    1 MDFSVKKLACDAGVFFSRAVQYTEEKLGQAEKTELDAHFESLLARADCTKNWTEKIYRQTEVLLQPNPSA------RIEEFLYEKLDRKLPYRATNGEILGQYMLEAAKEFGPGTPYGSTLIQVGDCQRRLGGAEREFLQTSSISFLTPLRNFLEGDWRTITKERRLLENRRLDLDACKARLKKAKAAEAKAAAEQELRLAQTEFDRQAEVTRLLLEGISSTHVNHLRCLHEFVEAQATYYNQCHHFMQELQKELS 250          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 167.548 bits (423), Expect = 2.535e-47
Identity = 108/272 (39.71%), Postives = 147/272 (54.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA----------------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  K+F + A T L+RAVQ TEE   QAEKTE D +  +L  + + T+ WTE I+K  EV  +PNP        R+E    EKL++K   RMN  E LG  ++ +G E G  T YG  L+K G++E  IG A+++       N++   + FL  D K I  ERK L+N RLDLD AK K+KKAK  +A                 + A+ +LK  Q +FD Q  I +L LEG+ + H  HL     F+  Q  YYA+C++ M DL   L 
Sbjct:    1 MDFNVKRFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLTRAECTKHWTERILKQTEVLLQPNPNV------RIEEFFYEKLDKKAPTRMNNHELLGQAMIDSGNEFGPGTAYGNALVKCGETEKEIGGAEREFIQSSAINFLTPFRNFLEGDFKTILKERKLLQNKRLDLDAAKTKLKKAKMAEARAAVSYITLHLASSAYFRSAEQDLKMTQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDFVEAQTTYYAQCYQYMVDLQKQLG 266          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3glb2b (SH3-domain GRB2-like endophilin B2b [Source:ZFIN;Acc:ZDB-GENE-040426-833])

HSP 1 Score: 131.724 bits (330), Expect = 4.938e-34
Identity = 90/276 (32.61%), Postives = 133/276 (48.19%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNK----------------MKKAKTEQAIQIADCE-LKKAQGDFDDQLVIAKLH---LEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  KK  S A     RAVQ TEE   QAEKTE D +  +L  + D T+ WTE I +  EV  +PNP++      R+E    EKL++K   R    E LG  +  A  + G  T YG TL+  G+ +  +G ++++        ++  L+ FL  D + I+ ER+ LEN RLDLD+ K +                 ++ +    I  A    ++K Q      L +   H   L    T++  HL    +F+  Q  YYA+CHK MQ+L  +L+
Sbjct:    1 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDAHLENLIARGDCTKNWTEKIFRQTEVLLQPNPSA------RIEEFFYEKLDKKAPTRTTNGELLGQYMQDAAKDFGPGTPYGSTLITVGEYQKKLGGSEREFLQSSAVGFLTPLRNFLEGDWRTISKERRLLENRRLDLDVCKARLKKAKLAEAKAAAAPDFQETRPRNYILSASASAVRKLQRTSSLSLSLPFPHSFCLSLFLTVN--HLRCLHEFVEAQAVYYAQCHKHMQELQKELS 268          
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Match: sh3gl1b (SH3 domain containing GRB2 like 1, endophilin A2 [Source:NCBI gene;Acc:103032391])

