GCR115

Overview
NameGCR115
Smed IDSMED30005705
Length (bp)1628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR115 (SMED30005705) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR115 (SMED30005705) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005705

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30005705SMESG000051772.1 dd_Smed_v4_21259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005705SMESG000051772.1 dd_Smed_v4_21259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005705SMESG000051772.1 dd_Smed_v4_21259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR115 vs. TrEMBL
Match: A0A193KUN2 (GCR115 OS=Schmidtea mediterranea OX=79327 GN=gcr115 PE=2 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 2.471e-113
Identity = 199/490 (40.61%), Postives = 284/490 (57.96%), Query Frame = 3
Query:  153 QPICWPMTSVSYLSMISSCSDINTDPILRRKCEDPNLFLPYIVDYIP-LHRRGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLALMLFKRLC--------YANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRWFRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVXXXXXXXXXXXXYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMR--TPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLRSSIPI-NHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQS 1586
              ICWP T   +LSMIS C     +  L  KCE+PN+FL  IVDY P + +    +VLYRN YC +C+ I +Y+++  N   +C   +   K K + +Y A ML+   C        Y+ F       C +P   C      N ++F GY   N  ++WF F    CC N S IC+  S  R+ L  Y++N ++Y +  E V N++  +        E+S L Y   +    LSL ++ LLI  Y  I +LQTSTSYMI+ IG NIA +E+  +L  F C  C+   C++    SI+FHISE ICIS Y+ SFW+DL+QMR  + N     RRN KR V F+  S +IP+      L+F + DF       + ++C  LK+ PL  FYI+P+ ++L++TT++ +KIC YL SS+ I ++E   ++ Q F +GLKLCFISGITWI N +M+  PN I+ D G+++SHFNGFVIVVCFLS + VRK I +++
Sbjct:   48 DEICWPFTKNFFLSMISKCPSSYKNKYLSEKCENPNIFLSDIVDYRPVIAQSQPMNVLYRNMYCAKCHNIVKYDWIKVNRKLKCKINLKSRKIKDENSYYARMLYNHQCEFVIDQRQYSQF------SCMIPIGVCDGYLLNNVESFYGYIEKNPTIKWFEFPSLNCCKNNSRICIVNSVGRSKLFYYSINSLLYNNQIEVVKNSSLKNTTS---NHEDSFLVYALDIAATSLSLVASILLISAYLIIPELQTSTSYMIVAIGFNIACLELTNLLSTFKCDSCQFLACKFHGIFSIFFHISETICISNYITSFWNDLNQMRRHSQNGIHEKRRNLKRTVRFYLSSAVIPLIFSSSYLLFDRFDFINFKEKNKTRMCFSLKMIPLICFYIIPVFVVLIYTTIVNMKICFYLHSSVKISSNETQNQTRQHFLLGLKLCFISGITWIFNLIMSVFPNRIVLDCGMIISHFNGFVIVVCFLSGRMVRKCIFKKA 528          
BLAST of GCR115 vs. Planmine SMEST
Match: SMESG000051772.1 (SMESG000051772.1)

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 526/531 (99.06%), Postives = 527/531 (99.25%), Query Frame = 3
Query:    3 PISSHNYQQLPAYTSPFSIIYKFMKTMSPRNLISFLHILILVEVSNLQSQQPICWPMTSVSYLSMISSCSDINTDPILRRKCEDPNLFLPYIVDYIPLHRRGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLALMLFKRLCYANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRWFRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVXXXXXXXXXXXXYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLRSSIPINHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQSFME 1595
            PISSHNYQQLPAYTS FSIIYKFMKTMSPRNLISFLHILILVEVSNLQSQQPICWPMTSVSYL MIS+CSDINTDPILRRKCEDPNLFLPYIVDYIPLHRRGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLALMLFKRLCYANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRWFRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVNNNTNSSLNISIYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCK CELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLRSSIPINHERHCKSHQRFFIGLKLCFISGITWI NFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQSFME
Sbjct:   25 PISSHNYQQLPAYTSTFSIIYKFMKTMSPRNLISFLHILILVEVSNLQSQQPICWPMTSVSYLFMISNCSDINTDPILRRKCEDPNLFLPYIVDYIPLHRRGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLALMLFKRLCYANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRWFRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVNNNTNSSLNISIYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKLCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLRSSIPINHERHCKSHQRFFIGLKLCFISGITWIFNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQSFME 555          
BLAST of GCR115 vs. Planmine SMEST
Match: SMESG000051770.1 (SMESG000051770.1)

