Ras-related protein Rab-8A

Overview
NameRas-related protein Rab-8A
Smed IDSMED30005697
Length (bp)1331
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-8A (SMED30005697) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-8A (SMED30005697) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-8A (SMED30005697) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-8A (SMED30005697) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005697

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30005697SMESG000026178.1 dd_Smed_v4_3485_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8A (RAB8A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:7007])

HSP 1 Score: 288.886 bits (738), Expect = 4.994e-96
Identity = 145/210 (69.05%), Postives = 173/210 (82.38%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  S+   KIT + ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSNQGVKITPDQQKRSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 283.108 bits (723), Expect = 9.151e-94
Identity = 139/210 (66.19%), Postives = 170/210 (80.95%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR---SDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  K+ ++   S+  G   P   KIT+   ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPV--KITENRSKKTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB8B (RAB8B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:30273])

HSP 1 Score: 275.789 bits (704), Expect = 3.078e-91
Identity = 129/176 (73.30%), Postives = 153/176 (86.93%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR 584
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  K+ ++
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSANVEEAFFTLARDIMTKLNRK 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: AL358472.6 (novel protein)

HSP 1 Score: 261.151 bits (666), Expect = 2.261e-85
Identity = 125/195 (64.10%), Postives = 152/195 (77.95%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESK 641
            MAK YDHLFKLLLIGDSGVGKT ++ RF+EDNFN T+I+TIGIDFKIRT+DI GKKIKLQ+WDTAGQERF+TITTAYYRGAMGI+LVYD+T EKSF NI  W+ +I ++A+A VE++LLGNK DM  +R+V  +   +LA+ HGI+F ETSAK+  NVDEAF  LA DI  K   R    G  PP++   T + K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKK 195          
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Match: RAB13 (RAB13, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9762])

HSP 1 Score: 261.151 bits (666), Expect = 2.261e-85
Identity = 125/195 (64.10%), Postives = 152/195 (77.95%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESK 641
            MAK YDHLFKLLLIGDSGVGKT ++ RF+EDNFN T+I+TIGIDFKIRT+DI GKKIKLQ+WDTAGQERF+TITTAYYRGAMGI+LVYD+T EKSF NI  W+ +I ++A+A VE++LLGNK DM  +R+V  +   +LA+ HGI+F ETSAK+  NVDEAF  LA DI  K   R    G  PP++   T + K
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPPSTDLKTCDKK 195          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 266.544 bits (680), Expect = 9.833e-88
Identity = 124/175 (70.86%), Postives = 151/175 (86.29%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEK 581
            MAK YD+LFKLLLIGDSGVGKT VLFRFS+D+FN +FI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGI+LVYD+T+E+SF NI  WI NI +HA +DVE+M++GNK D+ ++R+V  D G +LA  +G KF+ETSAK   N+DEAF  LA DIK+KME+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQ 175          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-8 (RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5EFC1])

HSP 1 Score: 266.544 bits (680), Expect = 9.833e-88
Identity = 124/175 (70.86%), Postives = 151/175 (86.29%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEK 581
            MAK YD+LFKLLLIGDSGVGKT VLFRFS+D+FN +FI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGI+LVYD+T+E+SF NI  WI NI +HA +DVE+M++GNK D+ ++R+V  D G +LA  +G KF+ETSAK   N+DEAF  LA DIK+KME+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSDDSFNNSFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIILVYDITNERSFENIKNWIRNIEEHAASDVERMIIGNKCDIEERREVSRDRGEQLAIEYGTKFLETSAKANLNIDEAFFTLARDIKSKMEQ 175          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 247.669 bits (631), Expect = 1.613e-80
Identity = 118/176 (67.05%), Postives = 142/176 (80.68%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 590
            +PYD LFKLLLIGDSGVGKT +L+RFS+D FN TFI+TIGIDFKI+TI++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+T+ KSF+NI +W+ NI +HA+ DV KM+LGNK DM+D+R V  + G ++AQ HGI F ETSAK   +VD AF  LA  I  KM   +D
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTD 179          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-10 (Ras-related protein Rab-10 [Source:UniProtKB/Swiss-Prot;Acc:Q94148])

HSP 1 Score: 247.669 bits (631), Expect = 1.613e-80
Identity = 118/176 (67.05%), Postives = 142/176 (80.68%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 590
            +PYD LFKLLLIGDSGVGKT +L+RFS+D FN TFI+TIGIDFKI+TI++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+T+ KSF+NI +W+ NI +HA+ DV KM+LGNK DM+D+R V  + G ++AQ HGI F ETSAK   +VD AF  LA  I  KM   +D
Sbjct:    4 RPYDMLFKLLLIGDSGVGKTCILYRFSDDAFNTTFISTIGIDFKIKTIELKGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFDNIAKWLRNIDEHASEDVVKMILGNKCDMSDRRVVSRERGEKIAQDHGISFHETSAKLNVHVDTAFYDLAEAILAKMPDSTD 179          
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Match: rab-1 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6])

HSP 1 Score: 219.164 bits (557), Expect = 2.188e-69
Identity = 97/173 (56.07%), Postives = 137/173 (79.19%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            M   YD+LFKLLLIGDSGVGK+ +L RF++D +  ++I+TIG+DFKIRTI+++GK IKLQIWDTAGQERFRTIT++YYRGA GI++VYD+T +++FNN+ QW+  I ++A  +V K+L+GNK D+  +R V T   ++ A   GI F+ETSAK+  NV++AF  +A +IK++M
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDITDQETFNNVKQWLQEIDRYACENVNKLLVGNKCDLTAKRAVETQAAQDYAGQLGIPFLETSAKSSTNVEQAFLTMASEIKSRM 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308833)

HSP 1 Score: 276.559 bits (706), Expect = 1.439e-91
Identity = 137/208 (65.87%), Postives = 164/208 (78.85%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITK-ESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++ KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T EKSF NI  WI NI ++A+ADVEKMLLGNK ++ D+RQV  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK K EKR +     P   H++   +S+ + ++  +C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN-PPKGGHQLKPMDSRTKDSWLSRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0074921)

HSP 1 Score: 276.559 bits (706), Expect = 1.439e-91
Identity = 137/208 (65.87%), Postives = 164/208 (78.85%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITK-ESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++ KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T EKSF NI  WI NI ++A+ADVEKMLLGNK ++ D+RQV  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK K EKR +     P   H++   +S+ + ++  +C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN-PPKGGHQLKPMDSRTKDSWLSRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab10 (gene:FBgn0015789 transcript:FBtr0077337)