HSP 1 Score: 83.5741 bits (205), Expect = 2.878e-17
Identity = 65/244 (26.64%), Postives = 109/244 (44.67%), Query Frame = 3
Query:   51 VSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLS 782
            V+G      +A Q   E    AE T+ D  F DL +K D+T      +I     + +PNPAS  K +  + ++   + + K      A   LG  + K G ++G ET +G  LM  G+S   +   K  L   +  N+I  L+   + DL+ I    K LE  RLD D  K +  K        I D E+K+A   F +   +A++ +  +     + +      +  Q +Y+ +  +I+++LS
Sbjct:    3 VAGLKKQFYKASQMVSEKVGGAEGTKLDEEFKDLERKVDVTSKAVVELISKTSEYLQPNPASRAKLS-MLNTMSKIRGQVKSPGYPQAEGLLGECMGKYGRDLGEETNFGLALMDVGESMKRLAEVKDSLDIDVKQNFIDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQGK--------IPDEEVKQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHKQAVQILEELS 237          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 164.851 bits (416), Expect = 7.279e-47
Identity = 100/285 (35.09%), Postives = 150/285 (52.63%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA-----------------------------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  +K  S A T  +RAVQ TEE   QAE+TE D +F +L  + ++T+ WT+ I++  E   +PNP +      R+E    EKLE K   R   +E LG  +++AG E G  T YG  L+K G ++  +G ++K       N ++  L+ FL+ D + I  E+K LEN RLDLD  K+++KKA++ +A                             +  A+ EL+  Q +FD Q  I +L LEGI + H  H  A K+F+  Q  YYA+C++ M +L  +L 
Sbjct:    1 MDFNVRKLASDAGTFFSRAVQFTEEKLGQAERTELDAHFENLLGRAEMTRHWTDKIMRQAETLLQPNPNA------RIEDYFFEKLEGKAPLRATNSEYLGQYMIEAGQEFGPGTAYGCALIKCGTTQKELGISEKDFIQTTANGFLTPLRNFLDGDFRTIAKEKKILENKRLDLDACKSRLKKARSAEAKAATEPDFNEIRPRNYVLSASAAGLWADEVARAEQELRVTQTEFDRQAEITRLLLEGIGSTHANHHRALKEFVEAQAAYYAKCYQSMVELQKELG 279          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: SH3GLB2 (SH3 domain containing GRB2 like, endophilin B2 [Source:HGNC Symbol;Acc:HGNC:10834])

HSP 1 Score: 134.035 bits (336), Expect = 3.769e-37
Identity = 81/236 (34.32%), Postives = 128/236 (54.24%), Query Frame = 3
Query:   87 QKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPA-SLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            Q   ET  QAEKTE D  F+ L    D+T+ WT+ +IK +EV  +PNP+ S F   + +  +      R ++      E LG + + AG E+G  T YG  L KAG++   +G ++K+  + +  +++G L  FL+ D+  I  ERK LE  RLDLD  ++K+K+   E+       E +KAQ  FD Q    K+ LEG+K+ H  HL     ++  + +Y+ +C + ++ L  DL
Sbjct:    1 QMAGETVGQAEKTELDASFLKLFGDVDITRNWTDKLIKQVEVVIQPNPSKSHFSGVSTIYYV------RGRSVGWTDTEILGQSFVDAGQELGPGTNYGAALTKAGETHKQLGTSEKEYIHVVSKDFLGPLHKFLDNDVAIIARERKALEAKRLDLDTLRSKLKRCTDEE-------EKQKAQAQFDHQAETTKILLEGLKSTHVSHLACLHHYVDAKAKYHEDCLQKLKTLQQDL 223          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: sh3glb1a (SH3-domain GRB2-like endophilin B1a [Source:ZFIN;Acc:ZDB-GENE-050417-89])

HSP 1 Score: 128.257 bits (321), Expect = 2.166e-35
Identity = 75/182 (41.21%), Postives = 102/182 (56.04%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKM 572
            MDF  KK  S A T   RAVQ TEE    AE+TE D +F +L  + D T+ WTE I++  EV  +PNP +      R+E  V EKLE+K   R    E LG  +  AG + G  T YG  L+K G+S+  +G A+K+       N++  L+ FL  D K +  ERK L+N RLDLD +K ++
Sbjct:    1 MDFNMKKLASDAGTFFTRAVQFTEEKLGGAERTELDAHFENLMTRADSTKNWTEKIMRQTEVVLQPNPTA------RVEEFVYEKLEKKGPARQRTVELLGQYMTDAGNDFGAGTPYGGALIKVGESQKLLGLAEKEFVQASTINFLTPLRNFLEGDYKAMAKERKLLQNKRLDLDASKTRL 176          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 75.8702 bits (185), Expect = 2.398e-15
Identity = 59/235 (25.11%), Postives = 103/235 (43.83%), Query Frame = 3
Query:   75 NRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            ++  Q   E    AE T+ D  F ++ KK D T      II   + + +PNPAS  K    + ++   + + K T        LG  + K G ++G E+ +G  L   G+S   +   K  L   +  N++  ++A  + +LK I    K LE  RLD D  K ++ K        I D E+++A+  F++   +A   +  +     + +      +  Q EY+     ++QDL
Sbjct:   13 HKCTQFVSEKVGGAEGTKLDDDFTEMEKKYDTTNKAVMDIITKTQEYLQPNPASRAKLG-MLNTMSKIRGQVKSTGYPQPEGLLGEAMAKYGKDMGTESCFGLALADVGESMKQMAEIKDSLDIDVKQNFLDPMQALQDKELKEIGHHLKKLEGRRLDFDYKKKRLGK--------IPDEEIRQAEEKFEESREVAASSMHNLVESEIEQVSQLAALVDAQLEYHQRSAAVLQDL 238          
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Match: SH3GL1 (SH3 domain containing GRB2 like 1, endophilin A2 [Source:HGNC Symbol;Acc:HGNC:10830])