HSP 1 Score: 356.295 bits (913), Expect = 6.871e-117
Identity = 199/490 (40.61%), Postives = 284/490 (57.96%), Query Frame = 3
Query:  153 QPICWPMTSVSYLSMISSCSDINTDPILRRKCEDPNLFLPYIVDYIP-LHRRGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLALMLFKRLC--------YANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRWFRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVXXXXXXXXXXXXYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMR--TPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLRSSIPI-NHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQS 1586
              ICWP T   +LSMIS C     +  L  KCE+PN+FL  IVDY P + +    +VLYRN YC +C+ I +Y+++  N   +C   +   K K + +Y A ML+   C        Y+ F       C +P   C      N ++F GY   N  ++WF F    CC N S IC+  S  R+ L  Y++N ++Y +  E V N++  +        E+S L Y   +    LSL ++ LLI  Y  I +LQTSTSYMI+ IG NIA +E+  +L  F C  C+   C++    SI+FHISE ICIS Y+ SFW+DL+QMR  + N     RRN KR V F+  S +IP+      L+F + DF       + ++C  LK+ PL  FYI+P+ ++L++TT++ +KIC YL SS+ I ++E   ++ Q F +GLKLCFISGITWI N +M+  PN I+ D G+++SHFNGFVIVVCFLS + VRK I +++
Sbjct:   48 DEICWPFTKNFFLSMISKCPSSYKNKYLSEKCENPNIFLSDIVDYRPVIAQSQPMNVLYRNMYCAKCHNIVKYDWIKVNRKLKCKINLKSRKIKDENSYYARMLYNHQCEFVIDQRQYSQF------SCMIPIGVCDGYLLNNVESFYGYIEKNPTIKWFEFPSLNCCKNNSRICIVNSVGRSKLFYYSINSLLYNNQIEVVKNSSLKNTTS---NHEDSFLVYALDIAATSLSLVASILLISAYLIIPELQTSTSYMIVAIGFNIACLELTNLLSTFKCDSCQFLACKFHGIFSIFFHISETICISNYITSFWNDLNQMRRHSQNGIHEKRRNLKRTVRFYLSSAVIPLIFSSSYLLFDRFDFINFKEKNKTRMCFSLKMIPLICFYIIPVFVVLIYTTIVNMKICFYLHSSVKISSNETQNQTRQHFLLGLKLCFISGITWIFNLIMSVFPNRIVLDCGMIISHFNGFVIVVCFLSGRMVRKCIFKKA 528          
BLAST of GCR115 vs. Planmine SMEST
Match: SMESG000033614.1 (SMESG000033614.1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.709e-8
Identity = 57/273 (20.88%), Postives = 124/273 (45.42%), Query Frame = 3
Query:  780 ESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQKNDFFKTGRSRRLQV----CSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYL-RSSIPINHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQ 1583
            E+ ++++S  F   LSL S F LII+Y T +  +    Y+ I + I +  +    +L+    +  + + C+Y +    +  +S  + ++ Y       L    T +   +  R +K    +F C   +   +   ++I +  D  KT  + R Q     C     +    +Y +P+ L+LL+  + C  +   L +++       +   +   ++ ++L  + G+ ++L  +  FT   I+  LG +V+   GF++ +CF+ +K VR  ++ +
Sbjct:  279 ETVIYHISFAFTC-LSLVSLFFLIILYLTHQVFKNLGGYLTICLSICLWLINFMSLLVTNT-QIVKSASCKYLAIFHHFVALSTFVWMAVYALDL---LQTFGTKSASINKNRGWKTFCIYFICVFAVSGCVVGISVIIEYFD--KTNSTLRPQYGGPHCWFTSKFGGLIWYFIPVCLLLLWNIITCGFVFYQLFKTAKECRIINNNDLNSTLWLCMRLTAVFGVGYVLQIIAIFTQLNILISLGSMVNCLQGFMLTLCFVCTKRVRSQLRNR 544          
BLAST of GCR115 vs. Planmine SMEST
Match: SMESG000033615.1 (SMESG000033615.1)

