Histone acetyltransferase p300

Overview
NameHistone acetyltransferase p300
Smed IDSMED30005716
Length (bp)2936
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase p300 (SMED30005716) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase p300 (SMED30005716) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase p300 (SMED30005716) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase p300 (SMED30005716) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005716

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005716SMESG000002563.1 SmedASXL_014004SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
zeta neoblastSMED30005716SMESG000002563.1 dd_Smed_v4_16296_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005716SMESG000002563.1 SMED_13428_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30005716SMESG000002563.1 SMED_13428_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 484.952 bits (1247), Expect = 8.734e-147
Identity = 284/779 (36.46%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    I++  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1040 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1805          
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 484.952 bits (1247), Expect = 1.085e-146
Identity = 284/779 (36.46%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    I++  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1078 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1843          
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Match: EP300 (E1A binding protein p300 [Source:HGNC Symbol;Acc:HGNC:3373])

HSP 1 Score: 479.174 bits (1232), Expect = 9.962e-145
Identity = 282/778 (36.25%), Postives = 418/778 (53.73%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF +   E   +  DPS+  +T    +F   KND L  E FV C++C RK H IC LH        F C  C  K+   +KE  FSA+R+P+T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG D+ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRA+++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H+H M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1042 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1806          
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Match: EP300 (E1A binding protein p300 [Source:HGNC Symbol;Acc:HGNC:3373])

HSP 1 Score: 478.789 bits (1231), Expect = 1.191e-144
Identity = 282/778 (36.25%), Postives = 418/778 (53.73%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF +   E   +  DPS+  +T    +F   KND L  E FV C++C RK H IC LH        F C  C  K+   +KE  FSA+R+P+T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG D+ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRA+++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H+H M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1016 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1780          
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Match: CREBBP (CREB binding protein [Source:HGNC Symbol;Acc:HGNC:2348])

HSP 1 Score: 408.683 bits (1049), Expect = 4.273e-125
Identity = 214/488 (43.85%), Postives = 292/488 (59.84%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML 1521
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+   LC  P +     Y+  S KY     +D    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +
Sbjct:  613 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGL--LADRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESI 1098          
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1c.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 427.557 bits (1098), Expect = 6.484e-128
Identity = 250/776 (32.22%), Postives = 384/776 (49.48%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDS-------DGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLC--SDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVS---KILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKL--------------------------------------DSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKD-SFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV--FVSLSEIRLRNMLTLLYEIIR---------CQ----ECRENSCVRMKQLIIHAQRCSLSYED-CQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            ++S + LI   +P+ E+L ++  + PFR  VD+ L   P+Y  I+K+PM L T+ +KL +  Y       +D WL+ +NA L+N+ NS  YK  +KL E+F    + +MK++G+CC  K  F P +L C+        C I + Q Y  F+ S +       +    C+ CF     + I     P+D + +   + F   KN ++  E F  C  C+RKWH ICALH        F C+ C  + K Q P  ++ A ++P   LS F+E RVN  +     + +    +++R L     + ++K ++   Y   N+    FPYR KA++AF+ IDG +V FF L+ QEY  +CP PNARRVYI+YLDSVH+FQPREL+T+VYH +L+ YLDY +   Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL  WYK+ML+K V     +E+ +I++   ++ +  P  +PYF+GDFWPN I + +    + ++   V                                                + V D ++S+  +  + F    LV + N    ++ PI + D    L  + +++ RD+ L   RE + EFS+LRRAK++TL +   L   + K   + C+ C    +   + C  C DFDLC  C     H H M ++   +   E          YE I+         CQ     CR  SC +MK+++ H + C       C +C  L  L   H  +C    C +  C
Sbjct:  852 VFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAA----MCTIAREQQYWVFEQSSTQYNVTVTERYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDG---LMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSSPAV---WHCQSCDDFDLCDGCKPTTQHPHEMEKIKSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFC 1617          
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774825:1 gene:WBGene00000366.1 transcript:R10E11.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 427.557 bits (1098), Expect = 6.484e-128
Identity = 250/776 (32.22%), Postives = 384/776 (49.48%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDS-------DGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLC--SDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVS---KILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKL--------------------------------------DSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKD-SFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV--FVSLSEIRLRNMLTLLYEIIR---------CQ----ECRENSCVRMKQLIIHAQRCSLSYED-CQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            ++S + LI   +P+ E+L ++  + PFR  VD+ L   P+Y  I+K+PM L T+ +KL +  Y       +D WL+ +NA L+N+ NS  YK  +KL E+F    + +MK++G+CC  K  F P +L C+        C I + Q Y  F+ S +       +    C+ CF     + I     P+D + +   + F   KN ++  E F  C  C+RKWH ICALH        F C+ C  + K Q P  ++ A ++P   LS F+E RVN  +     + +    +++R L     + ++K ++   Y   N+    FPYR KA++AF+ IDG +V FF L+ QEY  +CP PNARRVYI+YLDSVH+FQPREL+T+VYH +L+ YLDY +   Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL  WYK+ML+K V     +E+ +I++   ++ +  P  +PYF+GDFWPN I + +    + ++   V                                                + V D ++S+  +  + F    LV + N    ++ PI + D    L  + +++ RD+ L   RE + EFS+LRRAK++TL +   L   + K   + C+ C    +   + C  C DFDLC  C     H H M ++   +   E          YE I+         CQ     CR  SC +MK+++ H + C       C +C  L  L   H  +C    C +  C
Sbjct:  852 VFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAA----MCTIAREQQYWVFEQSSTQYNVTVTERYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDG---LMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSSPAV---WHCQSCDDFDLCDGCKPTTQHPHEMEKIKSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFC 1617          
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 427.557 bits (1098), Expect = 9.278e-128
Identity = 250/776 (32.22%), Postives = 384/776 (49.48%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDS-------DGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLC--SDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVS---KILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKL--------------------------------------DSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKD-SFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV--FVSLSEIRLRNMLTLLYEIIR---------CQ----ECRENSCVRMKQLIIHAQRCSLSYED-CQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            ++S + LI   +P+ E+L ++  + PFR  VD+ L   P+Y  I+K+PM L T+ +KL +  Y       +D WL+ +NA L+N+ NS  YK  +KL E+F    + +MK++G+CC  K  F P +L C+        C I + Q Y  F+ S +       +    C+ CF     + I     P+D + +   + F   KN ++  E F  C  C+RKWH ICALH        F C+ C  + K Q P  ++ A ++P   LS F+E RVN  +     + +    +++R L     + ++K ++   Y   N+    FPYR KA++AF+ IDG +V FF L+ QEY  +CP PNARRVYI+YLDSVH+FQPREL+T+VYH +L+ YLDY +   Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL  WYK+ML+K V     +E+ +I++   ++ +  P  +PYF+GDFWPN I + +    + ++   V                                                + V D ++S+  +  + F    LV + N    ++ PI + D    L  + +++ RD+ L   RE + EFS+LRRAK++TL +   L   + K   + C+ C    +   + C  C DFDLC  C     H H M ++   +   E          YE I+         CQ     CR  SC +MK+++ H + C       C +C  L  L   H  +C    C +  C
Sbjct:  863 VFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAA----MCTIAREQQYWVFEQSSTQYNVTVTERYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDG---LMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSSPAV---WHCQSCDDFDLCDGCKPTTQHPHEMEKIKSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFC 1628          
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Match: cbp-1 (pep chromosome:WBcel235:III:9766516:9774807:1 gene:WBGene00000366.1 transcript:R10E11.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cbp-1)

HSP 1 Score: 427.172 bits (1097), Expect = 9.954e-128
Identity = 250/776 (32.22%), Postives = 384/776 (49.48%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDS-------DGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLC--SDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVS---KILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKL--------------------------------------DSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKD-SFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV--FVSLSEIRLRNMLTLLYEIIR---------CQ----ECRENSCVRMKQLIIHAQRCSLSYED-CQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            ++S + LI   +P+ E+L ++  + PFR  VD+ L   P+Y  I+K+PM L T+ +KL +  Y       +D WL+ +NA L+N+ NS  YK  +KL E+F    + +MK++G+CC  K  F P +L C+        C I + Q Y  F+ S +       +    C+ CF     + I     P+D + +   + F   KN ++  E F  C  C+RKWH ICALH        F C+ C  + K Q P  ++ A ++P   LS F+E RVN  +     + +    +++R L     + ++K ++   Y   N+    FPYR KA++AF+ IDG +V FF L+ QEY  +CP PNARRVYI+YLDSVH+FQPREL+T+VYH +L+ YLDY +   Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL  WYK+ML+K V     +E+ +I++   ++ +  P  +PYF+GDFWPN I + +    + ++   V                                                + V D ++S+  +  + F    LV + N    ++ PI + D    L  + +++ RD+ L   RE + EFS+LRRAK++TL +   L   + K   + C+ C    +   + C  C DFDLC  C     H H M ++   +   E          YE I+         CQ     CR  SC +MK+++ H + C       C +C  L  L   H  +C    C +  C
Sbjct:  852 VFSQEDLIKFLLPVWEKLDKSEDAAPFRVPVDAKLLNIPDYHEIIKRPMDLETVHKKLYAGQYQNAGQFCDDIWLMLDNAWLYNRKNSKVYKYGLKLSEMFVSEMDPVMKSMGYCCAKKLAFTPLSLFCYGAA----MCTIAREQQYWVFEQSSTQYNVTVTERYTYCQKCFDALPPEGISLSENPNDRNNMAPKTSFTEQKNSVIDYEPFERCKYCMRKWHRICALHDKKVYPEGFICECCRTAKKYQKPDNKYLASKLPHNKLSTFLEDRVNGFIKKQLQAEAHKYPVIIRTLCVQDKEAEVKAQMKQKYVESNQFPEKFPYRTKAVFAFEIIDGVEVCFFGLHVQEYGSACPAPNARRVYIAYLDSVHFFQPRELRTDVYHELLLGYLDYAKMLGYTMAHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQDWYKKMLEKGVQEGSVVEFKDIYKQARDDNLTTPTQLPYFEGDFWPNVIEDCIREASNEEAQRKVKEDDDDGEDADGGLGGGDSGKKKSSKNKKNNLKKNAKMNKKKAGSITGNEVADKLYSQFEKHKEVFFTIRLVSLQNEPAVLAKPISDPDG---LMQSDMMDGRDTFLTKAREEHWEFSSLRRAKYSTLCLAYSLHETDSKGMEYTCNKCSSPAV---WHCQSCDDFDLCDGCKPTTQHPHEMEKIKSLIGGGEAGDSAAGGTRYESIQRCIASLVHACQCRDANCRRMSCHKMKRVVQHTKMCKKRINGTCPVCKQLIALCCYHAKHCTRDACTVPFC 1617          
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Match: athp-2 (AT Hook plus PHD finger transcription factor [Source:UniProtKB/TrEMBL;Acc:Q9N5L9])

HSP 1 Score: 62.3882 bits (150), Expect = 1.843e-9
Identity = 31/88 (35.23%), Postives = 51/88 (57.95%), Query Frame = 1
Query:  166 LCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKD 429
            L +E +R   S+PF   VDS   P+Y  ++K+PM+L T+  K+  + Y +P ++ NDF LI +N   +N+P +  YK   +L +   D
Sbjct: 1332 LLKEAMRQECSWPFLQPVDSKEVPDYYDVIKRPMNLRTMMNKIKQRIYNKPIEVRNDFQLILSNCETYNEPENEIYKLSRELHDFMAD 1419          
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0071402)

HSP 1 Score: 478.019 bits (1229), Expect = 1.794e-144
Identity = 274/792 (34.60%), Postives = 422/792 (53.28%), Query Frame = 1
Query:   88 PHEVNNISEENKYIWSSKRLIDSFIPLCEELLRN-PSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCS-EKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHI-STTDNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE--------------------------MLSMTGDSKS----------------SLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL--------------SEIR---LRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYE-DCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            P   N   ++ K  ++ + L  + +P  E+L R  P S PFR  VD  +L  P+Y  IVK+PM L TI+  + +  Y++PW+ ++D WL+F+NA L+N+  S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+    +Y   S+      C+ CF     +   +  DP +  +     +F  +KND L  E FV+C +C RK H IC L + S     F C  C  K  + +KE  F+A+R+PTT L  +IE+RVN  L        ++ +RV++ +   V++KP +   +  +   ++ FPYR KA++AF+++DG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ Y+DY +Q  Y  AH+W+CPP  GDDY+FH HPTDQK+PK  RL +WYK+MLDK ++  +  +Y +I +  +E+++    ++PYF+GDFWPN + E                          + S+  +  S                S    RK   K       +D+ +K+    ++  E F V+ L+  +  +S +  I   + L    L++ RD+ L   R+ + EFS+LRRA+F+TL +L EL    Q K  + C+ CK + +  RY CT C DFDLC VC +K GH+H M ++   +               E R   ++  +  L    +C++  CR  SC +MK ++ H + C       C +C  L  L   H   C+  KC +  C
Sbjct: 1683 PLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNR--YTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAAS-LAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTA-VETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC 2470          
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0302723)

HSP 1 Score: 478.019 bits (1229), Expect = 1.794e-144
Identity = 274/792 (34.60%), Postives = 422/792 (53.28%), Query Frame = 1
Query:   88 PHEVNNISEENKYIWSSKRLIDSFIPLCEELLRN-PSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCS-EKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHI-STTDNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE--------------------------MLSMTGDSKS----------------SLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL--------------SEIR---LRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYE-DCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            P   N   ++ K  ++ + L  + +P  E+L R  P S PFR  VD  +L  P+Y  IVK+PM L TI+  + +  Y++PW+ ++D WL+F+NA L+N+  S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+    +Y   S+      C+ CF     +   +  DP +  +     +F  +KND L  E FV+C +C RK H IC L + S     F C  C  K  + +KE  F+A+R+PTT L  +IE+RVN  L        ++ +RV++ +   V++KP +   +  +   ++ FPYR KA++AF+++DG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ Y+DY +Q  Y  AH+W+CPP  GDDY+FH HPTDQK+PK  RL +WYK+MLDK ++  +  +Y +I +  +E+++    ++PYF+GDFWPN + E                          + S+  +  S                S    RK   K       +D+ +K+    ++  E F V+ L+  +  +S +  I   + L    L++ RD+ L   R+ + EFS+LRRA+F+TL +L EL    Q K  + C+ CK + +  RY CT C DFDLC VC +K GH+H M ++   +               E R   ++  +  L    +C++  CR  SC +MK ++ H + C       C +C  L  L   H   C+  KC +  C
Sbjct: 1683 PLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNR--YTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAAS-LAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTA-VETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC 2470          
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0302722)