HSP 1 Score: 47.3654 bits (111), Expect = 8.045e-7
Identity = 29/96 (30.21%), Postives = 46/96 (47.92%), Query Frame = 3
Query:  324 LGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIAD 611
            LG  ++K G ++G E+ +G+ L+  G+S   +   K  L   +  N+I  L+     +L+ I    K LE  RLD D  K +  K   E   Q A+
Sbjct:   31 LGECMVKYGQDLGEESNFGQALVDVGESYKEMAEVKDGLDIGVKQNFIDPLQGLQEKELREIGQHLKKLEGRRLDFDYKKKRQGKILEEDIRQSAE 126          
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Match: EDO38201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDK8])

HSP 1 Score: 190.66 bits (483), Expect = 6.430e-57
Identity = 105/252 (41.67%), Postives = 148/252 (58.73%), Query Frame = 3
Query:   24 KISMDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDL 779
            + S   KKF S  +T  +RA Q TEE   +AE TE+D  F  L ++ D T+ WTE ++K  E   +PNP        R E     KL  K+ +R+   E LG  +  AG E+G  T+YG TL+K G +E  +  A++    K V++Y+  LK+FL  D+K I+TER+TL   RLDLD  K K++KA+T + IQ A+ EL+ AQ +FD Q  + KL L+GI T H  H  A + F+  Q +YYA+C + MQDL
Sbjct:    3 EFSDSMKKFGSTTATFFSRAKQYTEEQLGKAEATEFDARFESLLERADRTKQWTERLLKQTEALLQPNPGI------RAEEYFYSKLGEKKPERLTHLETLGKIMEDAGNELGPGTSYGSTLVKCGATEKKLASAERDFMTKSVSHYLHPLKSFLEGDMKTISTERRTLLAKRLDLDSCKAKVRKAQTPERIQQAESELRVAQAEFDRQYEVTKLLLDGIATSHANHHRALQSFIEAQAQYYAQCFQYMQDL 248          
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Match: EDO31161 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP4])

HSP 1 Score: 76.2554 bits (186), Expect = 2.635e-15
Identity = 52/187 (27.81%), Postives = 95/187 (50.80%), Query Frame = 3
Query:   54 SGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAE-ELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIAD 611
            +G    +N+A Q   E    A+ ++ +  FV+L +K D T    E ++   + + +PNPA+  K +  M+  V++     ++ R    E  LG T++K G ++G  + +G+ +++AG++ + +   K  L   +  N++  L    N D+K I   RK ++  RLD D  K K  K   E  I+IA+
Sbjct:    4 AGFKKQINKANQYMSEKIGSAKGSQLEEEFVELERKTDSTAKLIEDVLHKTKEYLQPNPAARAKLS--MQGAVHKVRGEARSTRYPQPEGNLGETMVKGGQDLGDTSLFGQAMVEAGETFLQLAEVKDALDANVKQNFLDPLTQLENRDIKEIMQHRKKMQGRRLDYDCKKRKSNKLPLED-IRIAE 187          
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Match: EDO47212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMW0])