HSP 1 Score: 252.292 bits (643), Expect = 4.052e-82
Identity = 118/174 (67.82%), Postives = 143/174 (82.18%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR 584
            K YD LFKLLLIGDSGVGKT +LFRFS+D F +TFI+TIGIDFKI+T+++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+T+EKSF NI +W+ NI +HAN DVEKM+LGNK DM D+R V  + G  +A+ HGI+FMETSAK+  N++ AF +LA  I +K   R
Sbjct:    4 KTYDLLFKLLLIGDSGVGKTCILFRFSDDAFTSTFISTIGIDFKIKTVELRGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNEKSFENIVKWLRNIDEHANEDVEKMILGNKCDMTDKRVVNKERGEAIAREHGIRFMETSAKSNINIERAFCELAEAILDKTSGR 177          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab1 (gene:FBgn0285937 transcript:FBtr0084104)

HSP 1 Score: 220.705 bits (561), Expect = 6.854e-70
Identity = 101/183 (55.19%), Postives = 140/183 (76.50%), Query Frame = 3
Query:   69 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTS 617
            YD+LFKLLLIGDSGVGK+ +L RF++D +  ++I+TIG+DFKIRTI+++GK IKLQIWDTAGQERFRTIT++YYRGA GI++VYD T ++SFNN+ QW++ I ++A  +V K+L+GNK+D+  ++ V   T  E A   GI F+ETSAK+  NV++AF  +A +IKN+         V PP+S
Sbjct:    8 YDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDCTDQESFNNVKQWLEEIERYACENVNKLLVGNKSDLTTKKVVDHTTAAEYAAQLGIPFLETSAKSATNVEQAFMTMAAEIKNR---------VGPPSS 181          
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Match: Rab8 (gene:FBgn0262518 transcript:FBtr0308832)

HSP 1 Score: 205.682 bits (522), Expect = 1.714e-64
Identity = 103/167 (61.68%), Postives = 127/167 (76.05%), Query Frame = 3
Query:  180 GIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITK-ESKRRRAFSFKCEIL 677
            GIDFKIRTI+++ KKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T EKSF NI  WI NI ++A+ADVEKMLLGNK ++ D+RQV  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK K EKR +     P   H++   +S+ + ++  +C +L
Sbjct:    7 GIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANN-PPKGGHQLKPMDSRTKDSWLSRCSLL 172          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 286.96 bits (733), Expect = 1.437e-95
Identity = 145/210 (69.05%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+N++RQV  D G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+ +  L G  P  S+   KIT E  ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINEKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTK--LEGNNPQGSNHGVKITTEQPKKSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 286.96 bits (733), Expect = 1.437e-95
Identity = 145/210 (69.05%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+N++RQV  D G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+ +  L G  P  S+   KIT E  ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINEKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTK--LEGNNPQGSNHGVKITTEQPKKSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: megf8 (multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-GENE-090730-1])

HSP 1 Score: 276.559 bits (706), Expect = 5.855e-92
Identity = 131/173 (75.72%), Postives = 150/173 (86.71%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI++NGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+TSEKSF NI  WI NI +HA++DVEKM+LGNK DMN++RQV  + G +LA  +GIKF+ETSAKT  NV+EAF  LA DI  ++
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVEKMILGNKCDMNERRQVSKERGEKLAIDYGIKFLETSAKTSINVEEAFFTLARDIMARL 173          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 277.715 bits (709), Expect = 6.692e-92
Identity = 137/210 (65.24%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR---SDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  ++ ++   ++ +G     + KIT ES+ ++   F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLNRKMNENNPSGGGGGGAVKIT-ESRSKKPSFFRCILL 209          
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Match: rab8b (RAB8B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070620-16])

HSP 1 Score: 277.715 bits (709), Expect = 6.692e-92
Identity = 137/210 (65.24%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR---SDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  ++ ++   ++ +G     + KIT ES+ ++   F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFVTLARDIMTRLNRKMNENNPSGGGGGGAVKIT-ESRSKKPSFFRCILL 209          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: clcn7 (chloride channel, voltage-sensitive 7 [Source:Xenbase;Acc:XB-GENE-995168])

HSP 1 Score: 286.96 bits (733), Expect = 3.263e-95
Identity = 142/210 (67.62%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVEKM+LGNK D+N++RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+KR  + G  P  S+   KIT++ +++ +F F+C +L
Sbjct:   14 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDVNEKRQVSKEKGEKLALEYGIKFMETSAKANINVENAFFTLARDIKAKMDKR--MEGNSPQGSNQGVKITQDQQKKSSF-FRCVLL 220          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 280.796 bits (717), Expect = 5.850e-93
Identity = 138/210 (65.71%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  K+ ++  +   + P      KIT++S ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEAFFTLARDIMTKLNRK--MNESISPGGGGPVKITEKSSKKSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 265.774 bits (678), Expect = 2.852e-87
Identity = 134/208 (64.42%), Postives = 165/208 (79.33%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLT-GVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+E         K K+     ++ G   P   KIT++S ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEVG-------KGKINSNESISPGGGGPV--KITEKSSKKSSF-FRCVLL 198          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 263.462 bits (672), Expect = 2.507e-86
Identity = 122/161 (75.78%), Postives = 143/161 (88.82%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEA 539
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+E 
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Match: pknox2 (PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GENE-853128])

HSP 1 Score: 261.922 bits (668), Expect = 6.313e-86
Identity = 122/161 (75.78%), Postives = 143/161 (88.82%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEA 539
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+E 
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSREKGEKLAIDYGIKFLETSAKSSINVEEV 161          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab8a (RAB8A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:96960])

HSP 1 Score: 290.426 bits (742), Expect = 6.370e-97
Identity = 147/210 (70.00%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  +SH  KIT E ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSSHGVKITVEQQKRTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab8b (RAB8B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:2442982])

HSP 1 Score: 283.878 bits (725), Expect = 2.971e-94
Identity = 139/210 (66.19%), Postives = 171/210 (81.43%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR---SDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAK+  NV+EAF  LA DI  K+ ++   S+ +G   P   KIT+   ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPV--KITESRSKKTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab13 (RAB13, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1927232])

HSP 1 Score: 259.225 bits (661), Expect = 8.486e-85
Identity = 123/200 (61.50%), Postives = 153/200 (76.50%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAF 656
            MAK YDHLFKLLLIGDSGVGKT ++ RF+EDNFN+T+I+TIGIDFKIRT+DI GK+IKLQ+WDTAGQERF+TITTAYYRGAMGI+LVYD+T EKSF NI  W+ +I ++A+A VE++LLGNK DM  +RQV  +   +LA+ H I+F ETSAK+  NVDEAF  LA DI  K   R   T   P ++   T + K+ +  
Sbjct:    1 MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNKCL 200          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab10 (RAB10, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105066])