HSP 1 Score: 53.1434 bits (126), Expect = 2.917e-7
Identity = 63/276 (22.83%), Postives = 130/276 (47.10%), Query Frame = 3
Query:  780 ESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMIIVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGYVYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLI---FQKNDFFKTGRSRRLQV----CSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYL-RSSIPINHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGVVVSHFNGFVIVVCFLSSKTVRKYIKEQ 1583
            E+ ++++S  F   LSL S F LII+Y T +  +    Y+ I + I +  +     L++   +  E + C+Y   L+I+ H    + +S +V+     L  ++T   +  +  N KR +  FS   LI  +   G+++        F KT  + R Q     C     +    +Y +P+ L+LL+  ++C  +   L +++      +   ++   ++ ++L  + G+ ++L     FT   I+  LG +V+   GF++ +CF+ +K  R  ++ +
Sbjct:  122 ETVIYHISFAFTC-LSLVSLFFLIILYLTHQVFKNFGGYLTICLSICLWLINFMS-LLVTNTQIVESASCKY---LAIFHHF---VALSTFVWMAVYALDLLQTFGTKL-VNANKKRGLKSFSVYCLIGFS-TSGSVVGISVITEYFDKTNSTLRPQYGGPYCWFTSKFGGLIYYFIPVCLLLLWNFIMCSFVFYQLFKTAKECRIVKKKDANSTLWLCMRLTAVFGVGYVLQIFAIFTQLEILISLGSMVNCLQGFMLTLCFVCTKRARSLLRNR 387          
The following BLAST results are available for this feature:
BLAST of GCR115 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A193KUN22.471e-11340.61GCR115 OS=Schmidtea mediterranea OX=79327 GN=gcr11... [more]
back to top
BLAST of GCR115 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR115 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000051772.10.000e+099.06SMESG000051772.1[more]
SMESG000051770.16.871e-11740.61SMESG000051770.1[more]
SMESG000033614.13.709e-820.88SMESG000033614.1[more]
SMESG000033615.12.917e-722.83SMESG000033615.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005705 ID=SMED30005705|Name=GCR115|organism=Schmidtea mediterranea sexual|type=transcript|length=1628bp
GCCCAATTAGTAGTCACAATTATCAGCAATTACCAGCGTATACTTCCCCC
TTCTCAATTATCTACAAATTTATGAAAACAATGTCTCCTAGAAATTTGAT
TTCTTTTCTTCATATACTAATATTAGTAGAAGTCTCCAATCTCCAATCTC
AACAACCCATATGTTGGCCTATGACTTCCGTTTCGTATTTGTCCATGATT
TCCAGTTGCTCTGATATCAATACCGATCCGATTCTTAGGCGGAAATGTGA
AGATCCAAACCTTTTCCTTCCTTATATTGTTGATTATATACCTTTGCATC
GTAGGGGCTCCAAAAGTGTTCTCTATCGAAACCGCTATTGCATCAGATGC
AACAAAATCAAAGAATATGAATATGTGAACACGAATAATACATTTAGATG
TTCGAAAAAGATTGTTTTAGGCAAAGGTAAACAAAAAGAAAATTATTTGG
CATTGATGTTATTCAAAAGGTTATGTTATGCCAATTTCCATTTTCCAGAA
TCTTTGAGGTGTTCCCTTCCGGAGGAAAAATGTAAGATTCCCGAGACAGT
AAATGAAGATACCTTTATTGGTTATGGCATTGATAACTCAATATTGCGAT
GGTTCCGGTTTCAAGGTTCGGAATGCTGTTTAAATTATAGCGAGATCTGC
ATGCCGATTTCTCGAAGACGAACCCCGCTATTGATATATGCGTTAAACGA
AATGATTTACCCAGACGACTTTGAGACAGTTAATAATAATACTAATTCCT
CTTTAAATATTTCAATTTATAGACAAGAAGAATCTACTTTATTTTACGTT
TCACACTTGTTTGTCGTCTTTTTGTCTTTAGGGTCGGCCTTTTTATTAAT
AATCGTCTACGCTACAATTAGAGATCTCCAAACGTCAACAAGTTACATGA
TAATTGTGATAGGTATCAATATTGCTTTCATGGAAATTCAGGAAATTTTA
ATGATATTTCTCTGTAAATTCTGTGAACTGTCGATTTGTGAATATTTCAG
CACTTTGTCGATTTATTTTCACATCTCAGAAGCGATTTGTATTAGCGGCT
ACGTTTACAGTTTCTGGAGCGACCTCCATCAAATGCGAACGCCAAATAAG
CAGAGTAGTATGAGAAGGAATTATAAACGAAATGTGGGATTTTTCAGTTG
CTCGATTTTGATACCGATGGCACTGTGTTGCGGGAATCTAATTTTTCAGA
AAAATGATTTTTTTAAGACGGGTCGATCAAGGAGACTTCAGGTCTGTTCT
GTATTAAAGCTCTATCCGTTGTTTGGATTTTACATTGTCCCTCTTTTATT
AATTCTATTATTTACTACAGTCATTTGTATTAAAATATGTCTATATTTGA
GGTCTTCTATCCCAATAAACCATGAAAGGCATTGTAAAAGTCACCAAAGA
TTCTTTATCGGACTGAAATTGTGCTTTATAAGTGGGATTACCTGGATTTT
AAATTTTTTAATGGCTTTTACTCCGAACACAATTATTCGAGATTTGGGGG
TGGTTGTCTCACATTTCAATGGATTTGTAATTGTTGTCTGTTTTTTGTCA
AGTAAAACAGTAAGGAAGTATATAAAAGAACAATCATTTATGGAATAAAT
ACATTTTATAGTCTTGCTAACAAAAAAA
back to top