HSP 1 Score: 53.9138 bits (128), Expect = 4.795e-8
Identity = 57/237 (24.05%), Postives = 96/237 (40.51%), Query Frame = 3
Query:   54 SGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEE--LGNTLMKAGAEIG---IETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYY 749
            +G    +N+A Q   E    AE T+ +  F+++ +K D        +    + + +PN     K           K+   Q D      E  +G+ +M AG EIG     + Y   L+    +   +   + +L  K+ +N++G L      DLK +   RK L+  RLD D  K K  K   E        E+K AQ  F++   + K  +  +       +E   Q +V+  EY+
Sbjct:    6 AGLKKQINKANQYVSEKMGSAEGTKMEDEFIEMERKTDALIELVANLTPKTKEYLQPNATYNAKV----------KMHMTQPDEKYPYTEGLMGDVMMLAGQEIGQVGKGSDYAAALLDFAGALHELAETRHELDEKVHSNFLGPLHDLEANDLKELTFNRKKLQGRRLDYDCKKRKGNKVSIE--------EIKTAQFKFEESKNLCKQGMAKLLGNEMDMIEQLCQLVVDMLEYH 224          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb1a (endophilin-B1 [Source:NCBI gene;Acc:101156208])

HSP 1 Score: 187.963 bits (476), Expect = 2.578e-55
Identity = 105/256 (41.02%), Postives = 147/256 (57.42%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  K+F + A T L+RAVQ TEE   QAEKTE D +  +L  + + T+ WTE I+K  EV  +PNP        R+E  V EKLE+K   RMN  E LG +++++G+E G  T YG  L+K G+++  IG A+++       N++   + FL  D K I  ERK L+  RLDLD AK ++KKA+   A   A+ EL+  Q +FD Q  I +L LEG+ + H  HL      +  Q  YYA+C++ M DL   L 
Sbjct:    1 MDFNVKRFAADAGTFLSRAVQFTEEKLGQAEKTELDAHLENLLVRAENTKQWTEKIMKQTEVLLQPNPNV------RLEEFVYEKLEKKAPTRMNNHELLGQSMIESGSEFGPGTAYGNALIKCGETQKQIGGAEREFIQSAAINFLTPFRNFLEGDFKTILKERKLLQVKRLDLDAAKTRLKKARMSDARAAAEQELRMTQSEFDRQAEITRLLLEGVSSTHAHHLRCLNDLVEAQTTYYAQCYQYMVDLQKQLG 250          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 163.31 bits (412), Expect = 7.716e-46
Identity = 98/280 (35.00%), Postives = 149/280 (53.21%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKK------------------------AKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  KK  S A     RAVQ TEE   QAEKTE DP+  +L  + D T+ WTE I++  EV  +PNP++      R+E  + +KL++K   RM  AE LG  ++ A  E G ++ YG TL+  G+ +  +G A+++        ++  L+ FL  D + I+ E++ LEN RLDLD+ K ++KK                        + +  A+  A+ EL+ AQ +FD Q  + +L LEGI + H  HL   + F   Q  Y+++CH  MQ+L  +L+
Sbjct:    1 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPNPSA------RIEEFIYDKLDKKLPSRMTTAELLGQYMLDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASAVSSAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELH 274          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 164.081 bits (414), Expect = 3.675e-45
Identity = 99/285 (34.74%), Postives = 149/285 (52.28%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTE-----------------------------QAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  KK  S A     RAVQ TEE   QAEKTE DP+  +L  + D T+ WTE I++  EV  +PNP++      R+E  + +KL++K   RM  AE LG  ++ A  E G ++ YG TL+  G+ +  +G A+++        ++  L+ FL  D + I+ E++ LEN RLDLD+ K ++KKAK                               + +  A+ EL+ AQ +FD Q  + +L LEGI + H  HL   + F   Q  Y+++CH  MQ+L  +L+
Sbjct:  100 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPNPSA------RIEEFIYDKLDKKLPSRMTTAELLGQYMLDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASALLSEEVDKAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELH 378          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000021068.2 (endophilin-B2 [Source:NCBI gene;Acc:101169212])