HSP 1 Score: 478.019 bits (1229), Expect = 1.796e-144
Identity = 274/792 (34.60%), Postives = 422/792 (53.28%), Query Frame = 1
Query:   88 PHEVNNISEENKYIWSSKRLIDSFIPLCEELLRN-PSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCS-EKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHI-STTDNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE--------------------------MLSMTGDSKS----------------SLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL--------------SEIR---LRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYE-DCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            P   N   ++ K  ++ + L  + +P  E+L R  P S PFR  VD  +L  P+Y  IVK+PM L TI+  + +  Y++PW+ ++D WL+F+NA L+N+  S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+    +Y   S+      C+ CF     +   +  DP +  +     +F  +KND L  E FV+C +C RK H IC L + S     F C  C  K  + +KE  F+A+R+PTT L  +IE+RVN  L        ++ +RV++ +   V++KP +   +  +   ++ FPYR KA++AF+++DG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ Y+DY +Q  Y  AH+W+CPP  GDDY+FH HPTDQK+PK  RL +WYK+MLDK ++  +  +Y +I +  +E+++    ++PYF+GDFWPN + E                          + S+  +  S                S    RK   K       +D+ +K+    ++  E F V+ L+  +  +S +  I   + L    L++ RD+ L   R+ + EFS+LRRA+F+TL +L EL    Q K  + C+ CK + +  RY CT C DFDLC VC +K GH+H M ++   +               E R   ++  +  L    +C++  CR  SC +MK ++ H + C       C +C  L  L   H   C+  KC +  C
Sbjct: 1689 PLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNR--YTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAAS-LAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTA-VETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC 2476          
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Match: nej (gene:FBgn0261617 transcript:FBtr0333521)

HSP 1 Score: 477.248 bits (1227), Expect = 3.649e-144
Identity = 271/788 (34.39%), Postives = 418/788 (53.05%), Query Frame = 1
Query:   88 PHEVNNISEENKYIWSSKRLIDSFIPLCEELLRN-PSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCS-EKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHI-STTDNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE--------------------------MLSMTGDSKS----------------SLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL--------------SEIR---LRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYE-DCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            P   N   ++ K  ++ + L  + +P  E+L R  P S PFR  VD  +L  P+Y  IVK+PM L TI+  + +  Y++PW+ ++D WL+F+NA L+N+  S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+        C I +   Y  ++    +    C+ CF     +   +  DP +  +     +F  +KND L  E FV+C +C RK H IC L + S     F C  C  K  + +KE  F+A+R+PTT L  +IE+RVN  L        ++ +RV++ +   V++KP +   +  +   ++ FPYR KA++AF+++DG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ Y+DY +Q  Y  AH+W+CPP  GDDY+FH HPTDQK+PK  RL +WYK+MLDK ++  +  +Y +I +  +E+++    ++PYF+GDFWPN + E                          + S+  +  S                S    RK   K       +D+ +K+    ++  E F V+ L+  +  +S +  I   + L    L++ RD+ L   R+ + EFS+LRRA+F+TL +L EL    Q K  + C+ CK + +  RY CT C DFDLC VC +K GH+H M ++   +               E R   ++  +  L    +C++  CR  SC +MK ++ H + C       C +C  L  L   H   C+  KC +  C
Sbjct: 1683 PLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYFEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFEAEIDPVMQALGYCCGRKYTFNPQVLCCY----GKQLCTIPRDAKYYSYQ----NRYTYCQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVNCQECGRKQHQICVLWLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEVHIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEYGSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPSEGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKKAKKSNKSKAAQRKNSKKSNEHQSGNDLSTKIYATMEKHKEVFFVIRLHSAQSAAS-LAPIQDPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHCKTA-VETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQSIQRCIQSLAHACQCRDANCRLPSCQKMKLVVQHTKNCKRKPNGGCPICKQLIALCCYHAKNCEEQKCPVPFC 2460          
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Match: tbrd-1 (gene:FBgn0039124 transcript:FBtr0084525)

HSP 1 Score: 62.003 bits (149), Expect = 1.916e-9
Identity = 36/84 (42.86%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  178 LLRNPSSYPFRNEVDS--LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIF 423
            L RN  SY FR+ VDS  L  P+Y  +VK PM L+TI+++L +K Y +  + + DF LIF+N +L+N   S  Y+    L+E F
Sbjct:   54 LWRNRFSYHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYNLEGSPVYQAGKLLMEAF 137          
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 496.508 bits (1277), Expect = 7.832e-151
Identity = 292/779 (37.48%), Postives = 425/779 (54.56%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD-SLLK-PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            K I+  + L  + +P  E L R +P S PFR  VD SLL  P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF +   + +     PS P    +  +F   KND L  E FV C  C RK H IC LH  T   + F C  C  K+   +KE  ++A+R+P T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPY++KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+FQPR L+TEVYH ILI YLDY ++Q + T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                       +  GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L    + ++  PI++ D    L    L++ RD+ L   R+ +LEFS+LRR+K++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1049 KKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADR--YHFCEKCFNEIQGETVSLGDDPSQPQTSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESVETTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDP---LMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQ-DRFVYTCNECKH-HVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1820          
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Match: CR354584.4 (E1A binding protein p300 a [Source:NCBI gene;Acc:559273])

HSP 1 Score: 494.197 bits (1271), Expect = 5.190e-150
Identity = 291/787 (36.98%), Postives = 429/787 (54.51%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD-SLLK-PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYSTSEFVSL------------KNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            K I+  + L  + +P  E L R +P S PFR  VD SLL  P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF +   E   +  DPS+  + + F+++            KND L  E FV C  C RK H IC LH  T   + F C  C  K+   +KE  ++A+R+P T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPY++KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+FQPR L+TEVYH ILI YLDY ++Q + T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                       +  GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L    + ++  PI++ D    L    L++ RD+ L   R+ +LEFS+LRR+K++T+ +L EL   +Q +  + C+ CK  ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1044 KKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADR--YHFCEKCFNEIQGETVSLGDDPSQPQTATIFLNISRSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESVETTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDP---LMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQDRFVYTCNECKH-HVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1824          
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 494.197 bits (1271), Expect = 5.369e-150
Identity = 293/788 (37.18%), Postives = 429/788 (54.44%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD-SLLK-PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYSTSEFVSL------------KNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            K I+  + L  + +P  E L R +P S PFR  VD SLL  P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF +   E   +  DPS+  + + F+++            KND L  E FV C  C RK H IC LH  T   + F C  C  K+   +KE  ++A+R+P T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPY++KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+FQPR L+TEVYH ILI YLDY ++Q + T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                       +  GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L    + ++  PI++ D    L    L++ RD+ L   R+ +LEFS+LRR+K++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1048 KKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADR--YHFCEKCFNEIQGETVSLGDDPSQPQTATIFLNISRSINKDQFEKKKNDTLDPELFVECMDCGRKMHQICVLHNETIWPSGFVCDGCLKKSNKTRKENKYAAKRLPQTKLGNFLETRVNAYLKRQNHPESGEVTVRVVHVSEKMVEVKPGMKSRFVDSGEMSESFPYKSKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRFLRTEVYHEILIGYLDYAKRQGFTTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKAVAERVVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSNESVETTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLFAAPNSNALLPIVDPDP---LMACDLMDGRDAFLTIARDKHLEFSSLRRSKWSTMCMLVELHNQSQ-DRFVYTCNECKH-HVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNSQVASTTQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1828          
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Match: AL953841.4 (CREB binding protein a [Source:NCBI gene;Acc:566841])

HSP 1 Score: 490.73 bits (1262), Expect = 3.711e-149
Identity = 285/781 (36.49%), Postives = 417/781 (53.39%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGDS--------------KSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +     +     P+ P  + S  +F   KND L  E FV C  C RK H IC LH      + F C  C  K+   +KE  F+A+R+ +T L  +IE RVN  L   ++    ++ VRV+A +   V++KP +   +      + +FPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+TAH+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDS              KSSL  SR    K  + +V +D+  K+    ++  E F V+ L+    ++S  PII+ D    L N  L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q D F   C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  954 SQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDGTYYSYQ----NRYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNCLKKSAKSRKENKFTAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKAKFVETGEMMEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTAHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNAKKKNNKKTNKNKSSL--SRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPIVNSLLPIIDSD---PLLNCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQ-DRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNAKGHEHQMVKWGLGLDDDSSSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1719          
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Match: crebbpa (CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-050208-439])

HSP 1 Score: 490.345 bits (1261), Expect = 4.863e-149
Identity = 285/783 (36.40%), Postives = 418/783 (53.38%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGDS--------------KSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIIN----IDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +     +     P+ P  + S  +F   KND L  E FV C  C RK H IC LH      + F C  C  K+   +KE  F+A+R+ +T L  +IE RVN  L   ++    ++ VRV+A +   V++KP +   + +    + +FPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+TAH+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDS              KSSL  SR    K  + +V +D+  K+    ++  E F V+ L+     S PI+N    I  ++ L N  L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q D F   C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  933 SQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDGTYYSYQ----NRYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICDNCLKKSAKSRKENKFTAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKAKFVDTGEMMEAFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTAHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNAKKKNNKKTNKNKSSL--SRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLH-----SGPIVNSLLPILDSDPLLNCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQ-DRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNAKGHEHQMVKWGLGLDDDSSSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1698          
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 488.034 bits (1255), Expect = 8.958e-148
Identity = 286/782 (36.57%), Postives = 417/782 (53.32%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCF----GKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF    G+C      P+ P    S  +F   KND L  E +V C +C RK H IC LH  T     F C+ C  K    +KE  FSA+R+PTT L  F+E+RVN  L   +N    ++++RV+  +   V++KP +   + +      SFPYR KA++AF+++DG ++ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDK+V   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+     +S  PI+  D    L    L++ RD+ L   R+ +LEFS+LRRAK++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   HEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1071 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPKYGLLADR--YHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1845          
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 486.878 bits (1252), Expect = 1.012e-147
Identity = 279/773 (36.09%), Postives = 414/773 (53.56%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCF----GKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            +YI+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF    G+C      P+ P    S  +F   KND L  E +V C +C RK H IC LH  T     F C+ C  K    +KE  FSA+R+PTT L  F+E+RVN  L   +N    ++++RV+  +   V++KP +   + +      SFPYR KA++AF+++DG ++ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDK+V   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+     +S  PI+  D    L    L++ RD+ L   R+ +LEFS+LRRAK++T+ +L EL   +Q +  + C+ CK  ++  R+ CT C D+DLC  CY+   HEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  856 QYIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPD---PLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1616          
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 483.797 bits (1244), Expect = 1.355e-146
Identity = 278/771 (36.06%), Postives = 412/771 (53.44%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCF----GKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF    G+C      P+ P    S  +F   KND L  E +V C +C RK H IC LH  T     F C+ C  K    +KE  FSA+R+PTT L  F+E+RVN  L   +N    ++++RV+  +   V++KP +   + +      SFPYR KA++AF+++DG ++ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDK+V   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+     +S  PI+  D    L    L++ RD+ L   R+ +LEFS+LRRAK++T+ +L EL   +Q +  + C+ CK  ++  R+ CT C D+DLC  CY+   HEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  881 IFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPD---PLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1639          
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 482.256 bits (1240), Expect = 3.651e-146
Identity = 277/767 (36.11%), Postives = 410/767 (53.46%), Query Frame = 1
Query:  139 KRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCF----GKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF    G+C      P+ P    S  +F   KND L  E +V C +C RK H IC LH  T     F C+ C  K    +KE  FSA+R+PTT L  F+E+RVN  L   +N    ++++RV+  +   V++KP +   + +      SFPYR KA++AF+++DG ++ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDK+V   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+     +S  PI+  D    L    L++ RD+ L   R+ +LEFS+LRRAK++T+ +L EL   +Q +  + C+ CK  ++  R+ CT C D+DLC  CY+   HEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  884 EELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPD---PLIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQDRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1638          
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Match: supv3l1 (Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE-989015])

HSP 1 Score: 482.256 bits (1240), Expect = 7.403e-146
Identity = 286/790 (36.20%), Postives = 419/790 (53.04%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD----------SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCF----GKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD          S+L+ +Y  IVK PM L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF    G+C      P+ P    S  +F   KND L  E +V C +C RK H IC LH  T     F C+ C  K    +KE  FSA+R+PTT L  F+E+RVN  L   +N    ++++RV+  +   V++KP +   + +      SFPYR KA++AF+++DG ++ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDK+V   V  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+     +S  PI+  D    L    L++ RD+ L   R+ +LEFS+LRRAK++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   HEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1072 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPKNTSVLQ-DYFEIVKTPMDLSTIKRKLDTGQYQEPWQYVEDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNSSPKYGLLADR--YHFCEKCFNEIQGECVSLGDDPTQPQTTISKDQFSKRKNDTLDPEQYVECLECGRKMHQICVLHNETIWPTGFVCEGCLKKTGRNRKENKFSAKRLPTTRLGSFLENRVNDFLRRQNNPEAGEVIIRVVHASDKTVEVKPGMKAKFVDTGEMAESFPYRTKALFAFEEVDGVELCFFGMHVQEYGSDCPQPNQRRVYISYLDSVHFFRPKNLRTAVYHEILIGYLEYVKRLGYTAGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYKKMLDKSVSERVIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESIEVGKGDSKNAKKKNNKKTSKNKSSLSRGSKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPAANSLPPIVEPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAKWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKTHEHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1853          
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 485.337 bits (1248), Expect = 4.778e-147
Identity = 285/779 (36.59%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    IS+  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1079 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1844          
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 484.952 bits (1247), Expect = 6.713e-147
Identity = 285/779 (36.59%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    IS+  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1041 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1806          
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Match: Ep300 (E1A binding protein p300 [Source:MGI Symbol;Acc:MGI:1276116])