HSP 1 Score: 253.447 bits (646), Expect = 1.759e-82
Identity = 123/188 (65.43%), Postives = 147/188 (78.19%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKI 626
            K YD LFKLLLIGDSGVGKT VLFRFS+D FN TFI+TIGIDFKI+T+++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+T+ KSF NI++W+ NI +HAN DVE+MLLGNK DM+D+R VP   G ++A+ HGI+F ETSAK   N+++AF  LA DI  K       T V  P S  +
Sbjct:    4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRK-------TPVKEPNSENV 184          
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Match: Rab1a (RAB1A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:97842])

HSP 1 Score: 221.861 bits (564), Expect = 4.674e-70
Identity = 99/173 (57.23%), Postives = 137/173 (79.19%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            M   YD+LFKLLLIGDSGVGK+ +L RF++D +  ++I+TIG+DFKIRTI+++GK IKLQIWDTAGQERFRTIT++YYRGA GI++VYDVT ++SFNN+ QW+  I ++A+ +V K+L+GNK D+  ++ V   T +E A S GI F+ETSAK   NV+++F  +A +IK +M
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|P35280|RAB8A_RAT (Ras-related protein Rab-8A OS=Rattus norvegicus OX=10116 GN=Rab8a PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 4.456e-96
Identity = 147/210 (70.00%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  +SH  KIT E ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSSHGVKITVEQQKRTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|P55258|RAB8A_MOUSE (Ras-related protein Rab-8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=2)

HSP 1 Score: 290.426 bits (742), Expect = 4.456e-96
Identity = 147/210 (70.00%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  +SH  KIT E ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSSHGVKITVEQQKRTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|A4FV54|RAB8A_BOVIN (Ras-related protein Rab-8A OS=Bos taurus OX=9913 GN=RAB8A PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.394e-95
Identity = 145/210 (69.05%), Postives = 173/210 (82.38%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  S+   KIT + ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKK--LEGNSPQGSNQGVKITPDQQKRSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|Q4R5P1|RAB8A_MACFA (Ras-related protein Rab-8A OS=Macaca fascicularis OX=9541 GN=RAB8A PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.398e-95
Identity = 145/210 (69.05%), Postives = 173/210 (82.38%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  S+   KIT + ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSNQGVKITPDQQKRSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Match: sp|P61006|RAB8A_HUMAN (Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.398e-95
Identity = 145/210 (69.05%), Postives = 173/210 (82.38%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  S+   KIT + ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSNQGVKITPDQQKRSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: V4A724 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_204153 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 1.048e-96
Identity = 145/207 (70.05%), Postives = 169/207 (81.64%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+TSEKSF NI  WI NI +HA+ DVEKM+L NK DMND+RQV  + G  LA  HGIKFMETSAK   NVDEAF  LA DIK KM++RSD T       +++ K++  +++F +KC IL
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIRNWIRNIEEHASKDVEKMILANKCDMNDRRQVSKERGENLAVEHGIKFMETSAKASINVDEAFFTLARDIKGKMDRRSDSTPNAKQAGYQLKKDNASKKSF-WKCSIL 206          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A4S2LFY0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007476 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 2.051e-96
Identity = 148/207 (71.50%), Postives = 168/207 (81.16%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED+FN+TFIATIGIDFKIRTIDI+GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVT+ KSF NIN W+ NI QHAN DVEKMLLGNK DM DQRQV  + G++LA    I F+ETSAK+G +VD+AFRQLA DIK KMEK+ D+ G  PP        S R +   ++C +L
Sbjct:    1 MAKCYDYLFKLLLIGDSGVGKTCLLFRFSEDDFNSTFIATIGIDFKIRTIDIDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTNAKSFKNINLWMRNIDQHANQDVEKMLLGNKCDMVDQRQVTREEGQDLANMFNIPFLETSAKSGASVDDAFRQLARDIKVKMEKKMDMAG--PPKQDLKNLNSGRHKRQFWRCSVL 205          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: A0A0N8JYY1 (Ras-related protein Rab-8A-like OS=Scleropages formosus OX=113540 GN=Z043_113574 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.680e-94
Identity = 147/210 (70.00%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  D G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  +SH  KIT E +++++  F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKDRGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKK--LEGNSPQGSSHGMKITPEQQQKKSNFFRCVLL 208          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: W4YMP8 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 8.836e-94
Identity = 143/208 (68.75%), Postives = 171/208 (82.21%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKIT-KESKRRRAFSFKCEIL 677
            MAK YD LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T++KSF+NI  WI NI +HA+ADVEKM+LGNK DM+D+R V  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK+KM+++ D TG       K+T KES+++  + F C +L
Sbjct:    1 MAKTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNQKSFDNIRNWIRNIEEHASADVEKMILGNKCDMDDRRAVSKEKGEQLAIEYGIKFMETSAKASINVEEAFVTLARDIKSKMDRKMDATGQQKSGGVKVTEKESQKKSGWKF-CTLL 207          
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Match: Q0PD50 (Rab8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.321e-93
Identity = 147/210 (70.00%), Postives = 174/210 (82.86%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GK+IKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  +SH  KIT E ++R +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKK--LEGNSPQGSSHGVKITVEQQKRTSF-FRCSLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: rab8a (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:103043778])

HSP 1 Score: 288.115 bits (736), Expect = 4.634e-96
Identity = 145/210 (69.05%), Postives = 172/210 (81.90%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH---KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVEKM+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+ +  L G  P  S+   KIT E +++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASADVEKMILGNKCDINDKRQVSKERGEKLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDTK--LEGNNPQGSNHGVKITTEQQKKSSF-FRCVLL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: megf8 (ras-related protein Rab-8B [Source:NCBI gene;Acc:103041748])

HSP 1 Score: 285.804 bits (730), Expect = 3.646e-95
Identity = 141/211 (66.82%), Postives = 171/211 (81.04%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR----SDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRT+++NGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+TSEKSF NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  +GIKF+ETSAKT  NV+EAF  LA DI +++ ++    S+  G  P    KIT++  ++ +F FKC +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVELNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITSEKSFENIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKTSVNVEEAFLTLARDIMSRLNRKMNDGSNSDGGAPV---KITEKRSKKHSF-FKCALL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: rab8b (ras-related protein Rab-8B [Source:NCBI gene;Acc:103040614])

HSP 1 Score: 276.944 bits (707), Expect = 1.233e-91
Identity = 133/207 (64.25%), Postives = 166/207 (80.19%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVE+M+LGNK DMND+RQV  + G +LA  + IKF+ETSAK+  NV+EAF  L+ DI  ++ ++ +          KIT+   ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYSIKFLETSAKSSTNVEEAFFTLSRDIMTRLNRKMNENNPAGGGPVKITENRSKKPSF-FRCSLL 206          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: rab13 (RAB13, member RAS oncogene family [Source:NCBI gene;Acc:103044636])