HSP 1 Score: 160.614 bits (405), Expect = 5.933e-45
Identity = 101/276 (36.59%), Postives = 144/276 (52.17%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKT---------------------EQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDF  K+  + A   L RAVQ TEE   Q+EKT  D  F +L  + D T+ WTE I++  E+  +PNP++      R+E  + EKL+ K   R+  +E LG  +  A  E+G+E+ YG TL+K G+ E  +G  +K        +++  L+ FL  D + I+ ER+ LENLRLDLD  K ++KKAK                        +   A+  LK AQ +FD Q  + +L LEGI   H  HL    +F+  Q  YY +CH  MQDL  +L
Sbjct:    1 MDFNVKRLATEAGLFLTRAVQFTEEKLWQSEKTNLDQDFENLTVRADCTKHWTEKILRQTEILLQPNPSA------RIEEFLYEKLDMKAPSRVTNSELLGQHMEDAAKELGLESPYGSTLVKVGECERRLGAVEKDFIQTADISFLSPLRNFLEGDCRIISKERRLLENLRLDLDACKTRVKKAKAAEAKVAVVPDFQETRPRNYVLSASASAAEQGLKTAQKEFDRQAEVTRLLLEGISCTHVNHLRCLHEFVEAQAAYYRQCHLHMQDLQEEL 270          
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Match: sh3glb2b (SH3 domain containing GRB2 like, endophilin B2 [Source:NCBI gene;Acc:101171759])

HSP 1 Score: 162.54 bits (410), Expect = 1.613e-44
Identity = 99/285 (34.74%), Postives = 148/285 (51.93%), Query Frame = 3
Query:   33 MDF--KKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTE-----------------------------QAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLN 794
            MDF  KK  S A     RAVQ TEE   QAEKTE DP+  +L  + D T+ WTE I++  EV  +PNP  +     R+E  + +KL++K   RM  AE LG  ++ A  E G ++ YG TL+  G+ +  +G A+++        ++  L+ FL  D + I+ E++ LEN RLDLD+ K ++KKAK                               + +  A+ EL+ AQ +FD Q  + +L LEGI + H  HL   + F   Q  Y+++CH  MQ+L  +L+
Sbjct:  100 MDFNVKKLASDAGVFFTRAVQFTEEKLGQAEKTELDPHLENLITRADSTKNWTEKILRQTEVLLQPNP--IDHTGARIEEFIYDKLDKKLPSRMTTAELLGQYMLDAAKEFGADSPYGSTLITVGEYQKRLGGAEREFLQTSAAAFLSPLRNFLEGDWRTISKEKRLLENRRLDLDICKARLKKAKHAEAKAAAAPDFQETRPRNYVLSASASALLSEEVDKAEHELRVAQTEFDRQAEVTRLLLEGISSTHLNHLRCLQDFAEAQTTYFSQCHHHMQELQRELH 382          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000000639.1 (SMESG000000639.1)

HSP 1 Score: 524.242 bits (1349), Expect = 0.000e+0
Identity = 256/256 (100.00%), Postives = 256/256 (100.00%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA 800
            MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA
Sbjct:    1 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA 256          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000000639.1 (SMESG000000639.1)

HSP 1 Score: 505.368 bits (1300), Expect = 0.000e+0
Identity = 250/256 (97.66%), Postives = 250/256 (97.66%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA 800
            MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPA      NRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA
Sbjct:    1 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPA------NRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDLNLA 250          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000051256.1 (SMESG000051256.1)

HSP 1 Score: 152.91 bits (385), Expect = 2.967e-43
Identity = 95/260 (36.54%), Postives = 140/260 (53.85%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGA-------EIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MD  KF+S AS+A++R VQ TEE     EKT YD     L  + DL Q+ TE I+K IE F +PNPA       R+ES+V EKL+ K+   ++ A  +G+T++           +I  ++ Y   L  +G+S   IG A ++L NK    +I  L+++L   +KN+  ERK LE  RLDLD  K K+K+  TE+A +  D +LK  Q +F+ QL +  L +E +      H      F+  + EYY  CH+ +  L   L
Sbjct:    1 MDLGKFISNASSAVSRVVQYTEEKLFNVEKTAYDARTEYLMHQTDLCQILTEKIVKSIESFIQPNPAY------RLESMVYEKLDGKRIVHISPASIVGDTMISVSQDLKANPNQIEPQSNYSVALQLSGESHNKIGLAHQELMNKTRTKFIEPLQSYLE-QVKNVQKERKELEGKRLDLDAIKTKLKRVVTEEAKRSTDRDLKSMQMEFEQQLEVTNLLMENVVASLGYHTRLLCDFVDCEAEYYEHCHEEITKLQESL 253          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000051256.1 (SMESG000051256.1)