HSP 1 Score: 474.937 bits (1221), Expect = 1.633e-143
Identity = 282/778 (36.25%), Postives = 417/778 (53.60%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  I+D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF +   E   +  DPS+  +T    +F   KND L  E FV C++C RK H IC LH      + F C  C  K    +KE   SA+R+P+T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG D+ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRA+++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H+H M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1041 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1805          
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 407.142 bits (1045), Expect = 1.120e-124
Identity = 214/488 (43.85%), Postives = 292/488 (59.84%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML 1521
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+   LC  P +     Y+  S KY     +D    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +
Sbjct:  615 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGL--LADRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESI 1100          
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Match: Crebbp (CREB binding protein [Source:MGI Symbol;Acc:MGI:1098280])

HSP 1 Score: 144.05 bits (362), Expect = 5.251e-39
Identity = 67/166 (40.36%), Postives = 92/166 (55.42%), Query Frame = 1
Query: 1024 SFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML 1521
            SFPYR KA++AF++IDG DV FF ++ QEY   CP PN R                                      Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +
Sbjct:   14 SFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTR--------------------------------------YVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESI 141          
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Match: sp|Q6JHU9|CBP_RAT (Histone lysine acetyltransferase CREBBP OS=Rattus norvegicus OX=10116 GN=Crebbp PE=1 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 5.212e-146
Identity = 285/779 (36.59%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    IS+  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1079 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1844          
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Match: sp|Q92793|CBP_HUMAN (CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3)

HSP 1 Score: 484.952 bits (1247), Expect = 5.212e-146
Identity = 284/779 (36.46%), Postives = 415/779 (53.27%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    I++  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1078 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPD---PLLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1843          
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Match: sp|Q09472|EP300_HUMAN (Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2)

HSP 1 Score: 479.174 bits (1232), Expect = 4.784e-144
Identity = 282/778 (36.25%), Postives = 418/778 (53.73%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF +   E   +  DPS+  +T    +F   KND L  E FV C++C RK H IC LH        F C  C  K+   +KE  FSA+R+P+T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG D+ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRA+++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H+H M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1042 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1806          
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Match: sp|B2RWS6|EP300_MOUSE (Histone acetyltransferase p300 OS=Mus musculus OX=10090 GN=Ep300 PE=1 SV=2)

HSP 1 Score: 474.937 bits (1221), Expect = 1.142e-142
Identity = 282/778 (36.25%), Postives = 417/778 (53.60%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             +  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  I+D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+        C I +  +Y  ++    +    CE CF +   E   +  DPS+  +T    +F   KND L  E FV C++C RK H IC LH      + F C  C  K    +KE   SA+R+P+T L  F+E+RVN  L   ++  S ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG D+ FF ++ QEY   CP PN RRVYISYLDSVH+F+P+ L+T VYH ILI YL+Y ++  Y T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                         GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRA+++T+ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H+H M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1041 GQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCY----GKQLCTIPRDATYYSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDPDP---LIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1805          
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Match: sp|P45481|CBP_MOUSE (Histone lysine acetyltransferase CREBBP OS=Mus musculus OX=10090 GN=Crebbp PE=1 SV=3)

HSP 1 Score: 462.225 bits (1188), Expect = 3.242e-138
Identity = 279/779 (35.82%), Postives = 409/779 (52.50%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            S+  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    S  +F   KND L  E FV C +C RK H IC LH      + F C  C  K   P+KE  FSA+R+ TT L   +E RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ Q      P     RVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GDSK++              +SR    K  + +V +D+  K+    ++  E F V+ L+    IS+  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR+K++TL +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY+   H H M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1079 SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDAAYYSYQ----NRYHFCEKCFTEIQGENVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQNTALIAPHQIQGRVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDP---LLSCDLMDGRDAFLTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1844          
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Match: A0A1B6LB89 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.40121 PE=4 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 9.876e-158
Identity = 280/786 (35.62%), Postives = 434/786 (55.22%), Query Frame = 1
Query:  112 EENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE-------------------------MLSMTGDSK-----------SSLPVSRKPPIKRKLDSVK-------DDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE-----------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            ++ K ++    L  + +P  E+L R +P S PFR  VD  SL  PEY  IV++PM L+T+K KL +  Y++PW+ ++D WL+F+NA L+N+ +S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+ +SY       SD    C+ CF     +   +  DP++  +     +F  +KND L  E  V C  C RK H IC LH+       F C+ C  K  + +K+  F+A+R+P T L  +IE+RVN  L        ++ +RV+A +   V++KP + + + +       FPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ YLDY +Q  Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDK ++  + ++Y +I +  +E+++    ++PYF+GDFWPN + E                          LS+T DS+            +   ++    +RK +S K       +D+ +K+    ++  E F V+ L+  +  +S +  I   +   N  L++ RD+ L   RE + EFS+LRRAK++++ +L EL    Q +  + C+ C K ++  RY CT C DFDLC  CYDK GH H M ++ + L +                 + ++  +  L    +C++  CR  SC++MK+++ H + C   +  DC +C  L  L   H  YC+ TKC +  CQ
Sbjct:   59 KKKKCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQSLGIPEYFEIVRRPMDLSTVKRKLDTGQYSDPWEYVDDVWLMFDNAWLYNRKSSRVYRYCTKLSEVFEVEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNRSYGVV----SDRYTFCQKCFNDIPGDTVTLGDDPTQAQTAIKKEQFKEMKNDHLELEPLVECQDCGRKLHQICVLHMENIWPQGFVCENCLKKKASKRKDNKFNAKRLPVTKLGTYIETRVNNFLKKKEAGAGEVAIRVVASSDKIVEVKPGMRNKFVDNGDLPEQFPYRAKALFAFEDIDGTDVCFFGMHVQEYGSECPTPNTRRVYIAYLDSVHFFRPRQFRTAVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPQEQKIPKPKRLQEWYKKMLDKGIIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAANAFLSITEDSEVGADGKKKGQKKAKKSNKSKANQRKSNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAAS-LQPIQDPDPFINCDLMDGRDAFLTMARERHYEFSSLRRAKYSSMAMLYELHNQGQDRFVYTCNNC-KGHVETRYHCTVCDDFDLCVTCYDKDGHPHKMEKLGLDLDDGSTPADQKQANPQEARKLSIQRCIQSLVHACQCRDANCRLPSCLKMKRVVQHTKNCKRKANGDCPICKQLIALCCYHAKYCQETKCPVPFCQ 838          
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Match: A0A1B6GA30 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.23844 PE=4 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 8.124e-157
Identity = 281/786 (35.75%), Postives = 434/786 (55.22%), Query Frame = 1
Query:  112 EENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY-KNRNI-HSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE-------------------------MLSMTGDSK-----------SSLPVSRKPPIKRKLDSVK-------DDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE-----------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            ++ K ++    L  + +P  E+L R +P S PFR  VD  SL  PEY  IVK+PM L+T+K KL +  Y++PW+ ++D WL+F+NA L+N+ +S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+ +SY       SD    C+ CF       +     P+ P  +    +F  +KND L  E  V C  C RK H IC LH+       F C+ C  K  + +K+  F+A+R+P T L  +IE+RVN  L        ++ +RV+A +   V++KP + + + +N ++   FPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ YLDY +Q  Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDK ++  + ++Y +I +  +E+++    ++PYF+GDFWPN + E                          LS+T DS+            +   ++    +RK +S K       +D+ +K+    ++  E F V+ L+  +  +S +  I   +   N  L++ RD+ L   RE + EFS+LRRAK++++ +L EL    Q +  + C+ CK  ++  RY CT C DFDLC  CYDK GH H M ++ + L +                 + ++  +  L    +C++  CR  SC++MK+++ H + C   +  DC +C  L  L   H  YC+  KC +  CQ
Sbjct:  196 KKKKCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQSLGIPEYFEIVKRPMDLSTVKRKLDTGQYSDPWEYVDDVWLMFDNAWLYNRKSSRVYRYCTKLSEVFEVEIDPVMQLLGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNRSYGVV----SDRYTFCQKCFNDIPGDTVTLGEDPTQPQTIIKKDQFKEMKNDHLELEPLVECQDCGRKLHQICVLHMENIWPQGFVCENCLKKKGSKRKDNKFNAKRLPVTKLGTYIETRVNNFLKKKEAGAGEVAIRVVASSDKIVEVKPGMRNKFVENGDLPEQFPYRAKALFAFEDIDGTDVCFFGMHVQEYGSECPTPNTRRVYIAYLDSVHFFRPRQFRTAVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPQEQKIPKPKRLQEWYKKMLDKGIIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAANAYLSITEDSEVGADGKKKGQKKAKKSNKSKANQRKSNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAAS-LQPIQDPDPFINCDLMDGRDAFLTMAREKHYEFSSLRRAKYSSMAMLYELHNQGQDRFVYTCNNCK-GHVETRYHCTICDDFDLCVTCYDKDGHPHKMEKLGLDLDDGSTPADQKQANPQEARKLSIQRCIQSLVHACQCRDANCRLPSCLKMKRVVQHTKNCKRKANGDCPICKQLIALCCYHAKYCQEMKCPVPFCQ 975          
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Match: A0A1B6KPK2 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.40124 PE=4 SV=1)

HSP 1 Score: 494.967 bits (1273), Expect = 7.692e-156
Identity = 275/782 (35.17%), Postives = 429/782 (54.86%), Query Frame = 1
Query:  112 EENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKC-SEKFIIPSDPSKLYST---SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE-------------------------MLSMTGDSK-----------SSLPVSRKPPIKRKLDSVK-------DDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE-----------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            ++ K ++    L  + +P  E+L R +P S PFR  VD  SL  PEY  IV++PM L+T+K KL +  Y++PW+ ++D WL+F+NA L+N+ +S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+        C I +   Y  ++    +    C+ CF     +   +  DP++  +     +F  +KND L  E  V C  C RK H IC LH+       F C+ C  K  + +K+  F+A+R+P T L  +IE+RVN  L        ++ +RV+A +   V++KP + + + +       FPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ YLDY +Q  Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDK ++  + ++Y +I +  +E+++    ++PYF+GDFWPN + E                          LS+T DS+            +   ++    +RK +S K       +D+ +K+    ++  E F V+ L+  +  +S +  I   +   N  L++ RD+ L   RE + EFS+LRRAK++++ +L EL    Q +  + C+ C K ++  RY CT C DFDLC  CYDK GH H M ++ + L +                 + ++  +  L    +C++  CR  SC++MK+++ H + C   +  DC +C  L  L   H  YC+ TKC +  CQ
Sbjct:   59 KKKKCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQSLGIPEYFEIVRRPMDLSTVKRKLDTGQYSDPWEYVDDVWLMFDNAWLYNRKSSRVYRYCTKLSEVFEVEIDPVMQALGYCCGRKYTFNPQVLCCY----GKQLCTIPRDAKYYSYQ----NRYTFCQKCFNDIPGDTVTLGDDPTQAQTAIKKEQFKEMKNDHLELEPLVECQDCGRKLHQICVLHMENIWPQGFVCENCLKKKASKRKDNKFNAKRLPVTKLGTYIETRVNNFLKKKEAGAGEVAIRVVASSDKIVEVKPGMRNKFVDNGDLPEQFPYRAKALFAFEDIDGTDVCFFGMHVQEYGSECPTPNTRRVYIAYLDSVHFFRPRQFRTAVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPQEQKIPKPKRLQEWYKKMLDKGIIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAANAFLSITEDSEVGADGKKKGQKKAKKSNKSKANQRKSNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAAS-LQPIQDPDPFINCDLMDGRDAFLTMARERHYEFSSLRRAKYSSMAMLYELHNQGQDRFVYTCNNC-KGHVETRYHCTVCDDFDLCVTCYDKDGHPHKMEKLGLDLDDGSTPADQKQANPQEARKLSIQRCIQSLVHACQCRDANCRLPSCLKMKRVVQHTKNCKRKANGDCPICKQLIALCCYHAKYCQETKCPVPFCQ 830          
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Match: A0A1B6IV49 (Uncharacterized protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.52389 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 1.141e-155
Identity = 281/786 (35.75%), Postives = 434/786 (55.22%), Query Frame = 1
Query:  112 EENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY-KNRNI-HSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE-------------------------MLSMTGDSK-----------SSLPVSRKPPIKRKLDSVK-------DDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE-----------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            ++ K ++    L  + +P  E+L R +P S PFR  VD  SL  PEY  IVK+PM L+T+K KL +  Y++PW+ ++D WL+F+NA L+N+ +S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+   LC  P + +   Y+ +SY       SD    C+ CF       +     P+ P  +    +F  +KND L  E  V C  C RK H IC LH+       F C+ C  K  + +K+  F+A+R+P T L  +IE+RVN  L        ++ +RV+A +   V++KP + + + +N ++   FPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ YLDY +Q  Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDK ++  + ++Y +I +  +E+++    ++PYF+GDFWPN + E                          LS+T DS+            +   ++    +RK +S K       +D+ +K+    ++  E F V+ L+  +  +S +  I   +   N  L++ RD+ L   RE + EFS+LRRAK++++ +L EL    Q +  + C+ CK  ++  RY CT C DFDLC  CYDK GH H M ++ + L +                 + ++  +  L    +C++  CR  SC++MK+++ H + C   +  DC +C  L  L   H  YC+  KC +  CQ
Sbjct:  178 KKKKCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQSLGIPEYFEIVKRPMDLSTVKRKLDTGQYSDPWEYVDDVWLMFDNAWLYNRKSSRVYRYCTKLSEVFEVEIDPVMQLLGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNRSYGVV----SDRYTFCQKCFNDIPGDTVTLGEDPTQPQTIIKKDQFKEMKNDHLELEPLVECQDCGRKLHQICVLHMENIWPQGFVCENCLKKKGSKRKDNKFNAKRLPVTKLGTYIETRVNNFLKKKEAGAGEVAIRVVASSDKIVEVKPGMRNKFVENGDLPEQFPYRAKALFAFEDIDGTDVCFFGMHVQEYGSECPTPNTRRVYIAYLDSVHFFRPRQFRTAVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPQEQKIPKPKRLQEWYKKMLDKGIIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAANAYLSITEDSEVGADGKKKGQKKAKKSNKSKANQRKSNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAAS-LQPIQDPDPFINCDLMDGRDAFLTMAREKHYEFSSLRRAKYSSMAMLYELHNQGQDRFVYTCNNCK-GHVETRYHCTICDDFDLCVTCYDKDGHPHKMEKLGLDLDDGSTPADQKQANPQEARKLSIQRCIQSLVHACQCRDANCRLPSCLKMKRVVQHTKNCKRKANGDCPICKQLIALCCYHAKYCQEMKCPVPFCQ 957          
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Match: A0A1B6EV37 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.23837 PE=4 SV=1)