HSP 1 Score: 253.062 bits (645), Expect = 1.936e-82
Identity = 123/207 (59.42%), Postives = 157/207 (75.85%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD LFKLLLIGDSGVGKT ++ RF+EDNFN+T+I+TIGIDFK++TI++ GKK+KLQ+WDTAGQERF+TITTAYYRGAMGI+LVYD+T EKSF NI  W+ +I ++A+A V +MLLGNK D+  +R+V  + G +LA+ HGI+F ETSAK+  NV+E+F  LA DI  K  K+S  TG     +   T E K     S KC +L
Sbjct:    1 MAKKYDFLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKVKTIEVEGKKVKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVSRMLLGNKCDIEAKRKVSKEMGEKLAKDHGIRFFETSAKSSINVEESFMSLARDILLKSGKKSGPTGREVKLTTTTTPEKK-----SSKCLLL 202          
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Match: RAB10 (RAB10, member RAS oncogene family [Source:NCBI gene;Acc:103045708])

HSP 1 Score: 252.292 bits (643), Expect = 3.506e-82
Identity = 122/188 (64.89%), Postives = 146/188 (77.66%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKI 626
            K YD LFKLLLIGDSGVGKT VLFRFS+D FN TFI+TIGIDFKI+T+++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+++ KSF NI++W+ NI +HAN DVE+MLLGNK DM D+R VP   G ++A+ HGI+F ETSAK   N+++AF  LA DI  K       T V  P S  +
Sbjct:    4 KTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDISNAKSFENISKWLRNIDEHANEDVERMLLGNKCDMEDKRIVPKAKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRK-------TPVKEPNSENV 184          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 290.426 bits (742), Expect = 1.275e-97
Identity = 145/209 (69.38%), Postives = 171/209 (81.82%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH--KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTID++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF NI  WI NI +HA+ADVEKM+LGNK DMN++RQV  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK KM+++  L G   P S+  +IT  S+ ++   F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVEKMILGNKCDMNERRQVTRERGEKLAIEYGIKFMETSAKASINVEEAFFTLARDIKAKMDRK--LEGNNTPDSNAVRITAPSQGKKTSFFRCALL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab8a (RAB8A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-070424-36])

HSP 1 Score: 255.758 bits (652), Expect = 5.169e-84
Identity = 131/209 (62.68%), Postives = 158/209 (75.60%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIR--TIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIG    +    I I+ KKIKLQIWDTAGQERFRTITTAYYRGAMG MLVYD+T+EKSF NI  WI NI +HA+ADV+KM +GNK DMND+RQV  D G +LA+ + I+FMETSAK   NV+EAF  LA +IK KM+K+ +       +S +IT  S  +++  F+C +L
Sbjct:    1 MAKSYDCLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGGSRPVCQVCIRIDLKKIKLQIWDTAGQERFRTITTAYYRGAMGSMLVYDITNEKSFENIKNWIRNIEEHASADVQKM-VGNKCDMNDRRQVTKDRGEKLAEDYNIQFMETSAKASINVEEAFFTLAREIKAKMDKKMEGNTAAENSSVQITNASHSKKSSFFRCTLL 208          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab1aa (RAB1A, member RAS oncogene family a [Source:ZFIN;Acc:ZDB-GENE-090312-110])

HSP 1 Score: 219.55 bits (558), Expect = 5.003e-70
Identity = 99/173 (57.23%), Postives = 136/173 (78.61%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            M   YD+LFKLLLIGDSGVGK+ +L RF++D +  ++I+TIG+DFKIRTI+++GK IKLQIWDTAGQERFRTIT++YYRGA GI++VYDVT ++SFNN+ QW+  I ++A+ +V K+L+GNK D+  ++ V   T +E A S  I F+ETSAK   NV++AF  +A +IK +M
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLEIPFLETSAKNATNVEQAFMTMAAEIKKRM 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: rab3c (RAB3C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040718-263])

HSP 1 Score: 203.756 bits (517), Expect = 1.441e-63
Identity = 92/171 (53.80%), Postives = 130/171 (76.02%), Query Frame = 3
Query:   69 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEK 581
            +D++FKLL+IG+S VGKTS LFR+++++F + F++T+GIDFK++T+  N K+IKLQIWDTAGQER+RTITTAYYRGAMG +L+YD+T+E SFN ++ W   I  ++  + + +L+GNK DM D R VPT+ GR+LA+  G +F ETSAK   NV + F +L   I  KM +
Sbjct:   26 FDYMFKLLIIGNSSVGKTSFLFRYADESFTSAFVSTVGIDFKVKTVYRNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEDSFNAVSDWSTQIKTYSWDNAQVVLVGNKCDMEDDRMVPTEQGRQLAEQLGFEFFETSAKDNINVKQTFERLVDVICEKMSE 196          
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010665.1 (pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 gene:ENSPMAG00000009656.1 transcript:ENSPMAT00000010665.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 1.146e-61
Identity = 90/121 (74.38%), Postives = 105/121 (86.78%), Query Frame = 3
Query:  180 GIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAF 542
            GIDFKIRT+D++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T++KSF NI  WI NI +HA+ADVE+M+LGNK DMND+RQV  + G + A  +GIKFMETSAK   NV+EAF
Sbjct:    1 GIDFKIRTVDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASADVERMILGNKCDMNDRRQVSRERGEKFASEYGIKFMETSAKASINVEEAF 121          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: SEC4 (Rab family GTPase; essential for vesicle-mediated exocytic secretion and autophagy; associates with the exocyst component Sec15p and may regulate polarized delivery of transport vesicles to the exocyst at the plasma membrane [Source:SGD;Acc:S000001889])

HSP 1 Score: 223.016 bits (567), Expect = 1.716e-71
Identity = 109/181 (60.22%), Postives = 137/181 (75.69%), Query Frame = 3
Query:   60 AKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGV 602
             K YD + K+LLIGDSGVGK+ +L RF ED FN +FI TIGIDFKI+T+DINGKK+KLQ+WDTAGQERFRTITTAYYRGAMGI+LVYDVT E++F NI QW   + +HAN + + +L+GNK+DM + R V  D G  LA+  GI F+E+SAK   NV+E F  LA  I+ K++  + L GV
Sbjct:   14 GKSYDSIMKILLIGDSGVGKSCLLVRFVEDKFNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDVTDERTFTNIKQWFKTVNEHANDEAQLLLVGNKSDM-ETRVVTADQGEALAKELGIPFIESSAKNDDNVNEIFFTLAKLIQEKIDS-NKLVGV 192          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT1 (Rab family GTPase; involved in the ER-to-Golgi step of the secretory pathway; complex formation with the Rab escort protein Mrs6p is required for prenylation of Ypt1p by type II protein geranylgeranyltransferase (Bet2p-Bet4p); binds to unspliced HAC1 mRNA; regulates the unfolded protein response (UPR) by promoting the decay of HAC1 RNA; localizes to the early Golgi, the transitional Golgi and ER membranes, pre-autophagosomal structures, and cytoplasmic vesicles [Source:SGD;Acc:S000001856])