HSP 1 Score: 149.058 bits (375), Expect = 9.572e-42
Identity = 95/267 (35.58%), Postives = 141/267 (52.81%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGA-------EIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQA-------IQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MD  KF+S AS+A++R VQ TEE     EKT YD     L  + DL Q+ TE I+K IE F +PNPA       R+ES+V EKL+ K+   ++ A  +G+T++           +I  ++ Y   L  +G+S   IG A ++L NK    +I  L+++L   +KN+  ERK LE  RLDLD  K K+K+  TE+A       + + D +LK  Q +F+ QL +  L +E +      H      F+  + EYY  CH+ +  L   L
Sbjct:    1 MDLGKFISNASSAVSRVVQYTEEKLFNVEKTAYDARTEYLMHQTDLCQILTEKIVKSIESFIQPNPAY------RLESMVYEKLDGKRIVHISPASIVGDTMISVSQDLKANPNQIEPQSNYSVALQLSGESHNKIGLAHQELMNKTRTKFIEPLQSYLE-QVKNVQKERKELEGKRLDLDAIKTKLKRVVTEEAKRSEAKEVAMTDRDLKSMQMEFEQQLEVTNLLMENVVASLGYHTRLLCDFVDCEAEYYEHCHEEITKLQESL 260          
BLAST of BAR domain-containing protein vs. Planmine SMEST
Match: SMESG000013676.1 (SMESG000013676.1)