HSP 1 Score: 496.508 bits (1277), Expect = 4.883e-155
Identity = 276/782 (35.29%), Postives = 429/782 (54.86%), Query Frame = 1
Query:  112 EENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY-KNRNI-HSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITE-------------------------MLSMTGDSK-----------SSLPVSRKPPIKRKLDSVK-------DDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE-----------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            ++ K ++    L  + +P  E+L R +P S PFR  VD  SL  PEY  IVK+PM L+T+K KL +  Y++PW+ ++D WL+F+NA L+N+ +S  Y+ C KL E+F+   + +M+ LG+CCG KYTF+PQ L C+        C I +   Y  ++    +    C+ CF       +     P+ P  +    +F  +KND L  E  V C  C RK H IC LH+       F C+ C  K  + +K+  F+A+R+P T L  +IE+RVN  L        ++ +RV+A +   V++KP + + + +N ++   FPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYI+YLDSVH+F+PR+ +T VYH IL+ YLDY +Q  Y  AH+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDK ++  + ++Y +I +  +E+++    ++PYF+GDFWPN + E                          LS+T DS+            +   ++    +RK +S K       +D+ +K+    ++  E F V+ L+  +  +S +  I   +   N  L++ RD+ L   RE + EFS+LRRAK++++ +L EL    Q +  + C+ CK  ++  RY CT C DFDLC  CYDK GH H M ++ + L +                 + ++  +  L    +C++  CR  SC++MK+++ H + C   +  DC +C  L  L   H  YC+  KC +  CQ
Sbjct:  196 KKKKCLFKPDELRQALMPTLEKLYRQDPESLPFRQPVDPQSLGIPEYFEIVKRPMDLSTVKRKLDTGQYSDPWEYVDDVWLMFDNAWLYNRKSSRVYRYCTKLSEVFEVEIDPVMQLLGYCCGRKYTFNPQVLCCY----GKQLCTIPRDAKYYSYQ----NRYTFCQKCFNDIPGDTVTLGEDPTQPQTIIKKDQFKEMKNDHLELEPLVECQDCGRKLHQICVLHMENIWPQGFVCENCLKKKGSKRKDNKFNAKRLPVTKLGTYIETRVNNFLKKKEAGAGEVAIRVVASSDKIVEVKPGMRNKFVENGDLPEQFPYRAKALFAFEDIDGTDVCFFGMHVQEYGSECPTPNTRRVYIAYLDSVHFFRPRQFRTAVYHEILLGYLDYVKQLGYTMAHIWACPPSEGDDYIFHCHPQEQKIPKPKRLQEWYKKMLDKGIIERIVLDYKDILKQAMEDKLSSAAELPYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAANAYLSITEDSEVGADGKKKGQKKAKKSNKSKANQRKSNSKKSNTPQTGNDLSAKIFATMEKHKEVFFVIRLHSAQSAAS-LQPIQDPDPFINCDLMDGRDAFLTMAREKHYEFSSLRRAKYSSMAMLYELHNQGQDRFVYTCNNCK-GHVETRYHCTICDDFDLCVTCYDKDGHPHKMEKLGLDLDDGSTPADQKQANPQEARKLSIQRCIQSLVHACQCRDANCRLPSCLKMKRVVQHTKNCKRKANGDCPICKQLIALCCYHAKYCQEMKCPVPFCQ 967          
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Match: crebbpa (CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-050208-439])

HSP 1 Score: 480.33 bits (1235), Expect = 5.498e-146
Identity = 277/774 (35.79%), Postives = 410/774 (52.97%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +     +     P+ P  + S  +F   KND L  E FV C  C RK H IC LH        F C  C  K+   +KE  FSA+R+ +T L  +IE RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++ YF+GDFWPN + E +                          GDSK+               VSR    K  + +V +D+  K+    ++  E F V+ L+    +++  PI++ D    L    L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q +  + C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  740 RKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDGTYYSYQ----NRYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPAGFICDNCLKKSVKSRKENKFSAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELSYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNGKKKNNKKTNKNKSSVSRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIMDPD---PLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDSSGQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1501          
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Match: crebbpa (CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-050208-439])

HSP 1 Score: 480.33 bits (1235), Expect = 6.589e-146
Identity = 277/774 (35.79%), Postives = 410/774 (52.97%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGDSKSSLP------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG KY F PQTL C+        C I +  +Y  ++    +    CE CF +     +     P+ P  + S  +F   KND L  E FV C  C RK H IC LH        F C  C  K+   +KE  FSA+R+ +T L  +IE RVN  L   ++    ++ VRV+A +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y+T H+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++ YF+GDFWPN + E +                          GDSK+               VSR    K  + +V +D+  K+    ++  E F V+ L+    +++  PI++ D    L    L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q +  + C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  761 RKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPILLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQGLGYCCGRKYEFSPQTLCCY----GKQLCTIPRDGTYYSYQ----NRYHFCEKCFNEIQGDSVTLGDDPAQPQTMISKDQFERKKNDTLDPEPFVECKDCGRKMHQICVLHYEVIWPAGFICDNCLKKSVKSRKENKFSAKRLQSTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECPFPNTRRVYISYLDSIHFFKPRMLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPADQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELSYFEGDFWPNVLEESIKELEQEEEERKKEENTAACETPEGTPGDSKNGKKKNNKKTNKNKSSVSRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIMDPD---PLLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDSSGQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1522          
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Match: ep300b (E1A binding protein p300 [Source:NCBI gene;Acc:103032522])

HSP 1 Score: 478.789 bits (1231), Expect = 8.610e-145
Identity = 283/794 (35.64%), Postives = 422/794 (53.15%), Query Frame = 1
Query:  109 SEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLKP-------------EYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVS-KILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            ++  K I+  + +  + +P  E L R +P S PFR  VD  L               +Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M+TLG+CCG K  F PQTL C+   LC  P +     Y+  S KY   ++      CE CF +   + +     P+ P    +  +F   +ND L  E FV C+ C RK H IC LH  T   + F C  C  KA   +KE  ++A+R+P T L  F+E+RVN  L   ++  S ++ +RV+  +   V++KP +   + +      SFPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+FQPR+L+T VYH ILI Y++Y ++  + T H+W+CPP  GDDY+FH HP +QK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                       + TGD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L      +S  PI++ D    L    L++ RD+ L   R+ +LEFS+LRRAK++++ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1030 TQSKKKIFKPEEVRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPVRIRTSNKTNLDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQTLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLANR--YHFCEKCFNEIQGENVSLGDDPTQPQTSINKDQFQKKRNDTLDPELFVECNDCCRKMHQICVLHNETIWPSGFVCDGCLKKANKTRKENKYAAKRLPQTKLGCFLETRVNDYLKRQAHPESGEVTIRVVHVSDKMVEVKPGMKSRFVDSGEMAESFPYRTKAMFAFEDIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRQLRTGVYHEILIGYIEYVKKLGFTTGHIWACPPSEGDDYIFHCHPLEQKIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSSESVDATTGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPTANSLPPIVDPDP---LMACDLMDGRDAFLTLARDKHLEFSSLRRAKWSSMCMLVELHNQSQ-DRFVYTCNECKH-HVETRFHCTVCEDYDLCITCYNTKGHEHKMEKLGLGLDDESSNQAAAATQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1816          
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Match: ep300a (histone acetyltransferase p300-like [Source:NCBI gene;Acc:103044365])

HSP 1 Score: 471.085 bits (1211), Expect = 3.530e-142
Identity = 284/779 (36.46%), Postives = 423/779 (54.30%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD-SLLK-PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH---LCD-PNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------------------SMTGD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            K I+  + L  + +P  E L R +P S PFR  VD SLL  P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG K  F PQTL C+   LC  P +     Y+  S KY   +D      CE CF +   + +     PS P    +  +F   KND L  E FV C  C RK H IC LH  T   + F C  C  KA   +KE  ++A+R+P T L  ++E+RVN  +   ++    ++ +RV+  +   V++KP +   + +      SFPYR+KA++AF+ IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+FQPR ++T VYH ILI YL+Y ++  + T H+W+CPP  GDDY+FH HPTDQ++PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                       +  GD            SK+   +SR    K  + +V +D+  K+    ++  E F V+ L+   + ++  PII+ D    L    L++ RD+ L   R+ +LEFS+LRR++++++ +L EL   +Q D F   C+ CK  ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1060 KKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPSLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDAAYFSYQNSSPKYGLLADR--YHFCEKCFNEIQGESVSLGDDPSQPQTSITKEQFEKKKNDTLDPELFVECLDCGRKMHQICVLHHETIWPSGFVCNGCLKKANKTRKENKYAAKRLPPTKLGIYLENRVNDYVKRQNHPEAGEVTIRVVHVSDKVVEVKPGMKARFVDTGEMAESFPYRSKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFQPRCMRTTVYHEILIGYLEYAKKLGFTTGHIWACPPSEGDDYIFHCHPTDQRIPKPKRLQEWYKKMLDKAVAERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENNTSSESVDATKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLSAGPNSNALPPIIDPDP---LMACDLMDGRDAFLTLARDKHLEFSSLRRSRWSSMCMLVELHNQSQ-DRFVYTCNECKH-HVETRFHCTVCEDYDLCITCYNTKGHEHKMDKLGLGLDDESNNQAAASMQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1831          
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Match: brwd3 (bromodomain and WD repeat domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-100921-43])

HSP 1 Score: 61.6178 bits (148), Expect = 4.431e-9
Identity = 33/100 (33.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  148 IDSFIPLCEELLR----NPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPN--SNAYKECVKLVEIFKD 429
            + +++  C+EL+R    +P S PFR  VD    P+Y+ I+  PM L T+ E L++ +Y  P +   D  LIF+N+  +  PN  S  Y   + L   F++
Sbjct: 1285 VQAWLVKCKELMRKMIASPDSEPFRQPVDLFAYPDYRDIIDTPMDLGTVSETLMAGNYENPMEFAKDVRLIFSNSRAYT-PNKKSQIYSMTLSLSASFEN 1383          
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Match: ep300a (E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GENE-080403-16])

HSP 1 Score: 337.806 bits (865), Expect = 2.670e-99
Identity = 196/581 (33.73%), Postives = 293/581 (50.43%), Query Frame = 1
Query:  676 EFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERI----PTTDLSEFIESRVNIMLSDYS-NSVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKLDSVKDD-----------------------------------IHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQ-KDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE---------------IRLRNMLTLLYEIIRC--QECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            +F   KND L  E FV C +C RK H ICALH  T     F C  C  K    +KE  F ++ +    PT+ L   +E+RVN  L   +     ++ VRV+  +   V++KP +   + +      SFPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+F+PR L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQ++PK  RL +WYK+MLDKAV   +  +Y +I +   ++++    ++PYF+GDFWPN + E +      +               +  K D                                   +  K+    ++  E F V+ L+     +S +  I   + L    L++ RD+ L   R+ + EFS+LRRAK++T+ +L EL    Q +  + C+ CK  ++  RY CT C D+DLC  CY   GHEH M +  + L +               + ++  +  L    +C    C   SC++MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:    6 QFEKKKNDTLDPEPFVECKECGRKLHQICALHNETIWPAGFVCDTCLKKTGRTRKENKFCSKSLNAGLPTSKLGTHLENRVNNFLRRQNCPEAGEVTVRVVHVSDKTVEVKPGMKARFVDNGEMADSFPYRAKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPRHLRTAVYHEILIGYLEYVKKIGYTQGHIWACPPSEGDDYIFHCHPPDQRIPKPKRLQEWYKKMLDKAVAERIVHDYKDILKQATDDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREETSASCESTEGKKGDSKNAKKKNNKKTSKSKSSSSRTSKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRLHPPAAANS-VPPIQDPDPLVTCDLMDGRDAFLTMARDKHYEFSSLRRAKWSTMCMLVELHNQGQDRFVYTCNECKH-HVETRYHCTVCEDYDLCVACYKTKGHEHKMEKWGLGLDDDSNNQPMQNPQESRRLSIQRCIQSLVHACQCLNANCSLPSCLKMKRVVQHTRVCKRKTNGGCPICKQLIALCCFHAKHCQENKCPVPFC 584          
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006336.1 (pep scaffold:Pmarinus_7.0:GL479543:3524:30791:1 gene:ENSPMAG00000005717.1 transcript:ENSPMAT00000006336.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.413 bits (324), Expect = 9.577e-31
Identity = 62/133 (46.62%), Postives = 85/133 (63.91%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACH 510
            K ++  + L  + +P  E L R +P S PFR  VD  +L  P+Y  IVK PM L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+
Sbjct:  790 KKVFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQALGIPDYFDIVKTPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFEQEIDPVMQSLGYCCGRKYEFSPQTLCCY 922          
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006283.1 (pep scaffold:Pmarinus_7.0:GL487345:511:5582:1 gene:ENSPMAG00000005678.1 transcript:ENSPMAT00000006283.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.362e-11
Identity = 36/116 (31.03%), Postives = 60/116 (51.72%), Query Frame = 1
Query:  166 LCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPN--SNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLAC 507
            L   +L    S PFR  VD +  P+Y+TI+  PM L T++E+L   +Y +P D   D  LIF+NA  +  PN  S  Y   ++L  +F+++   ++    +   ++Y    +  AC
Sbjct:  153 LVSVILEREDSEPFRQPVDPIAYPDYRTIIPTPMDLGTVRERLREDTYHDPVDFCKDVRLIFSNAKAYT-PNKKSRIYGMTLRLSALFEEHIRGIVSE--YKSALRYHERRERAAC 265          
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010200.1 (pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 gene:ENSPMAG00000009229.1 transcript:ENSPMAT00000010200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.956e-7
Identity = 23/76 (30.26%), Postives = 46/76 (60.53%), Query Frame = 1
Query:  196 SYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIF 423
            ++PF   VD    P Y  ++K+PM L+TI+++L S+ Y++  + + D   +F+N   +N P  + + +C +++E F
Sbjct: 2773 AWPFLEPVDEEEAPGYYEVIKEPMDLSTIEKRLSSRFYSKLAEFVGDMTKMFDNCRYYN-PGESTFAKCAEVLETF 2847          
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008098.1 (pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 gene:ENSPMAG00000007319.1 transcript:ENSPMAT00000008098.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 2.046e-7
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  178 LLRNPSSYPFRNEVDS--LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSN 387
            L R+  ++PF   VD+  L  P+Y  I+KQPM + TIK++L S  Y    + I+DF  +FNN  ++NKP  +
Sbjct:   50 LWRHHFAWPFLQPVDAAALNLPDYHKIIKQPMDMGTIKQRLESSYYWSASECISDFKTMFNNCYVYNKPGDD 121          