HSP 1 Score: 207.223 bits (526), Expect = 2.283e-65
Identity = 92/177 (51.98%), Postives = 134/177 (75.71%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRS 587
            M   YD+LFKLLLIG+SGVGK+ +L RFS+D +   +I+TIG+DFKI+T++++GK +KLQIWDTAGQERFRTIT++YYRG+ GI++VYDVT ++SFN +  W+  I ++A + V K+L+GNK D+ D+R V  D  +E A ++ + F+ETSA    NV++AF  +A  IK  M +++
Sbjct:    1 MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQN 177          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 186.422 bits (472), Expect = 3.937e-57
Identity = 88/178 (49.44%), Postives = 125/178 (70.22%), Query Frame = 3
Query:   69 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRS-DLTG 599
            YD+LFK++LIGDSGVGK+++L RF+ D FN    +TIG++F  RTI++  KKIK QIWDTAGQER+R IT+AYYRGA+G ++VYD++   S+ N N W+  + ++A+ +V   L+GNK+D+   R VPTD  +  A  + + F ETSA    NVD+AFR+L + I   + K   DL+G
Sbjct:   10 YDYLFKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSG 187          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 184.496 bits (467), Expect = 2.073e-56
Identity = 84/172 (48.84%), Postives = 124/172 (72.09%), Query Frame = 3
Query:   69 YDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR 584
            YD LFK++LIGDSGVGK+++L RF+++ FN    +TIG++F  RT++I+GK+IK QIWDTAGQER+R IT+AYYRGA+G ++VYD++   S+ N N W+  + ++A+ +V   L+GNK+D+   R VPT+  +  AQ + + F ETSA   +NVD+AF +L   I  K+ K 
Sbjct:   10 YDLLFKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKH 181          
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 146.362 bits (368), Expect = 5.546e-42
Identity = 70/160 (43.75%), Postives = 113/160 (70.62%), Query Frame = 3
Query:   81 FKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNI-TQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIK-FMETSAKTGQNVDEAFRQLA 554
            +K++ +G+ GVGKTS++ RF  D F+  + ATIGIDF  +T+ ++ K I+LQ+WDTAGQERFR++  +Y R +   ++VYD+T  KSF  I++WI+++  +  + +V   ++GNK+D++D+RQ+ T+ G + A+  G K FMETS K G NV   F+++A
Sbjct:   11 YKIVFLGEQGVGKTSLITRFMYDTFDDHYQATIGIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDLSDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIA 170          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO41018 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5I6])

HSP 1 Score: 285.804 bits (730), Expect = 1.218e-95
Identity = 141/207 (68.12%), Postives = 166/207 (80.19%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD LFKLLLIGDSGVGKT VLFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T++KSF NI  WI NI +HA+ DVEKM+LGNK DM D+RQV  + G +LA  +GIKFMETSAK   NV+EAF  LA DIK KM+K+ + +      + KIT E + +R+  F+C  L
Sbjct:    1 MAKTYDFLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNDKSFENIKNWIRNIEEHASQDVEKMVLGNKCDMEDRRQVSKERGEQLAVEYGIKFMETSAKASINVEEAFFTLARDIKLKMDKKLENSNPASTGAVKITHEKETKRSI-FRCSTL 206          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO47471 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA6])

HSP 1 Score: 258.84 bits (660), Expect = 3.216e-85
Identity = 121/177 (68.36%), Postives = 152/177 (85.88%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDI-KNKMEKRSD 590
            K YD+LFKLLLIGDSGVGKT +LFRFS+D FN TFI+TIGIDFKI+TI++ GKKIKLQIWDTAGQERF TITT+YYRGAMGIMLVYD+T EK+F+NI++W+ NI +HAN DVEKM+LGNK DM+D+R V  + G ++A+ HGI+F+ETSAKT  N+++AF+ LA DI K ++ K S+
Sbjct:    4 KSYDYLFKLLLIGDSGVGKTCILFRFSDDAFNTTFISTIGIDFKIKTIEMQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITQEKTFDNISKWLRNIEEHANEDVEKMILGNKCDMDDRRIVSRERGEQIAREHGIRFLETSAKTNINIEQAFQYLAQDILKKELNKDSE 180          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO40845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5Z2])

HSP 1 Score: 236.113 bits (601), Expect = 1.415e-76
Identity = 114/190 (60.00%), Postives = 143/190 (75.26%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITK 632
            K  D  FKLLLIGDSGVGKT ++FRF+++ FN +FI+TIGIDFKI+T+++ GKKIKLQIWDTAGQERF TITTAYYRGAMGIMLVYDVT+EKSF+NI++W+  I  HAN DV++ML+GNK DM D+R +    G +LA S+GI F+ETSA +  NV+++F  L  DI         L  V PPT  +  K
Sbjct:    4 KKSDLFFKLLLIGDSGVGKTCIIFRFADNTFNPSFISTIGIDFKIKTLELGGKKIKLQIWDTAGQERFHTITTAYYRGAMGIMLVYDVTNEKSFSNISKWLKKIDDHANEDVKRMLVGNKCDMYDKRVISQTKGEQLASSYGISFIETSALSNINVEKSFVVLTEDI---------LNAVCPPTVEETEK 184          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO40167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S806])

HSP 1 Score: 224.172 bits (570), Expect = 1.367e-71
Identity = 100/173 (57.80%), Postives = 138/173 (79.77%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            M   YD+LFKLLLIGDSGVGK+ +L RF++D +  ++I+TIG+DFKIRTI+++GK IKLQIWDTAGQERFRTIT++YYRGA GI++VYDVT ++SFNN+ QW+  I ++A  +V K+L+GNK D+  ++ V   T +E A+S G+ F+ETSAK   NV++AF  +A +IKN+M
Sbjct:    4 MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYACENVNKLLVGNKCDLTTKKVVDFTTAKEYAESLGVPFLETSAKNATNVEQAFMTMAAEIKNRM 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Match: EDO42144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2G3])