HSP 1 Score: 139.428 bits (350), Expect = 2.399e-38
Identity = 92/254 (36.22%), Postives = 129/254 (50.79%), Query Frame = 3
Query:   33 MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVWTEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGNTLMKAGAEIG-IETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKAFLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQGDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLSPDL 791
            MDFKK VS A   LNRAVQKT ET L AEKTEYD  + ++  K D   VWTE  +K+     EPN       A R+E  V +K++RK  +R+   E LG    KAG     +     K     G  E+ +G   K+   +    Y+  L+  +  DLK    ER  LENLRLDLD  + K+K++ +E   + A+   + A+  F+ QL + K     I  + ++H    K F+  Q  YYAEC + ++ L   L
Sbjct:    1 MDFKKLVSEAGAKLNRAVQKTNETLLSAEKTEYDIEYKNMLTKIDALNVWTERFVKEATSALEPN------LAFRLEDKVLDKIDRK-NERITPLEVLGGVYEKAGETFAPLSGDLSKCFATFGGIEVRVGITSKEFQKRASEVYVSKLRTMITVDLKKFQEERVNLENLRLDLDSLRGKLKRS-SENNRRSAEDAFQNAEIKFNQQLNMNKEIFANIDKLFDEHQTLIKAFVSAQISYYAECQRELERLEKQL 246          
The following BLAST results are available for this feature:
BLAST of BAR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GLB11.528e-5742.75SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB13.314e-5339.49SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB11.168e-5138.73SH3 domain containing GRB2 like, endophilin B1 [So... [more]
SH3GLB21.180e-4740.15SH3 domain containing GRB2 like, endophilin B2 [So... [more]
SH3GLB23.008e-4535.71SH3 domain containing GRB2 like, endophilin B2 [So... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F35A5.81.380e-5239.15pep chromosome:WBcel235:X:3800045:3802767:-1 gene:... [more]
F35A5.84.421e-5137.64pep chromosome:WBcel235:X:3800737:3802771:-1 gene:... [more]
F35A5.87.926e-5037.64pep chromosome:WBcel235:X:3800045:3802771:-1 gene:... [more]
unc-578.314e-1226.14Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
unc-578.696e-1226.14Endophilin-A homolog [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EndoB1.418e-4736.22gene:FBgn0034433 transcript:FBtr0113098[more]
EndoB2.383e-4736.22gene:FBgn0034433 transcript:FBtr0086559[more]
EndoB2.773e-4534.59gene:FBgn0034433 transcript:FBtr0113097[more]
EndoB4.263e-4534.59gene:FBgn0034433 transcript:FBtr0086558[more]
EndoA1.669e-921.40gene:FBgn0038659 transcript:FBtr0083699[more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb1b4.831e-5339.61SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb1b5.287e-5340.39SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb1a2.395e-5243.03SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
sh3glb1a2.395e-5243.03SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
sh3glb1b7.351e-4735.56SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb11.280e-5641.96SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb11.119e-5239.05SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb11.333e-5040.85SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb12.116e-5040.60SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
sh3glb13.933e-5040.60SH3 domain GRB2 like, endophilin B1 [Source:NCBI g... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3glb11.040e-5742.75SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb11.269e-5742.75SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb12.608e-5339.49SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb11.232e-5138.73SH3-domain GRB2-like B1 (endophilin) [Source:MGI S... [more]
Sh3glb23.900e-4840.15SH3-domain GRB2-like endophilin B2 [Source:MGI Sym... [more]
back to top
BLAST of BAR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AYE2|SHLB1_RAT5.174e-5743.14Endophilin-B1 OS=Rattus norvegicus OX=10116 GN=Sh3... [more]
sp|Q5R8P5|SHLB1_PONAB7.337e-5742.75Endophilin-B1 OS=Pongo abelii OX=9601 GN=SH3GLB1 P... [more]
sp|Q9Y371|SHLB1_HUMAN7.337e-5742.75Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1 P... [more]
sp|Q9JK48|SHLB1_MOUSE8.877e-5742.75Endophilin-B1 OS=Mus musculus OX=10090 GN=Sh3glb1 ... [more]
sp|Q5ZIR1|SHLB1_CHICK9.710e-5743.14Endophilin-B1 OS=Gallus gallus OX=9031 GN=SH3GLB1 ... [more]
back to top
BLAST of BAR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KEP36.589e-5942.46Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2J7RKY18.409e-5942.64Endophilin-B1 OS=Cryptotermes secundus OX=105785 G... [more]
A0A210PSL11.831e-5840.89Endophilin-B1 OS=Mizuhopecten yessoensis OX=6573 G... [more]
A0A1S3IQ192.555e-5844.18endophilin-B1 isoform X4 OS=Lingula unguis OX=7574... [more]
W4Z6W98.202e-5844.44Uncharacterized protein OS=Strongylocentrotus purp... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb1b1.243e-4938.67SH3-domain GRB2-like endophilin B1b [Source:ZFIN;A... [more]
sh3glb2a5.762e-4839.84SH3-domain GRB2-like endophilin B2a [Source:ZFIN;A... [more]
sh3glb1a2.535e-4739.71SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
sh3glb2b4.938e-3432.61SH3-domain GRB2-like endophilin B2b [Source:ZFIN;A... [more]
sh3gl1b2.878e-1726.64SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3GLB27.279e-4735.09SH3 domain containing GRB2 like, endophilin B2 [So... [more]
SH3GLB23.769e-3734.32SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sh3glb1a2.166e-3541.21SH3-domain GRB2-like endophilin B1a [Source:ZFIN;A... [more]
SH3GL12.398e-1525.11SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
SH3GL18.045e-730.21SH3 domain containing GRB2 like 1, endophilin A2 [... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BAR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO382016.430e-5741.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311612.635e-1527.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472124.795e-824.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BAR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3glb1a2.578e-5541.02endophilin-B1 [Source:NCBI gene;Acc:101156208][more]
sh3glb2b7.716e-4635.00SH3 domain containing GRB2 like, endophilin B2 [So... [more]
sh3glb2b3.675e-4534.74SH3 domain containing GRB2 like, endophilin B2 [So... [more]
ENSORLT00000021068.25.933e-4536.59endophilin-B2 [Source:NCBI gene;Acc:101169212][more]
sh3glb2b1.613e-4434.74SH3 domain containing GRB2 like, endophilin B2 [So... [more]
back to top
BLAST of BAR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000639.10.000e+0100.00SMESG000000639.1[more]
SMESG000000639.10.000e+097.66SMESG000000639.1[more]
SMESG000051256.12.967e-4336.54SMESG000051256.1[more]
SMESG000051256.19.572e-4235.58SMESG000051256.1[more]
SMESG000013676.12.399e-3836.22SMESG000013676.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005717 ID=SMED30005717|Name=BAR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1305bp
GTAATTTTTGAATTCTAAATCGCAAAATTTCAATGGATTTTAAAAAGTTT
GTATCTGGTGCGAGTACTGCCTTAAATAGAGCTGTGCAAAAAACTGAAGA
AACATTTCTTCAAGCTGAAAAAACCGAGTATGATCCATATTTTGTTGATC
TGGCAAAAAAGTGTGATTTAACCCAAGTTTGGACCGAAGCTATTATCAAA
GACATTGAAGTATTTGCTGAACCAAACCCAGCATCACTTTTTAAGTTCGC
AAATCGGATGGAATCTTTGGTGAATGAAAAGCTCGAGAGAAAGCAAACTG
ACCGAATGAATGCAGCTGAAGAATTGGGAAACACTCTGATGAAAGCTGGA
GCTGAAATTGGAATAGAAACGACCTATGGCAAAACACTCATGAAAGCTGG
GCAGTCAGAAATCTACATTGGTAGAGCCAAGAAACAGCTGGGCAACAAAA
TTGTTAATAACTACATTGGAACTTTGAAGGCCTTTCTCAATACAGATTTA
AAAAATATCAATACTGAAAGAAAAACTTTGGAAAATTTGAGATTGGATTT
AGATTTGGCCAAGAATAAGATGAAAAAAGCAAAGACTGAACAAGCAATTC
AAATTGCGGATTGTGAATTGAAGAAAGCTCAGGGTGATTTTGACGACCAA
TTGGTGATAGCGAAACTGCACTTGGAAGGCATCAAGACCATTCATAATCA
GCACTTGGAGGCCTTTAAACAATTTCTAGTGGAACAAAAAGAATATTATG
CCGAATGCCACAAAATAATGCAAGACTTGTCACCGGATTTGAACCTGGCA
TAAATCTATTCTATGAATTTTGAATTCCTTTCGCTATATCAATTACTTGT
GCCAATGTGATTTTATTAATTGCGGAGTATTGGCTGTGCTGTTCTGGTGA
TAGAATTTGTCTGTGGGCAGCCGCTGTTGTCCCATACATTTATATAAATT
TATATGATTTCCTTCATTTATATTTGTTATTGATAATCAGTTTAAACAAA
TAATTATCCAGTTAATTGGGTTTCGATTTAAAACAATTATTAAATATGAA
AAATGGGATTTGTTTTTGTGAGTATTATTTGGTGATGGCACTGTAAATGG
CGATTCCTAGAATGTATTGACTGTTGGAGAATTTCTATTAATTCATGGGA
AATCAACAATTATAGTCGGGTAAACATTATTTCCAGTTACTCGGTTGGAT
TGGTTTAGATTATTTATTTTTTTATTTATCTCCCATTAATTTTAATGGAA
ATAGTAATTTTAGATAAGTGCGTCAGAGTGGAATCGCATAGATTCTGGGT
TTATA
back to top