HSP 2 Score: 50.8322 bits (120), Expect = 1.251e-6
Identity = 31/92 (33.70%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  166 LCEELL-RNPSSY--PFRNEVDS--LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFK 426
            L +EL+ +N ++Y  PF N VD+  L   +Y  I+K PM L TI+ KL ++ Y    +  +D  L+F+N   +N P  +      KL ++F+
Sbjct:  328 LLKELISKNHAAYAWPFYNPVDARALGLHDYHDIIKHPMDLGTIRRKLEAREYASGQEFASDVRLMFSNCYKYNPPEHDVVAMARKLQDVFE 419          
BLAST of Histone acetyltransferase p300 vs. Ensembl Yeast
Match: RSC4 (Component of the RSC chromatin remodeling complex; found in close proximity to nucleosomal DNA; displaced from the surface of nucleosomal DNA after chromatin remodeling; acetylated (K25) by Gcn5p, altering replication stress tolerance; contains tandem bromodomains that recognize histone H3 acetylated on K14 (H3K14ac) by Gcn5p [Source:SGD;Acc:S000001716])

HSP 1 Score: 56.225 bits (134), Expect = 1.894e-8
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query:  196 SYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIF 423
            S PF   VD    PEY  IV  PM+L+ +K+ L    Y++ +D I D  L+F NA +FN P++  YK+   L   F
Sbjct:  210 SEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYF 285          
BLAST of Histone acetyltransferase p300 vs. Ensembl Yeast
Match: GCN5 (Catalytic subunit of ADA and SAGA histone acetyltransferase complexes; modifies N-terminal lysines on histones H2B and H3; acetylates Rsc4p, a subunit of the RSC chromatin-remodeling complex, altering replication stress tolerance; relocalizes to the cytosol in response to hypoxia; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; greater involvement in repression of RNAPII-dependent transcription than in activation [Source:SGD;Acc:S000003484])

HSP 1 Score: 54.299 bits (129), Expect = 6.470e-8
Identity = 29/86 (33.72%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  166 LCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIF 423
            +  EL  + +++PF   V+    P+Y   +K+PM L+T++ KL S  Y +  D I D  L+FNN  ++N  N++ YK   +L + F
Sbjct:  339 ILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGENTSYYKYANRLEKFF 424          
BLAST of Histone acetyltransferase p300 vs. Ensembl Yeast
Match: RSC1 (Component of the RSC chromatin remodeling complex; required for expression of mid-late sporulation-specific genes; contains two essential bromodomains, a bromo-adjacent homology (BAH) domain, and an AT hook; RSC1 has a paralog, RSC2, that arose from the whole genome duplication [Source:SGD;Acc:S000003288])

HSP 1 Score: 49.2914 bits (116), Expect = 2.767e-6
Identity = 27/64 (42.19%), Postives = 38/64 (59.38%), Query Frame = 1
Query:  235 PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFK 426
            P+Y  I++ P+SLNT+K++L    YT P D +NDF  I  NAM +N  +S  YK  + L    K
Sbjct:   45 PDYYIIIRNPISLNTLKKRL--PHYTSPQDFVNDFAQIPWNAMTYNAKDSVIYKYAILLESFIK 106          
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Match: EDO40753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S640])

HSP 1 Score: 459.144 bits (1180), Expect = 7.805e-142
Identity = 271/769 (35.24%), Postives = 402/769 (52.28%), Query Frame = 1
Query:  154 SFIPLCEELLRN-PSSYPFRNEVDSLLKP--EYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFI-IPSDPS---KLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-------------------------SMTGDSKSSLPVSRKPPIKRKLDSVKD------------DIHSKMLQMSKRFNEEFLVVVLN--RQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELF-RDNQKDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLS----------------------EIRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRC-SLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQ 2229
            + +P  E+L +  P S PFR+ VD  L    +Y  IV+ PM L+TIK KL +  Y  PW+  +D WL+F+NA L+N+  S  YK C KL E+F+   + +MK LG+CCG KY F PQ L C         C I +  +Y  ++  +   I     CF +     + +  DP+    L    +FV LKND L  E FV C  C RK H IC LH        + C  C +K    +KE  ++A R+  T L E IE+RVN  L       +++ +RV++    Q +IKP +   Y+        FPY+ KA++AF++IDG DV FF ++ QEY   C  PN RRVY+SYLDSVH+FQPR+L+T VYH ILI YL++  Q  +  AH+W+CPP  GDDY+FH HP +QK+PK  RL+ WYK+MLDKA++  V IEY +I +   ++ + +P ++PYFDGDFWPNA+ + +                          + G+SK S   + K   K K  S K             D+  ++    ++  E F V+ LN  +  D S P       + +    L++ RD+ L   R+ + EFS+ RRA+F+T+ +L EL  + N +  + C++CK+  +  RY C EC D+DLC  CYD+ GHEH M R+   L                        ++++  +  L     C++  C   SC +MK+++ H + C   +   C++C  L  L   H  +C   +C +  C+
Sbjct:  673 ALMPTLEKLYKQEPESLPFRSPVDPKLLGCLDYFEIVRNPMDLSTIKRKLDNGQYKNPWEYCDDVWLMFDNAWLYNRKTSRVYKYCTKLSEVFESEIDPVMKLLGYCCGRKYVFHPQVLCCF----GKQLCTITRDTAYYTYQ--NRQEIVTFPKCFNEIQGDMVNLGEDPTLQQSLIPKDQFVKLKNDHLDVEPFVECIDCGRKVHQICVLHHDLIWPTGYQCDACLNKRGVKKKENKYTARRLQHTRLGEKIETRVNTFLQK-QGCPAEVTIRVVSSVQKQAEIKPGMKTRYEGSGQLPEYFPYQAKALFAFEEIDGTDVCFFGMHVQEYGSDCQQPNTRRVYVSYLDSVHFFQPRQLRTAVYHEILIGYLEHVGQIGFQMAHIWACPPSEGDDYIFHCHPPEQKIPKHKRLVDWYKKMLDKAIMDKVVIEYKDILKQASDDGLTNPKELPYFDGDFWPNALEDSIRELDQEEEERKANAAAAEASGKEGSKVKGNSKRS---NSKKGTKSKAGSRKLSKKINGPSMELCDLSQRLYSTMEKHREVFFVIRLNGRKTPDTSDP-------DPMMTCDLMDGRDAFLTLARDKHYEFSSNRRAQFSTMAMLVELHNQGNDRFVYTCNLCKRP-VETRYHCNECEDYDLCVPCYDEKGHEHKMERLGFDLDVEQQSQPSKDGQPQKMNAQEERRLKIQRCIQSLVHATHCRDINCTMLSCAKMKRVVEHTKSCRKKTSGGCRICQELIHLCCYHAKHCMERECVVPFCR 1423          
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Match: EDO31845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWS2])

HSP 1 Score: 58.151 bits (139), Expect = 1.157e-8
Identity = 33/84 (39.29%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  178 LLRNPSSYPFRNEVDS--LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIF 423
            L R+  ++PFR  VD+  L  P+Y TI+K+PM L TIK+KL +  Y    + I DF L+ NN   +NKP  +    C  + ++F
Sbjct:   30 LWRHHHAWPFREPVDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFRLMINNCYTYNKPGDDIVLMCQSMDKLF 113          

HSP 2 Score: 49.6766 bits (117), Expect = 4.998e-6
Identity = 26/79 (32.91%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  196 SYPFRNEVDS--LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFK 426
            ++PF   VD+  L   +Y  I+KQPM +  IK KL +++Y  P +   D  L+F+N   +N P+ +  K   +L ++F+
Sbjct:  306 AWPFYKPVDAEALGLHDYHDIIKQPMDMTEIKNKLENRAYDSPSEFAADIRLMFSNCYRYNPPDHDVVKMARQLQDVFE 384          
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Match: EDO44902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUH0])

HSP 1 Score: 52.7582 bits (125), Expect = 5.466e-8
Identity = 28/94 (29.79%), Postives = 50/94 (53.19%), Query Frame = 1
Query:  136 SKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVE 417
            + R  DS   +   L  +  ++PF   V  L  P Y  ++K+PM L+T+++K+ SK Y      ++D   IF+N   FN  ++  Y+ C +++E
Sbjct:   49 TNRDHDSLKRMLRSLQSHKMAWPFLEPVSGLDVPGYYDVIKEPMDLSTVEDKITSKKYATLEQFVSDVTRIFDNCRFFNGKDTPYYR-CAEVLE 141          
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Match: EDO45971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR96])

HSP 1 Score: 55.0694 bits (131), Expect = 1.223e-7
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  196 SYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFK-----DNANILMKTLGF 462
            +YP    V+  + P Y  ++  PM  +TIK K+ S SYT      +DF+L+ NNAM++N P++  +K   ++++I       D    + +++GF
Sbjct:  182 AYP----VNDAIAPGYSRVITHPMDFSTIKTKIDSNSYTTIEAFRDDFYLMCNNAMVYNAPDTIYFKAAKRIMQIGAKMMTNDRIKNMYRSIGF 271          
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Match: EDO38859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBV1])

HSP 1 Score: 55.0694 bits (131), Expect = 1.467e-7
Identity = 28/103 (27.18%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  133 SSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFN-KPNSNAYKECVKLVEIFKDNAN 438
            +S R++ +F      L+    + PF   V+    P+Y   V+QPM  +T+  K +   Y++P  +++D  L+F+N+  +N +P S  Y   ++L  +F+D  +
Sbjct: 1293 TSARILLNF------LMSREDAEPFLAPVNLADFPDYTDYVEQPMDFSTVWRKFVENQYSDPEQLVSDIRLVFSNSRAYNTQPRSRIYSMTIRLAAMFEDRVD 1389          
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 483.026 bits (1242), Expect = 2.566e-146
Identity = 281/787 (35.71%), Postives = 416/787 (52.86%), Query Frame = 1
Query:  103 NISEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSD------SDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSM-------------TGDSKSS----------------------LPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECRE-----NSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + S+ +K I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  + D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I +  +Y  ++ S       +D    CE CF +     +     P+ P  + S  +F   KND L  E FV C  C RK H IC LH      + F C  C  K+   +KE  FSA R+ TT L  +IE RVN  L   ++    ++ VRV+A +   V +KP +   + +    + +FPYR KA++AF++IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+F+PR L+T VYH ILI YL+Y ++  Y+  H+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +               T  S+++                        +SR    K  + +V +D+  K+    ++  E F V+ L+    I++  PI++ D    L    L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q D F   C+ CK  ++  R+ CT C D+DLC  CY   GHEH M +  + L                E R  ++   +  ++   +CR      +SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1018 STSQNHKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVEDVWLMFNNAWLYNRKTSRVYKYCTKLAEVFEVEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTISRDGTYYSYQNSSPKYGLIADRYHFCEKCFNEIQGNSVTLGDDPAQPQTVISKEQFEKKKNDTLDPEPFVECKDCERKMHQICVLHYEVIWPSGFICDNCLKKSGKTKKENKFSARRLQTTRLGTYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKSVDVKPGMKSRFVDSGEMMENFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPFPNTRRVYISYLDSVHFFKPRLLRTAVYHEILIGYLEYVKKLGYVMGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTASSETTEGAQADSKNAKKKNNKKTNKNKSSLSRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIMDPDP---LLTCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQ-DRFVYTCNECKH-HVETRWHCTVCEDYDLCINCYKTKGHEHQMVKWGLGLDDDSNGQGGEASKSPQENRRLSIQRCIQSLVHACQCRNANCSLSSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1795          
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Match: ep300b (histone acetyltransferase p300 [Source:NCBI gene;Acc:101168870])

HSP 1 Score: 481.485 bits (1238), Expect = 9.879e-146
Identity = 278/782 (35.55%), Postives = 414/782 (52.94%), Query Frame = 1
Query:  106 ISEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSN-SVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSM-------------TGDSKSSLP----------------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIIN----IDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             ++  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  I D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG K+ F PQTL C+        C I +  +Y  ++    +    CE CF +   + +     PS P    +  +F   KND L  E  V C  C RK H IC LH  T   + F C  C  +A   +KE  ++A+R+P T L  F+E+RVN  L   ++    ++ +RV+  +   V++KP +   + +      SFPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+F+PR L+T VYH IL+ YL+Y ++Q +   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +               +  S+S+ P                      +SR    K  + SV +D+  K+    ++  E F V+ L     I+ P  N    I   + L    L++ RD+ L   R+ +LEFS+LRR+K++++ +L EL   +Q D F   C+ CK+ ++  R+ CT C D+DLC  CY+  GHEH M ++ + L                + R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1096 TAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRKFEFSPQTLCCY----GKQLCTIQRDAAYFSYQ----NRYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELLVECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRMKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEYVKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSSESTDPSKGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRL-----IAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQ-DRFVYTCNECKR-HVETRFHCTVCEDYDLCITCYNIKGHEHKMDKLGLGLDDDGNNQAAAAAQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1862          
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Match: ep300b (histone acetyltransferase p300 [Source:NCBI gene;Acc:101168870])