HSP 1 Score: 214.542 bits (545), Expect = 8.796e-68
Identity = 96/173 (55.49%), Postives = 134/173 (77.46%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            M   YD+LFKLLLIGDSGVGK+S+L RF++D F+ T+I+TIG+DFKIRT+ ++GK IKLQIWDTAGQERFRT+TTAYYR A GI+L+YDV   ++F +++QW++ ++++A   V  +L+GNK D+ D RQV  +T +E A+   I F+ETSAK   NV+  FR +A ++K K+
Sbjct:    1 MNSEYDYLFKLLLIGDSGVGKSSLLLRFADDTFSNTYISTIGVDFKIRTLTVDGKTIKLQIWDTAGQERFRTLTTAYYRSAHGIVLIYDVNESETFLHLSQWLEEVSEYACEGVNTILVGNKCDLIDCRQVGYNTAKEFAEKLDISFIETSAKDSTNVESVFRTMAAELKAKL 173          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 285.034 bits (728), Expect = 7.904e-95
Identity = 143/209 (68.42%), Postives = 170/209 (81.34%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITK--ESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT VLFRF++D FN+TFI+TIGIDFKIRTID+NGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF NI  WI NI +HA+ADVE+M+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+  L G  P  S++  K  E  ++ +F F+C +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKK--LEGNNPQGSNQGVKITEQPKKSSF-FRCVLL 206          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: rab8a (ras-related protein Rab-8A [Source:NCBI gene;Acc:101170877])

HSP 1 Score: 284.648 bits (727), Expect = 9.656e-95
Identity = 140/208 (67.31%), Postives = 168/208 (80.77%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPP-TSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN+TFI+TIGIDFKIRTI+++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA++DVEKM+LGNK D+ND+RQV    G +LA  +GIKFMETSAK+  NV+ AF  LA DIK KM+  S L G  P  +SH +     +++   F+C +L
Sbjct:    4 MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNSTFISTIGIDFKIRTIELDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVEKMVLGNKCDINDKRQVTKMGGEKLALEYGIKFMETSAKSNINVENAFLTLARDIKTKMD--SKLEGNAPQGSSHGVKISEPQKKTSFFRCSLL 209          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: RAB8A (RAB8A, member RAS oncogene family [Source:NCBI gene;Acc:101161304])

HSP 1 Score: 279.256 bits (713), Expect = 6.213e-93
Identity = 133/176 (75.57%), Postives = 153/176 (86.93%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKR 584
            MAK YD+LFKLLLIGDSGVGKT VLFRF++D FN+TFI+TIGIDFKIRTID+NGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF NI  WI NI +HA+ADVE+M+LGNK D+ND+RQV  + G +LA  +GIKFMETSAK   NV+ AF  LA DIK KM+K+
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCVLFRFADDAFNSTFISTIGIDFKIRTIDLNGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFENIKNWIRNIEEHASADVERMVLGNKCDVNDRRQVSKERGEQLALEYGIKFMETSAKANINVENAFLTLARDIKAKMDKK 176          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: megf8 (RAB8B, member RAS oncogene family [Source:NCBI gene;Acc:101174994])

HSP 1 Score: 271.552 bits (693), Expect = 1.513e-89
Identity = 132/208 (63.46%), Postives = 163/208 (78.37%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSH-KITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED+FN TFI+TIGIDFKIRTI+++GK++KLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+ +EKSF+NI  WI NI +HA++DVEKM+LGNK DM D+RQV  D G +LA  + +KF+ETSAK+  NV+EAF  +A DI + +  ++            KIT +  +R  F FKC +L
Sbjct:    1 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDSFNTTFISTIGIDFKIRTIELDGKRVKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDICNEKSFDNIKNWIRNIEEHASSDVEKMILGNKCDMTDRRQVSKDRGEKLAIDYRVKFLETSAKSSLNVEEAFYTMARDILHNLNSKAGDGNGGGSGKPVKITDKKSKRIKF-FKCSVL 207          
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Match: ENSORLT00000044845.1 (ras-related protein Rab-8B [Source:NCBI gene;Acc:101162740])

HSP 1 Score: 273.092 bits (697), Expect = 2.696e-89
Identity = 133/207 (64.25%), Postives = 164/207 (79.23%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKT +LFRFSED FN TFI+TIGIDFKIRT+D++GKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD+T+EKSF+NI  WI NI +HA+ADVE+M+LGNK DMND+RQV  + G +LA  + IKF+ETSAK+  NV+EAF  LA DI +++ ++               KE + +++  F+C +L
Sbjct:   58 MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTVDLDGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVERMVLGNKCDMNDRRQVSKERGEKLAIDYSIKFLETSAKSSINVEEAFLTLARDIMSRLNRKMHNDSSAGGGGAIQIKEPRSKKSL-FRCLLL 263          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000026178.1 (SMESG000026178.1)

HSP 1 Score: 430.639 bits (1106), Expect = 3.323e-152
Identity = 207/207 (100.00%), Postives = 207/207 (100.00%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL
Sbjct:    1 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 207          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000030619.1 (SMESG000030619.1)

HSP 1 Score: 284.263 bits (726), Expect = 9.112e-95
Identity = 132/207 (63.77%), Postives = 166/207 (80.19%), Query Frame = 3
Query:   57 MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAFSFKCEIL 677
            MAK YD+LFKLLLIGDSGVGKTS+L RF+++ F+ +FI TIGIDFKI+T+D+ GKK+KLQ+WDTAGQERFRTITT+YYRGA GIMLVYDVTS  SFNNINQW+ NI +HAN+DVEKML+GNK+D+ND+R++  ++G ++AQ HGI F ETSAK+  NVD+AFR L ++IK K + R       P   HK+TKE  +R+   F C IL
Sbjct:    1 MAKDYDYLFKLLLIGDSGVGKTSLLVRFADETFSTSFITTIGIDFKIKTMDLEGKKVKLQVWDTAGQERFRTITTSYYRGATGIMLVYDVTSASSFNNINQWMQNIAEHANSDVEKMLIGNKSDLNDRREISRESGLKVAQEHGILFSETSAKSSDNVDQAFRMLTMEIKKKFDIRGQ-NAKAPENGHKLTKEPNKRKKKRFGCIIL 206          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000035214.1 (SMESG000035214.1)