protein sequence of SMED30005717-orf-1

>SMED30005717-orf-1 ID=SMED30005717-orf-1|Name=SMED30005717-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=257bp
MDFKKFVSGASTALNRAVQKTEETFLQAEKTEYDPYFVDLAKKCDLTQVW
TEAIIKDIEVFAEPNPASLFKFANRMESLVNEKLERKQTDRMNAAEELGN
TLMKAGAEIGIETTYGKTLMKAGQSEIYIGRAKKQLGNKIVNNYIGTLKA
FLNTDLKNINTERKTLENLRLDLDLAKNKMKKAKTEQAIQIADCELKKAQ
GDFDDQLVIAKLHLEGIKTIHNQHLEAFKQFLVEQKEYYAECHKIMQDLS
PDLNLA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000232copulatory apparatus
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR028503SH3GLB1
IPR004148BAR_dom
IPR027267AH/BAR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008289lipid binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0000139Golgi membrane
GO:0000421autophagosome membrane
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0030496midbody
GO:0031410cytoplasmic vesicle
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 149..202
NoneNo IPR availablePANTHERPTHR14167SH3 DOMAIN-CONTAININGcoord: 7..249
IPR004148BAR domainSMARTSM007215barcoord: 9..255
e-value: 3.4E-38
score: 142.9
IPR004148BAR domainPFAMPF03114BARcoord: 13..253
e-value: 1.3E-46
score: 159.2
IPR004148BAR domainPROSITEPS51021BARcoord: 22..256
score: 18.887
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 24..256
e-value: 1.6E-56
score: 193.8
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 15..253
IPR028503Endophilin-B1PANTHERPTHR14167:SF52ENDOPHILIN-B1coord: 7..249