HSP 1 Score: 480.715 bits (1236), Expect = 1.820e-145
Identity = 281/788 (35.66%), Postives = 415/788 (52.66%), Query Frame = 1
Query:  106 ISEENKYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSD------SDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSN-SVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMT-----------------------GD------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIIN----IDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQ--ECRENSCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
             ++  K I+  + L  + +P  E L R +P S PFR  VD  L   P+Y  IVK PM L+TIK KL +  Y EPW  I D WL+FNNA L+N+  S  YK C KL E+F+   + +M+ LG+CCG K+ F PQTL C+        C I +  +Y  ++ S       +D    CE CF +   + +     PS P    +  +F   KND L  E  V C  C RK H IC LH  T   + F C  C  +A   +KE  ++A+R+P T L  F+E+RVN  L   ++    ++ +RV+  +   V++KP +   + +      SFPYR KA++AF+ IDG DV FF ++ QEY   CP PN RRVYISYLDSVH+F+PR L+T VYH IL+ YL+Y ++Q +   H+W+CPP  GDDY+FH HP DQK+PK  RL +WYK+MLDKAV   +  +Y +I +   E+++    ++PYF+GDFWPN + E +                          GD            SK+   +SR    K  + SV +D+  K+    ++  E F V+ L     I+ P  N    I   + L    L++ RD+ L   R+ +LEFS+LRR+K++++ +L EL   +Q D F   C+ CK+ ++  R+ CT C D+DLC  CY+  GHEH M ++ + L +                  + ++  +  L    +C+   C   SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct: 1028 TAQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYIEDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFETEIDPVMQGLGYCCGRKFEFSPQTLCCY----GKQLCTIQRDAAYFSYQNSSPKYGLLADRYHFCEKCFNEIQGESVSLGDDPSQPQTSINKDQFQRKKNDTLDPELLVECIDCGRKMHQICVLHNETIWPSGFVCDNCLKRANKSRKENKYAAKRLPQTKLGNFLETRVNDYLKRQNHLESGEVTIRVVHVSDKVVEVKPGMKSRFVDSGEMSESFPYRMKALFAFEDIDGADVCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFKPRHLRTAVYHEILLGYLEYVKRQGFTAGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENSTSSESTDVSRGDSKNAKKKNNKKTSKNKSSLSRANKKKPGMPSVSNDLSQKLYATMEKHKEVFFVIRL-----IAGPTANSLPPITDPDPLMACDLMDGRDAFLTLARDKHLEFSSLRRSKWSSMCMLVELHNQSQ-DRFVYTCNECKR-HVETRFHCTVCEDYDLCITCYNIKGHEHKMDKLGLGLDDDGNNQAAAAAQNPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFC 1804          
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Match: crebbpa (CREB-binding protein [Source:NCBI gene;Acc:101163392])

HSP 1 Score: 479.559 bits (1233), Expect = 2.818e-145
Identity = 274/775 (35.35%), Postives = 410/775 (52.90%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------SMTGDSKSSLP------------------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I  G +Y  ++    +    CE CF       +     P+ P  + S  +F   KND+L  E FV C  C RK H IC LH      + F C+ C  K+   +KE  F+A+R+ +T L   IE RVN  L   ++    ++ VRV+A +   V++KP +   + +      +FPYR KA++AF++IDG DV FF ++ QEY   C  PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                + S +P                        +SR    K  + +V +D+  K+    ++  E F V+ L+    +++  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q D F   C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  924 RKIFKPEELRQTLMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPTGGTYYSYQ----NRYHFCEKCFNDIQGDSVTLGDDPAQPQTMISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICENCLKKSGKTKKENKFTAKRLQSTRLGMHIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMPETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECSFPNNRRVYISYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTAASEMPEGTPSDSKNAKKKNNKKTNKNKSSISRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPD---PLISCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQ-DRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDNNGQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1685          
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Match: crebbpa (CREB-binding protein [Source:NCBI gene;Acc:101163392])

HSP 1 Score: 479.174 bits (1232), Expect = 3.404e-145
Identity = 274/775 (35.35%), Postives = 410/775 (52.90%), Query Frame = 1
Query:  121 KYIWSSKRLIDSFIPLCEELLR-NPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFII----PSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNS-VSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-----------SMTGDSKSSLP------------------------VSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISS--PIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSF--DCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSL---------------SEIRLRNMLTLLYEIIRCQECREN-----SCVRMKQLIIHAQRCSL-SYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            + I+  + L  + +P  E L R +P S PFR  VD +L   P+Y  IVK P+ L+TIK KL +  Y EPW  ++D WL+FNNA L+N+  S  YK C KL E+F+   + +M++LG+CCG KY F PQTL C+        C I  G +Y  ++    +    CE CF       +     P+ P  + S  +F   KND+L  E FV C  C RK H IC LH      + F C+ C  K+   +KE  F+A+R+ +T L   IE RVN  L   ++    ++ VRV+A +   V++KP +   + +      +FPYR KA++AF++IDG DV FF ++ QEY   C  PN RRVYISYLDS+H+F+PR L+T VYH ILI YL+Y ++  Y   H+W+CPP  GDDY+FH HP DQK+PK  RL +WY++MLDKA    +  +Y +I +   E+++    ++PYF+GDFWPN + E +                + S +P                        +SR    K  + +V +D+  K+    ++  E F V+ L+    +++  PI++ D    L +  L++ RD+ L   R+ + EFS+LRR K++T+ +L EL    Q D F   C+ CK  ++  R+ CT C DFDLC  CY+  GHEH M +  + L                E R  ++   +  ++   +CR       SC +MK+++ H + C   +   C +C  L  L   H  +C+  KC +  C
Sbjct:  945 RKIFKPEELRQTLMPTLESLYRQDPESLPFRQPVDPMLLGIPDYFDIVKNPIDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQSLGYCCGRKYEFSPQTLCCY----GKQLCTIPTGGTYYSYQ----NRYHFCEKCFNDIQGDSVTLGDDPAQPQTMISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICENCLKKSGKTKKENKFTAKRLQSTRLGMHIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDTGEMPETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECSFPNNRRVYISYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYAQGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEERKKEENTAASEMPEGTPSDSKNAKKKNNKKTNKNKSSISRANKKKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMVNTLPPIVDPD---PLISCDLMDGRDAFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQ-DRFVYTCNECKH-HVETRWHCTVCEDFDLCINCYNTKGHEHQMVKWGLGLDDDNNGQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFC 1706          
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Match: SMESG000002563.1 (SMESG000002563.1)

HSP 1 Score: 1880.92 bits (4871), Expect = 0.000e+0
Identity = 937/939 (99.79%), Postives = 938/939 (99.89%), Query Frame = 1
Query:   64 MQKKTYIWPHEVNNISEENKYIWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTTDNRFFCQLCSDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSEIRLRNMLTLLYEIIRCQECRENSCVRMKQLIIHAQRCSLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQXXXXXXXXXQTKILLKRRYNEILRYQATKQSSLGIEESNKPISESTKITGEQFLDAIKRFKELYSDKDECKRQFQIFLDSNPGYELARSEYVQQKNRPGGGYTQLGGKSSNRGDTAAGLLSSNQIDGNRKLEIIEKKPMKSDYFIRSPKNYRNNSEETQNAGSKPLPKNHVKPVESLRIFSSKPQXXXXXXXXXXXXXXXXXAPVRKKKRVEISNQN 2880
            MQKKTYIWPHEVNNISEENKYIWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFK+NANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTTDNRFFCQLCSDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSK SLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSEIRLRNMLTLLYEIIRCQECRENSCVRMKQLIIHAQRCSLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQEKREKEKRRQTKILLKRRYNEILRYQATKQSSLGIEESNKPISESTKITGEQFLDAIKRFKELYSDKDECKRQFQIFLDSNPGYELARSEYVQQKNRPGGGYTQLGGKSSNRGDTAAGLLSSNQIDGNRKLEIIEKKPMKSDYFIRSPKNYRNNSEETQNAGSKPLPKNHVKPVESLRIFSSKPQISSMKIERIEEEIKIQEAPVRKKKRVEISNQN
Sbjct:    1 MQKKTYIWPHEVNNISEENKYIWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKENANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTTDNRFFCQLCSDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKPSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSEIRLRNMLTLLYEIIRCQECRENSCVRMKQLIIHAQRCSLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLCQEKREKEKRRQTKILLKRRYNEILRYQATKQSSLGIEESNKPISESTKITGEQFLDAIKRFKELYSDKDECKRQFQIFLDSNPGYELARSEYVQQKNRPGGGYTQLGGKSSNRGDTAAGLLSSNQIDGNRKLEIIEKKPMKSDYFIRSPKNYRNNSEETQNAGSKPLPKNHVKPVESLRIFSSKPQISSMKIERIEEEIKIQEAPVRKKKRVEISNQN 939          
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Match: SMESG000018938.1 (SMESG000018938.1)

HSP 1 Score: 507.294 bits (1305), Expect = 1.671e-157
Identity = 278/777 (35.78%), Postives = 426/777 (54.83%), Query Frame = 1
Query:  130 WSSKRLIDSFIPLCEELLRNPSSYPFRNEVD--SLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLAC---HLCDPNNPQCAIYKGQSYKYFKPSDSDGIQ-----ICEDCFGKCSEKFIIPSDP---SKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQK--EFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRN--IHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML---------------SMTGD---------------------------SKSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKD-SFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE--------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYED-CQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            W++  L  +F+P+  E+    ++  FR +VD  +L  P+Y  ++K PM + +I+ KL +  Y +PWD+++DFWL+F NA L+NK  S  YK C KL E+F+   N LMK LG+CCG+ Y+++PQ L C   H C    P+ AIY    ++Y     S  +      ICE C+ +      +  DP   S++     F  L+N++ V+E FV+C  C+RKWH +CAL++     + + C  C  K    +K  +F+A ++PT+ LS ++E RVN  L     + +++++R+LA +   V++KP +   Y   N    SFPYR KAIYAFQ+IDG +V FF LY QEY   CP PN RRVYI+YLDSV+YFQPR+ +T+VYH IL+ YL + ++  +  AH+WSCPPG GDDY+FH HP DQK+PK+ RLI+WY  ML KA++  +  +Y +I +  IEN ++ P +IPYFDGDFWPN + ++L               S+ GD                              ++P  RK  +    D   +        M K  +  F++ ++  QE    P    D +  + N+ L+E RD+ L  CRE NLEFS+LRR K++T+ +L E+  + + +  ++C  C +  +  RY C EC ++D+C  C +   H H +  +   L E              + + N +  L    +C++  CR N+C+RMK+++ H + C+   +  C+ C  L  L   H   CK +KC I  C
Sbjct:  471 WTTDELKTNFLPMWNEIYNEKNAEWFREKVDYVALQIPDYPLVIKHPMDMTSIRMKLEAGKYKDPWDVVDDFWLMFKNAWLYNKKTSRVYKACSKLAEVFESKINNLMKKLGYCCGMHYSYEPQVLFCNSVHACTI--PKDAIY----FEYENSGKSQILAGEKYLICEKCYNEADLTIKLNDDPQQDSEIVDKDMFRQLRNNVKVEEKFVNCILCMRKWHCVCALYMEEIWSSGYLCPSCLQKTNQRRKPNKFTARKLPTSCLSNYLERRVNDFLKKKEANANEVVIRILASSDKTVEVKPLMRGRYAETNEMSESFPYRLKAIYAFQEIDGVEVCFFGLYVQEYGSDCPQPNTRRVYIAYLDSVYYFQPRQYRTDVYHEILLGYLMFAKKNHFSMAHIWSCPPGEGDDYIFHMHPPDQKIPKEKRLIEWYVNMLRKALIELIVADYKDILKDSIENNLLSPAEIPYFDGDFWPNTLEDILKEYEEEVEKRRMEENSIGGDDEITTDYTTVDYDKRGKKKAKKRKEKRGNCTIPNKRKKMVNGGFDGGTELCRKVYDVMEKVKHLLFVIRLIPSQEAHLLPDTK-DPDGAVINSDLMESRDAFLQLCREKNLEFSSLRRGKYSTMVMLYEIHNERRHNFMYNCSECGEQ-METRYHCNECEEYDICVKCKETKQHPHKLHMIGFCLDEDEKDNEQEAVKSKRVGIDNCIKALLHACQCRDANCRINNCLRMKRIVQHTKTCNKKAQGTCETCKQLIALCFYHAKICKESKCHIPFC 1239          
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Match: SMESG000066809.1 (SMESG000066809.1)