HSP 1 Score: 233.032 bits (593), Expect = 1.203e-74
Identity = 107/171 (62.57%), Postives = 139/171 (81.29%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKM 575
            K YD LFKLLLIGDSGVGKT +LFR+++D F+ TFI+TIGIDFKI+TI++NGK+IKLQIWDTAGQERF TIT +YYRGAMGIMLVYDVT++KSF+NI++W+ NI  HA+  VEK+++ NK DM ++R V  D G  +A ++ + F+E SAKTG NV +AF +L + I  K+
Sbjct:    4 KSYDLLFKLLLIGDSGVGKTCLLFRYADDTFSTTFISTIGIDFKIKTIEMNGKRIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDVTNKKSFDNISKWLTNIQSHASESVEKLIVANKIDMEEKRVVTKDIGENIAVANKVSFLEVSAKTGVNVPQAFEKLTMAILAKV 174          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 231.106 bits (588), Expect = 6.433e-74
Identity = 107/176 (60.80%), Postives = 134/176 (76.14%), Query Frame = 3
Query:   63 KPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 590
            K YD LFKLLLIGDSGVGKT +LF + +  ++ T+I+TIGIDFKI+TI+I GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYD+T+ KSF NIN+W+ NI  HA+  VE +++ NK DM D+R V  + GRE A SH IK++ETSAK   N+ EAF +L + I  K  +  +
Sbjct:    4 KSYDMLFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDE 179          
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Match: SMESG000077710.1 (SMESG000077710.1)

HSP 1 Score: 225.328 bits (573), Expect = 9.026e-72
Identity = 104/171 (60.82%), Postives = 131/171 (76.61%), Query Frame = 3
Query:   78 LFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTIDINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNINQWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMETSAKTGQNVDEAFRQLALDIKNKMEKRSD 590
            LFKLLLIGDSGVGKT +LF + +  ++ T+I+TIGIDFKI+TI+I GKKIKLQIWDTAGQERF TIT +YYRGAMGIMLVYD+T+ KSF NIN+W+ NI  HA+  VE +++ NK DM D+R V  + GRE A SH IK++ETSAK   N+ EAF +L + I  K  +  +
Sbjct:    2 LFKLLLIGDSGVGKTCMLFSYVDGAYSPTYISTIGIDFKIKTIEIGGKKIKLQIWDTAGQERFHTITMSYYRGAMGIMLVYDITARKSFENINRWLGNIRTHASETVEVIIVANKCDMIDRRAVTEEEGREAAASHSIKYIETSAKASTNITEAFEELTMAILKKCPREDE 172          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-8A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB8A4.994e-9669.05RAB8A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B9.151e-9466.19RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
RAB8B3.078e-9173.30RAB8B, member RAS oncogene family [Source:HGNC Sym... [more]
AL358472.62.261e-8564.10novel protein[more]
RAB132.261e-8564.10RAB13, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-89.833e-8870.86RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-89.833e-8870.86RAB family; Rab8 [Source:UniProtKB/TrEMBL;Acc:G5E... [more]
rab-101.613e-8067.05Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-101.613e-8067.05Ras-related protein Rab-10 [Source:UniProtKB/Swis... [more]
rab-12.188e-6956.07RAB family [Source:UniProtKB/TrEMBL;Acc:Q9UAQ6][more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab81.439e-9165.87gene:FBgn0262518 transcript:FBtr0308833[more]
Rab81.439e-9165.87gene:FBgn0262518 transcript:FBtr0074921[more]
Rab104.052e-8267.82gene:FBgn0015789 transcript:FBtr0077337[more]
Rab16.854e-7055.19gene:FBgn0285937 transcript:FBtr0084104[more]
Rab81.714e-6461.68gene:FBgn0262518 transcript:FBtr0308832[more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a1.437e-9569.05RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a1.437e-9569.05RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
megf85.855e-9275.72multiple EGF-like-domains 8 [Source:ZFIN;Acc:ZDB-G... [more]
rab8b6.692e-9265.24RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8b6.692e-9265.24RAB8B, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clcn73.263e-9567.62chloride channel, voltage-sensitive 7 [Source:Xenb... [more]
pknox25.850e-9365.71PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox22.852e-8764.42PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox22.507e-8675.78PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
pknox26.313e-8675.78PBX/knotted 1 homeobox 2 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab8a6.370e-9770.00RAB8A, member RAS oncogene family [Source:MGI Symb... [more]
Rab8b2.971e-9466.19RAB8B, member RAS oncogene family [Source:MGI Symb... [more]
Rab138.486e-8561.50RAB13, member RAS oncogene family [Source:MGI Symb... [more]
Rab101.759e-8265.43RAB10, member RAS oncogene family [Source:MGI Symb... [more]
Rab1a4.674e-7057.23RAB1A, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35280|RAB8A_RAT4.456e-9670.00Ras-related protein Rab-8A OS=Rattus norvegicus OX... [more]
sp|P55258|RAB8A_MOUSE4.456e-9670.00Ras-related protein Rab-8A OS=Mus musculus OX=1009... [more]
sp|A4FV54|RAB8A_BOVIN1.394e-9569.05Ras-related protein Rab-8A OS=Bos taurus OX=9913 G... [more]
sp|Q4R5P1|RAB8A_MACFA2.398e-9569.05Ras-related protein Rab-8A OS=Macaca fascicularis ... [more]
sp|P61006|RAB8A_HUMAN2.398e-9569.05Ras-related protein Rab-8A OS=Homo sapiens OX=9606... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A7241.048e-9670.05Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A4S2LFY02.051e-9671.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A0N8JYY12.680e-9470.00Ras-related protein Rab-8A-like OS=Scleropages for... [more]
W4YMP88.836e-9468.75Uncharacterized protein OS=Strongylocentrotus purp... [more]
Q0PD501.321e-9370.00Rab8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=1[more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a4.634e-9669.05RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
megf83.646e-9566.82ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
rab8b1.233e-9164.25ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
rab131.936e-8259.42RAB13, member RAS oncogene family [Source:NCBI gen... [more]
RAB103.506e-8264.89RAB10, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab8a1.275e-9769.38RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab8a5.169e-8462.68RAB8A, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab1aa5.003e-7057.23RAB1A, member RAS oncogene family a [Source:ZFIN;A... [more]
rab3c1.441e-6353.80RAB3C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000010665.11.146e-6174.38pep scaffold:Pmarinus_7.0:GL482742:3398:12039:1 ge... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SEC41.716e-7160.22Rab family GTPase; essential for vesicle-mediated ... [more]
YPT12.283e-6551.98Rab family GTPase; involved in the ER-to-Golgi ste... [more]
YPT323.937e-5749.44Rab family GTPase involved in the exocytic pathway... [more]
YPT312.073e-5648.84Rab family GTPase; involved in the exocytic pathwa... [more]
YPT65.546e-4243.75Rab family GTPase; required for endosome-to-Golgii... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO410181.218e-9568.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474713.216e-8568.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408451.415e-7660.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401671.367e-7157.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421448.796e-6855.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB8A7.904e-9568.42RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
rab8a9.656e-9567.31ras-related protein Rab-8A [Source:NCBI gene;Acc:1... [more]
RAB8A6.213e-9375.57RAB8A, member RAS oncogene family [Source:NCBI gen... [more]
megf81.513e-8963.46RAB8B, member RAS oncogene family [Source:NCBI gen... [more]
ENSORLT00000044845.12.696e-8964.25ras-related protein Rab-8B [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Ras-related protein Rab-8A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026178.13.323e-152100.00SMESG000026178.1[more]
SMESG000030619.19.112e-9563.77SMESG000030619.1[more]
SMESG000035214.11.203e-7462.57SMESG000035214.1[more]
SMESG000077710.16.433e-7460.80SMESG000077710.1[more]
SMESG000077710.19.026e-7260.82SMESG000077710.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005697 ID=SMED30005697|Name=Ras-related protein Rab-8A|organism=Schmidtea mediterranea sexual|type=transcript|length=1331bp
GAATTATTTTAATTTAATTTAATAAACTATAGCAGTTATTTAATTTTAAT
TATTTTATGGCGAAACCTTACGACCATCTTTTTAAATTGTTACTTATTGG
AGATTCAGGAGTAGGAAAAACGAGTGTTTTATTTCGATTTTCTGAAGATA
ATTTTAATGCCACGTTTATTGCAACTATCGGCATTGATTTTAAAATTCGC
ACAATTGACATAAATGGTAAAAAAATTAAACTTCAAATATGGGACACTGC
TGGACAAGAACGCTTCCGAACTATTACTACTGCATATTATCGCGGTGCAA
TGGGAATAATGCTTGTTTATGATGTGACTAGCGAGAAATCTTTCAATAAT
ATCAACCAATGGATTGATAATATCACTCAACATGCCAATGCCGACGTTGA
AAAAATGTTACTAGGAAATAAAGCTGACATGAATGACCAAAGACAAGTAC
CAACTGATACTGGTCGAGAATTGGCTCAGTCTCATGGCATCAAATTTATG
GAAACAAGTGCTAAAACTGGGCAAAATGTAGATGAAGCATTCAGACAGTT
AGCTTTAGATATCAAAAATAAAATGGAAAAAAGATCTGATTTGACTGGAG
TCGTTCCGCCAACTTCTCACAAAATTACAAAGGAAAGTAAACGCAGACGG
GCTTTTTCATTTAAATGTGAAATTTTGTAGAAAAATTGAATCTTGGAAAA
ATTTATTGAATATTGTTTTTTATACAAAAAAATGTGAATTTGAAAAGTTG
CTTTGATATTTTGTCTTTAAGATGATGATGCTGATTAGTGAATTATTAAA
TTAACAAATTGATTTATTTAAATTTAGAGTTGAAATCGGTTTATTTTTTT
AATATTCAAAGGCAATATTAAGATTGTATTAGGCATGAATTATATTGAAA
TCTTTTATTTAATATATAACACTTTGCCTGCTCTTTTTCTGTAGCATGTT
GGGAAACAAAAAATGTACATACAATTGGTTCTATAAATATTTTTCGAAAG
TTTCTTATTTTCTGGGACTTGAAACATTGGTTTAGAAAAAAAGCTTTTTC
AATTTAATGCATGTATTTTTTGTTGAATTTAGATTTTTTTATTTTTTGAT
GACTTTATAAATTTTAATTATAGGCAATTTATTTTATTAATTTGATATTG
ATTTCATTTTATTAAATTTATTATTTAAATCTCAATTCCGGAATGGAAGC
GCTTAATCAAGCCGTTTGTAGATATTTTATTGTCTAAAATAAATCGGTTC
AGTGGATAATTTTCGTTGTAGAAATTTTGTTGGATTATAAAATAATCATT
TCATAATCCATGGACAATAATGAGAAAAATT
back to top