protein sequence of SMED30005705-orf-1

>SMED30005705-orf-1 ID=SMED30005705-orf-1|Name=SMED30005705-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=532bp
PISSHNYQQLPAYTSPFSIIYKFMKTMSPRNLISFLHILILVEVSNLQSQ
QPICWPMTSVSYLSMISSCSDINTDPILRRKCEDPNLFLPYIVDYIPLHR
RGSKSVLYRNRYCIRCNKIKEYEYVNTNNTFRCSKKIVLGKGKQKENYLA
LMLFKRLCYANFHFPESLRCSLPEEKCKIPETVNEDTFIGYGIDNSILRW
FRFQGSECCLNYSEICMPISRRRTPLLIYALNEMIYPDDFETVNNNTNSS
LNISIYRQEESTLFYVSHLFVVFLSLGSAFLLIIVYATIRDLQTSTSYMI
IVIGINIAFMEIQEILMIFLCKFCELSICEYFSTLSIYFHISEAICISGY
VYSFWSDLHQMRTPNKQSSMRRNYKRNVGFFSCSILIPMALCCGNLIFQK
NDFFKTGRSRRLQVCSVLKLYPLFGFYIVPLLLILLFTTVICIKICLYLR
SSIPINHERHCKSHQRFFIGLKLCFISGITWILNFLMAFTPNTIIRDLGV
VVSHFNGFVIVVCFLSSKTVRKYIKEQSFME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 253..530
e-value: 1.1E-9
score: 39.7
NoneNo IPR availableCDDcd139527tm_classBcoord: 260..524
e-value: 3.71454E-7
score: 49.524
NoneNo IPR availableTMHMMTMhelixcoord: 377..399
NoneNo IPR availableTMHMMTMhelixcoord: 494..516
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 468..490
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 426..448
NoneNo IPR availableTMHMMTMhelixcoord: 334..356