HSP 1 Score: 473.011 bits (1216), Expect = 1.194e-145
Identity = 277/784 (35.33%), Postives = 428/784 (54.59%), Query Frame = 1
Query:  130 WSSKRLIDSFIPLCEELLRNPSSYPFRNEVD-SLLK-PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQI-----------CEDCFGKCSE--KFIIPSDPSKL--YSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE--FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHY--KNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML-------------------SMTGDSKSSLPVSRKP-------------------PIKRKLDSVKD---DIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDS--FDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV------------------FVSLSEIRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRCSLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            WSS+ L D F  + + +L +  S PF+  V+  LL  P+Y +IVK PM L+TIK+KL++  Y  PWD+++DFWL+FNNA L+NK  S  YK C  L ++F+   + +M + GFCCG ++ + PQ L C  C PN   C I +   Y  F+   S+G +I           CE C+    E  +FI   +         S     +N++  +E FV C  C RKWH +CA HI     + F+C  C  +     K   + ++ +P  +LS +IE+RVN  L D   ++++++VRVL+ +   V++KP +  HY        SF YR KA++AFQ+IDG +V FF L+ QEY   CP PN+RRVY++YLDSVH+F PR+ +T+VYH  L+ YL+Y ++  +  AH+W+CPPG GDDY+FH HP +QK+PK  RL +WY +MLDKA+  +V I+Y +I    + + ++ P ++PYF+GD+WPNA+ ++                    S  G++  +  +S+                       KRK  +  D   D+  K+L++ ++  E F V+ L+ Q D ++ +  I+  + L ++ L++ RD +L   RE +LEFS+LRRAKF+TL    EL  + QK+S  + C+ C K  +  RY+C +C DF+LCP CY    H H + +V                      +  R+      L    +C++  CR N C +MK +I H Q CS+    C+MC +   +   H  +C  +KC++  C
Sbjct:  359 WSSEELSDLFTEIHQLILSDKDSEPFKLPVNWELLDIPDYPSIVKCPMDLSTIKDKLVNGLYNNPWDVVDDFWLMFNNAWLYNKKTSKVYKMCSTLAKLFESKIDDIMVSCGFCCGREFVYLPQVLIC--CTPN--VCLIVRDAVYYAFQNDKSNGEKIISELTCDRYICCEKCYNDSCEDVQFINAENNGAACKVQKSLLSKCRNNVKENEEFVFCRICNRKWHKVCANHIDDIWRDGFYCATCIREKSIKIKPNVYKSKGLPHCELSRYIENRVNKYLKDRDPTINEVIVRVLSSSDKVVEVKPGMKSHYCETCEMPESFKYRLKAVFAFQEIDGQEVCFFGLHVQEYGSDCPDPNSRRVYLAYLDSVHFFSPRKYRTDVYHEFLVGYLEYAKKLGFTMAHIWACPPGEGDDYIFHMHPPEQKLPKPKRLQEWYIKMLDKAIKENVVIDYRDIFSDALNSSMLSPTELPYFEGDYWPNALEDIFKEIDEETNRRLKSYSETPNSQEGETSQTEVISKNNLSKMDKKPKKRKLKRMNSLNNKRKRINGSDTINDVSRKVLELMEKRKENFFVIRLHSQSDAAN-LPPINDPDALFHSDLMDGRDKLLCLAREKHLEFSSLRRAKFSTLCFCYELHME-QKNSVLYACNACNKQ-IEVRYTCKQCEDFELCPSCYTTETHPHSLFKVDPDEESNILNSQNLSQPTSEDTTRARMVRYSKSLQHACQCRDVNCRINLCAKMKGMIKHFQCCSIPKSTCKMCQLFLRICFVHAKFCSDSKCQVPNC 1135          
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Match: SMESG000060474.1 (SMESG000060474.1)

HSP 1 Score: 410.223 bits (1053), Expect = 3.594e-124
Identity = 262/830 (31.57%), Postives = 417/830 (50.24%), Query Frame = 1
Query:  115 ENKYIWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDSLLK--PEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSD-------------SDGIQICEDCFGKCSE---KFIIPSDPSKLYST--SEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTT-DNRFFCQLCSDKAQAPQKE---FSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEI--IDHYKNRNIHSFPYRNKAIYAFQKI-DGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML---SMTGDSKSSLPVSRKPP---------------IKRKLDSV-------------------KDDIHSKMLQMSKRFNEEFLVVVLNRQEDIS---SPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQKDS-FDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRV------------FVSLSEIRLRNMLTL----------------------------LYEII-RCQE--CRENSCVRMKQLIIHAQRCSLSYE-DCQMCYILTFLMVNHVHYCKSTKCRISLCQXXXXXXXXXQTKI 2268
            +++ +W ++ L   F PL  ++     +  F   VD   +  P+Y  I+  PM L+TIK KL    Y +PW +I D+WLIFNNA  +NK +S  YK C  L  IF+  A+  M+++G CCG  + + PQ L C  C P    C + +   Y      +             SD    C+ CF   ++   + ++    + L +   S F  +KN++   E F+ C  CL+KWH +CA H+     + F+C  C    + P+++    SAE +P  +LS  IE+RV+      S S++K+ +RVL+ +    +IK E+  I         S PY++KAI+AFQ++ DG ++  F ++TQEY   CP PN RRVY++YLDSV++FQP  L+T+ YH +LI+YL+YC+Q  ++ AH+W+CPPG GDDY+FH HP  QK+PK  RL  WY  MLDKA+L  + +EY +I  +   +Q++   ++PYF+GD+WPN + ++L   S    +   L    + P                KRKL  +                    +DI  ++    +R  E F VV L+ Q D S   + II+ D +    N+ L++ RD  L   R+ +LEFS++RRAKF TL +  EL  + +    + C+ C     S RY+C  C +F+LC  C  + GH H + R               S +E R +++  +                            +YE   +C++  C+  +C R +++  H   C+   E  C+ C  +  ++  H   C++  CR+ +C  KR +    QT++
Sbjct:  296 QSEKVWVARELEYLFEPLHSKICHEKDATIFLAPVDWEAEDIPDYPKIISHPMDLSTIKRKLADGDYQDPWHVIADYWLIFNNAWTYNKKSSRVYKMCSNLARIFELEADKTMQSIGLCCGRDFVYLPQILTC--CTPQ--MCMVGRDALYHVLNNEEDESNGDKLVPELASDKFLCCDKCFNDATDDSIQLMLNDSTTALVAVKKSLFTKMKNNVKEREEFIKCKICLKKWHKVCAEHMDEIWGSGFYCPDCESNRRFPKQKNVLISAE-LPQCNLSRHIEARVDAWRQKESQSIAKVNIRVLSISTKSAEIKSEMKRIFVENGEMPESLPYKSKAIFAFQELSDGSEICLFGMHTQEYGSDCPSPNTRRVYLAYLDSVNFFQPSNLRTDFYHRLLISYLEYCQQLGFIFAHIWACPPGEGDDYIFHMHPPSQKLPKPKRLQDWYIAMLDKAILEGIVVEYSDIFAYSYNSQLMSLSEMPYFEGDYWPNVLEDLLKEDSALSAADLMLEEELRAPDSMIEQQNGFSNSYSKKRKLKKMSINSNSKRRRQSDLSDGNNNNDIMKRLFDNLERRKENFFVVRLHSQSDASKLPAVIIDSDCDGIKFNSDLMDGRDKFLALSRDKHLEFSSIRRAKFATLSLCYELHLELRHGVIYSCNSCDLMLDSIRYTCQVCEEFELCDRCVRELGHPHKLHRTPSCQDDPSESVDSSSGNEDRHQSIAAIGNPVTVPAFAPPQDEGAIKRQKTIVFIKMYEHADKCRDASCKIANCARFRRIPDHTIDCAKKNERSCKFCKQIFNIIREHQRDCRNIDCRLEVCIRKRSRINSNQTRL 1120          
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Match: SMESG000031693.1 (SMESG000031693.1)

HSP 1 Score: 375.17 bits (962), Expect = 5.563e-111
Identity = 227/778 (29.18%), Postives = 393/778 (50.51%), Query Frame = 1
Query:  127 IWSSKRLIDSFIPLCEELLRNPSSYPFRNEVDS-------LLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAMLFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHLCDPNNPQCAIYKGQSYKYFKPSDSDGIQ--------ICEDCFGKCSEK--FIIPSDPSKLYSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTTDNRFFCQLCSDKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADTCSQVKIKPEIIDHYKNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEYDESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYLTAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAIEYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEML--------------------------SMTGDS-------------KSSLPVSRKPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDRNNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRD-NQKDSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE------------------IRLRNMLTLLYEIIRCQE--CRENSCVRMKQLIIHAQRC-SLSYEDCQMCYILTFLMVNHVHYCKSTKCRISLC 2226
            +W  + LI+ F    + +  N ++  F ++VD+       LL+   K      +SL  I +KL   +Y +PW +++D  ++  N   + K    + K+ V+ +   +   + +M  +GFCCG    + P TL C  C  N   C I K   Y  ++  + D +          CE C+   + K  FI  S+          V  +N++ + E FV C  C RKWH +CA HI    + F+C+ C+   Q  + +++A+R+  + LS F+E RVN  L     +   +++RVL+      ++K  +  ++ + +  SFPYR+KAI+AFQ+  G +V FF L+ QEY   CP PN RRVY++YLDSV YF+P + +T+VY+ IL+ YLDY ++  Y+ AH+W+CPP  GDDY+FH HP DQ++PK  RL +WY +MLDK +   V  +Y ++++    ++I    +IPYF+GDFWPNA  ++L                           ++ D+              +++  S++  I    D+V +++  K+L++ ++  + F ++ L+ Q+++ + +  I+  + +  + L++ R++ L   R  +LEFSNLRR+ ++TL +  EL  +  Q   + C+ C  + +  RY C +C ++DLC  CY    H HP+ ++   + +                   R+  ++        C++  CR N C   K+ + H++ C   + + C  C  +  L   H  +C   KC I  C
Sbjct:  334 LWGKEELINEFKVFFDFVKNNKNAQLFLSQVDAKNYNNVELLRANSKH-----LSLLIISQKLDDGTYNDPWCVVDDLNILIKNVCNYTKKKGKSKKDFVQSMNDIQIQIDEIMTKMGFCCGRVEVYQPLTLLC--CTAN--VCTINKDSVYYAYQNENDDKVPGMLVDSYLCCEKCYSDSASKVSFIAESNEMVTIRKDLLVKKRNNVEIHEEFVYCHDCKRKWHKVCACHIDEIWSSFYCKNCALNGQKRENKYTAKRLLPSVLSNFLEKRVNDYLKKNEITTDNVIIRVLSSVKKVTEVKSGMKTYFGDADT-SFPYRSKAIFAFQENQGREVCFFGLHVQEYGSDCPEPNRRRVYVAYLDSVKYFEPSKHRTKVYYEILVGYLDYVKKLGYVMAHIWACPPSEGDDYIFHIHPPDQRIPKPKRLQEWYTKMLDKGIQELVIDDYKDVYKDAYLSEIKSVSEIPYFEGDFWPNAFEDILKEFEENNRKAKESVQDEDDNDSVVNYEISKDNIGNKKPKKRKQKKTTNIATSKRKKIHDPADTV-NELFKKVLEIMEKHKDNFFIIRLHPQKNVCN-LKEINDPDPIVESELMDGRENFLQMARAKHLEFSNLRRSLYSTLVMCYELHNEIKQSFCYTCNAC-NAQIETRYHCNQCEEYDLCTKCYTTEKHIHPLEKIRSGVEDENDNLNFKSEENCEETNRRRIDRLVKYFEHAATCRDACCRLNPCSVFKKALSHSKNCKERNAQSCDKCKGIFKLSAYHAKFCTDIKCTIIFC 1098          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase p300 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CREBBP8.734e-14736.46CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
CREBBP1.085e-14636.46CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
EP3009.962e-14536.25E1A binding protein p300 [Source:HGNC Symbol;Acc:H... [more]
EP3001.191e-14436.25E1A binding protein p300 [Source:HGNC Symbol;Acc:H... [more]
CREBBP4.273e-12543.85CREB binding protein [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbp-16.484e-12832.22pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-16.484e-12832.22pep chromosome:WBcel235:III:9766516:9774825:1 gene... [more]
cbp-19.278e-12832.22pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
cbp-19.954e-12832.22pep chromosome:WBcel235:III:9766516:9774807:1 gene... [more]
athp-21.843e-935.23AT Hook plus PHD finger transcription factor [Sou... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nej1.794e-14434.60gene:FBgn0261617 transcript:FBtr0071402[more]
nej1.794e-14434.60gene:FBgn0261617 transcript:FBtr0302723[more]
nej1.796e-14434.60gene:FBgn0261617 transcript:FBtr0302722[more]
nej3.649e-14434.39gene:FBgn0261617 transcript:FBtr0333521[more]
tbrd-11.916e-942.86gene:FBgn0039124 transcript:FBtr0084525[more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ep300a7.832e-15137.48E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
CR354584.45.190e-15036.98E1A binding protein p300 a [Source:NCBI gene;Acc:5... [more]
ep300a5.369e-15037.18E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
AL953841.43.711e-14936.49CREB binding protein a [Source:NCBI gene;Acc:56684... [more]
crebbpa4.863e-14936.40CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
supv3l18.958e-14836.57Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l11.012e-14736.09Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l11.355e-14636.06Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l13.651e-14636.11Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
supv3l17.403e-14636.20Suv3 like RNA helicase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crebbp4.778e-14736.59CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Crebbp6.713e-14736.59CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Ep3001.633e-14336.25E1A binding protein p300 [Source:MGI Symbol;Acc:MG... [more]
Crebbp1.120e-12443.85CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
Crebbp5.251e-3940.36CREB binding protein [Source:MGI Symbol;Acc:MGI:10... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6JHU9|CBP_RAT5.212e-14636.59Histone lysine acetyltransferase CREBBP OS=Rattus ... [more]
sp|Q92793|CBP_HUMAN5.212e-14636.46CREB-binding protein OS=Homo sapiens OX=9606 GN=CR... [more]
sp|Q09472|EP300_HUMAN4.784e-14436.25Histone acetyltransferase p300 OS=Homo sapiens OX=... [more]
sp|B2RWS6|EP300_MOUSE1.142e-14236.25Histone acetyltransferase p300 OS=Mus musculus OX=... [more]
sp|P45481|CBP_MOUSE3.242e-13835.82Histone lysine acetyltransferase CREBBP OS=Mus mus... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B6LB899.876e-15835.62Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A1B6GA308.124e-15735.75Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A1B6KPK27.692e-15635.17Uncharacterized protein (Fragment) OS=Graphocephal... [more]
A0A1B6IV491.141e-15535.75Uncharacterized protein (Fragment) OS=Homalodisca ... [more]
A0A1B6EV374.883e-15535.29Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crebbpa5.498e-14635.79CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
crebbpa6.589e-14635.79CREB binding protein a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ep300b8.610e-14535.64E1A binding protein p300 [Source:NCBI gene;Acc:103... [more]
ep300a3.530e-14236.46histone acetyltransferase p300-like [Source:NCBI g... [more]
brwd34.431e-933.00bromodomain and WD repeat domain containing 3 [Sou... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ep300a2.670e-9933.73E1A binding protein p300 a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000006336.19.577e-3146.62pep scaffold:Pmarinus_7.0:GL479543:3524:30791:1 ge... [more]
ENSPMAT00000006283.12.362e-1131.03pep scaffold:Pmarinus_7.0:GL487345:511:5582:1 gene... [more]
ENSPMAT00000010200.11.956e-730.26pep scaffold:Pmarinus_7.0:GL476882:35727:95577:1 g... [more]
ENSPMAT00000008098.12.046e-740.28pep scaffold:Pmarinus_7.0:GL481104:2991:16154:-1 g... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RSC41.894e-839.47Component of the RSC chromatin remodeling complex;... [more]
GCN56.470e-833.72Catalytic subunit of ADA and SAGA histone acetyltr... [more]
RSC12.767e-642.19Component of the RSC chromatin remodeling complex;... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407537.805e-14235.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318451.157e-839.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449025.466e-829.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459711.223e-730.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388591.467e-727.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crebbpb2.566e-14635.71adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
ep300b9.879e-14635.55histone acetyltransferase p300 [Source:NCBI gene;A... [more]
ep300b1.820e-14535.66histone acetyltransferase p300 [Source:NCBI gene;A... [more]
crebbpa2.818e-14535.35CREB-binding protein [Source:NCBI gene;Acc:1011633... [more]
crebbpa3.404e-14535.35CREB-binding protein [Source:NCBI gene;Acc:1011633... [more]
back to top
BLAST of Histone acetyltransferase p300 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002563.10.000e+099.79SMESG000002563.1[more]
SMESG000018938.11.671e-15735.78SMESG000018938.1[more]
SMESG000066809.11.194e-14535.33SMESG000066809.1[more]
SMESG000060474.13.594e-12431.57SMESG000060474.1[more]
SMESG000031693.15.563e-11129.18SMESG000031693.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005716 ID=SMED30005716|Name=Histone acetyltransferase p300|organism=Schmidtea mediterranea sexual|type=transcript|length=2936bp
ATTATATCTTTATAATTGCATCATTAATTTAAATTTCTATTATTATCTAA
TCATACATTCCAGATGCAAAAGAAAACGTATATATGGCCACATGAAGTTA
ATAACATTAGTGAAGAAAATAAATATATTTGGTCATCGAAACGTTTGATC
GATTCTTTTATTCCTTTATGTGAAGAATTACTGAGAAATCCAAGTAGCTA
TCCTTTTCGAAATGAAGTAGATTCTCTGCTTAAACCTGAATATAAGACCA
TTGTAAAACAACCAATGTCATTAAATACAATTAAAGAAAAACTCTTATCA
AAAAGTTATACAGAACCATGGGACATCATTAATGATTTTTGGTTGATTTT
CAATAACGCTATGTTGTTTAATAAACCAAATTCTAATGCGTATAAAGAAT
GTGTAAAATTAGTCGAAATTTTCAAAGACAATGCAAATATTTTAATGAAA
ACTCTTGGATTTTGTTGTGGAGTTAAATATACATTTGATCCACAAACTTT
GGCGTGCCATTTATGTGATCCCAATAATCCGCAATGTGCAATATATAAAG
GACAAAGTTACAAATATTTTAAACCCAGCGATAGCGATGGAATTCAGATT
TGCGAGGATTGTTTTGGAAAATGCTCAGAGAAATTCATCATTCCGTCTGA
TCCATCTAAACTTTACTCGACATCTGAATTTGTTTCCCTAAAGAATGATA
TTCTCGTCGACGAGACATTTGTTTCATGTTCAAAATGCCTCCGAAAATGG
CACAGTATTTGTGCTCTTCACATTTCCACTACCGATAATCGTTTCTTCTG
TCAGCTCTGTTCCGACAAAGCCCAAGCTCCACAGAAAGAATTCTCCGCCG
AAAGAATTCCAACAACCGATCTCAGTGAATTCATTGAGAGTCGTGTCAAT
ATCATGCTTTCTGATTACAGTAACTCAGTGAGCAAAATCCTAGTCCGAGT
ACTGGCTGACACGTGTTCCCAGGTGAAAATTAAACCCGAGATAATCGATC
ACTACAAAAATCGGAACATACACTCCTTCCCTTACCGGAATAAAGCGATT
TATGCTTTCCAGAAAATCGACGGTTACGATGTGCTGTTCTTTGCCCTCTA
TACCCAGGAATATGACGAGAGTTGCCCGGTACCGAATGCCCGTCGAGTCT
ACATATCATATCTCGATTCCGTTCACTATTTCCAGCCGAGGGAATTGAAA
ACCGAAGTCTACCATTCGATACTGATTAATTACCTCGACTATTGTCGACA
ACAGCAATACCTCACCGCTCATCTCTGGTCTTGTCCTCCGGGTTCCGGTG
ACGATTACGTTTTCCATCAGCATCCGACCGATCAAAAAGTTCCGAAGAAA
ACACGCCTCATAAAATGGTACAAACAAATGCTCGACAAAGCCGTTCTGTC
GGATGTTGCCATTGAATACATGAATATTCACGAGTTCTTCATCGAGAACC
AAATAGTCCACCCGATCGATATTCCATATTTCGATGGAGACTTCTGGCCG
AATGCGATTACCGAAATGCTCTCGATGACTGGCGACAGCAAATCCTCGTT
ACCAGTCAGTCGAAAGCCACCAATCAAACGAAAATTGGATTCAGTGAAGG
ATGATATCCATTCGAAAATGCTGCAGATGTCCAAGAGATTCAATGAGGAA
TTCCTGGTGGTCGTTCTCAATCGACAGGAAGACATTTCCAGTCCGATAAT
CAACATCGACCGCAACAATCAGCTGAGAAATACCGCTCTCGTCGAGGTGA
GAGATTCGATTCTCTATTTCTGTCGGGAATTCAATCTCGAGTTCTCGAAT
TTGCGCCGGGCCAAGTTTACAACCCTCCGAATACTCGATGAGCTGTTCCG
AGACAATCAGAAAGATTCGTTCGACTGTGACGTTTGCAAAAAGTCCAATC
TGTCAGATCGATATTCCTGTACCGAATGTCTCGATTTCGATCTCTGTCCG
GTTTGTTACGACAAATGGGGACATGAGCATCCAATGAGTCGAGTCTTTGT
GAGTTTGAGTGAAATCCGGTTGCGCAACATGCTCACCCTGCTCTATGAGA
TCATCCGGTGCCAGGAGTGCCGCGAGAACAGCTGCGTCCGGATGAAGCAA
TTGATAATCCACGCTCAGCGCTGCTCATTGTCCTATGAGGATTGCCAGAT
GTGTTACATTCTCACGTTCCTAATGGTGAATCACGTGCATTATTGCAAGA
GTACAAAATGCCGGATCTCGTTGTGCCAGGAGAAACGAGAAAAGGAAAAA
CGGCGACAAACGAAAATCCTTTTGAAGCGAAGATACAACGAGATATTGCG
TTACCAGGCAACGAAACAGAGTAGCTTGGGAATCGAAGAGAGCAACAAGC
CGATATCGGAGTCGACGAAAATAACCGGCGAACAATTCCTGGACGCTATC
AAGCGGTTTAAGGAACTCTATTCTGACAAAGACGAATGCAAGAGACAATT
TCAAATATTTCTCGACTCTAATCCAGGTTACGAGTTGGCGAGGAGCGAAT
ATGTTCAACAGAAAAATCGACCCGGCGGAGGATATACACAACTGGGAGGG
AAATCCTCCAATAGGGGCGATACAGCAGCTGGTTTATTATCGTCCAATCA
AATCGATGGAAATAGGAAATTGGAAATTATCGAAAAAAAACCAATGAAAT
CAGATTATTTTATTAGATCACCGAAAAATTACCGGAACAATTCAGAGGAG
ACGCAAAATGCCGGTAGCAAACCGCTACCGAAAAATCACGTGAAACCTGT
GGAATCTTTGAGGATTTTCAGTTCCAAGCCACAAATTAGTTCTATGAAAA
TCGAAAGAATCGAAGAGGAAATCAAAATACAAGAAGCACCGGTGAGAAAA
AAGAAAAGAGTCGAGATATCCAATCAAAATTGATCGTTTTATATTTTTGA
GCTTATTTTTTTAATAAATTTTTTTTTGAAAAAAAA
back to top

protein sequence of SMED30005716-orf-1

>SMED30005716-orf-1 ID=SMED30005716-orf-1|Name=SMED30005716-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=940bp
MQKKTYIWPHEVNNISEENKYIWSSKRLIDSFIPLCEELLRNPSSYPFRN
EVDSLLKPEYKTIVKQPMSLNTIKEKLLSKSYTEPWDIINDFWLIFNNAM
LFNKPNSNAYKECVKLVEIFKDNANILMKTLGFCCGVKYTFDPQTLACHL
CDPNNPQCAIYKGQSYKYFKPSDSDGIQICEDCFGKCSEKFIIPSDPSKL
YSTSEFVSLKNDILVDETFVSCSKCLRKWHSICALHISTTDNRFFCQLCS
DKAQAPQKEFSAERIPTTDLSEFIESRVNIMLSDYSNSVSKILVRVLADT
CSQVKIKPEIIDHYKNRNIHSFPYRNKAIYAFQKIDGYDVLFFALYTQEY
DESCPVPNARRVYISYLDSVHYFQPRELKTEVYHSILINYLDYCRQQQYL
TAHLWSCPPGSGDDYVFHQHPTDQKVPKKTRLIKWYKQMLDKAVLSDVAI
EYMNIHEFFIENQIVHPIDIPYFDGDFWPNAITEMLSMTGDSKSSLPVSR
KPPIKRKLDSVKDDIHSKMLQMSKRFNEEFLVVVLNRQEDISSPIINIDR
NNQLRNTALVEVRDSILYFCREFNLEFSNLRRAKFTTLRILDELFRDNQK
DSFDCDVCKKSNLSDRYSCTECLDFDLCPVCYDKWGHEHPMSRVFVSLSE
IRLRNMLTLLYEIIRCQECRENSCVRMKQLIIHAQRCSLSYEDCQMCYIL
TFLMVNHVHYCKSTKCRISLCQEKREKEKRRQTKILLKRRYNEILRYQAT
KQSSLGIEESNKPISESTKITGEQFLDAIKRFKELYSDKDECKRQFQIFL
DSNPGYELARSEYVQQKNRPGGGYTQLGGKSSNRGDTAAGLLSSNQIDGN
RKLEIIEKKPMKSDYFIRSPKNYRNNSEETQNAGSKPLPKNHVKPVESLR
IFSSKPQISSMKIERIEEEIKIQEAPVRKKKRVEISNQN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
GO:0000123histone acetyltransferase complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR043145Znf_ZZ_sf
IPR036427Bromodomain-like_sf
IPR035898TAZ_dom_sf
IPR013083Znf_RING/FYVE/PHD
IPR001487Bromodomain
IPR013178Histone_AcTrfase_Rtt109/CBP
IPR000433Znf_ZZ
IPR000197Znf_TAZ
IPR010303RING_CBP-p300
IPR018359Bromodomain_CS
IPR031162CBP_P300_HAT
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004402histone acetyltransferase activity
GO:0008270zinc ion binding
GO:0003712transcription cofactor activity
GO:0003713transcription coactivator activity
GO:0016740transferase activity
GO:0016746transferase activity, transferring acyl groups
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0016573histone acetylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001487BromodomainPRINTSPR00503BROMODOMAINcoord: 43..56
score: 31.99
coord: 73..91
score: 28.95
coord: 91..110
score: 35.65
coord: 57..73
score: 44.5
IPR001487BromodomainSMARTSM00297bromo_6coord: 25..129
e-value: 2.5E-20
score: 83.5
IPR001487BromodomainPFAMPF00439Bromodomaincoord: 35..113
e-value: 3.1E-17
score: 62.4
IPR001487BromodomainPROSITEPS50014BROMODOMAIN_2coord: 40..110
score: 17.191
IPR013178Histone acetyltransferase Rtt109/CBPSMARTSM01250KAT11_2coord: 278..546
e-value: 1.6E-74
score: 263.6
IPR013178Histone acetyltransferase Rtt109/CBPPFAMPF08214HAT_KAT11coord: 282..485
e-value: 1.4E-36
score: 126.6
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 599..641
e-value: 7.9E-7
score: 38.7
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 600..641
e-value: 3.4E-7
score: 29.9
IPR000433Zinc finger, ZZ-typePROSITEPS01357ZF_ZZ_1coord: 605..631
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 599..643
score: 10.576
IPR000197Zinc finger, TAZ-typeSMARTSM00551TAZ_2coord: 647..722
e-value: 0.0053
score: 1.4
IPR000197Zinc finger, TAZ-typePFAMPF02135zf-TAZcoord: 655..721
e-value: 1.0E-4
score: 22.7
IPR000197Zinc finger, TAZ-typePROSITEPS50134ZF_TAZcoord: 639..724
score: 8.682
IPR010303CREB-binding protein/p300, atypical RING domainPFAMPF06001DUF902coord: 128..168
e-value: 1.9E-7
score: 31.5
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 598..648
e-value: 1.1E-11
score: 46.4
IPR036427Bromodomain-like superfamilyGENE3DG3DSA:1.20.920.10coord: 11..131
e-value: 1.3E-26
score: 95.0
IPR036427Bromodomain-like superfamilySUPERFAMILYSSF47370Bromodomaincoord: 18..130
IPR035898TAZ domain superfamilyGENE3DG3DSA:1.20.1020.10coord: 649..750
e-value: 2.3E-10
score: 42.3
IPR035898TAZ domain superfamilySUPERFAMILYSSF57933TAZ domaincoord: 664..725
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 212..255
e-value: 1.1E-10
score: 42.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 869..887
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 866..896
NoneNo IPR availablePANTHERPTHR13808CBP/P300-RELATEDcoord: 59..738
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 602..646
IPR018359Bromodomain, conserved sitePROSITEPS00633BROMODOMAIN_1coord: 45..102
IPR031162CBP/p300-type histone acetyltransferase domainPROSITEPS51727CBP_P300_HATcoord: 259..599
score: 69.583