protein sequence of SMED30005697-orf-1

>SMED30005697-orf-1 ID=SMED30005697-orf-1|Name=SMED30005697-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
MAKPYDHLFKLLLIGDSGVGKTSVLFRFSEDNFNATFIATIGIDFKIRTI
DINGKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDVTSEKSFNNIN
QWIDNITQHANADVEKMLLGNKADMNDQRQVPTDTGRELAQSHGIKFMET
SAKTGQNVDEAFRQLALDIKNKMEKRSDLTGVVPPTSHKITKESKRRRAF
SFKCEIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006914autophagy
GO:0010506regulation of autophagy
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006904vesicle docking involved in exocytosis
GO:0007409axonogenesis
GO:0009306protein secretion
GO:0015031protein transport
GO:0030030cell projection organization
GO:0032869cellular response to insulin stimulus
GO:0032880regulation of protein localization
GO:0042593glucose homeostasis
GO:0046326positive regulation of glucose import
GO:0048169regulation of long-term neuronal synaptic plasticity
GO:0048210Golgi vesicle fusion to target membrane
GO:0051223regulation of protein transport
GO:0060271cilium morphogenesis
GO:0061024membrane organization
GO:0072659protein localization to plasma membrane
GO:0098969neurotransmitter receptor transport to postsynaptic membrane
Vocabulary: molecular function
TermDefinition
GO:0017137Rab GTPase binding
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0003924GTPase activity
GO:0019003GDP binding
GO:0019901protein kinase binding
GO:0031489myosin V binding
Vocabulary: cellular component
TermDefinition
GO:0030496midbody
GO:0005737cytoplasm
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005814centriole
GO:0005856cytoskeleton
GO:0005886plasma membrane
GO:0005929cilium
GO:0008021synaptic vesicle
GO:0014069postsynaptic density
GO:0016020membrane
GO:0030140trans-Golgi network transport vesicle
GO:0030425dendrite
GO:0030659cytoplasmic vesicle membrane
GO:0030670phagocytic vesicle membrane
GO:0031012extracellular matrix
GO:0031410cytoplasmic vesicle
GO:0036064ciliary basal body
GO:0042995cell projection
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0045335phagocytic vesicle
GO:0055037recycling endosome
GO:0055038recycling endosome membrane
GO:0070062extracellular exosome
GO:0097546ciliary base
GO:0097730non-motile cilium
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 32..48
score: 32.87
coord: 50..72
score: 55.12
coord: 112..125
score: 42.7
coord: 147..169
score: 45.74
coord: 9..30
score: 50.32
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 11..172
e-value: 1.9E-13
score: 52.1
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 14..207
e-value: 4.6E-5
score: 22.8
NoneNo IPR availableSMARTSM00177arf_sub_2coord: 1..173
e-value: 3.1E-4
score: 13.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 9..172
e-value: 4.4E-106
score: 368.4
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 6..172
e-value: 8.2E-33
score: 125.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..201
e-value: 4.0E-70
score: 237.2
NoneNo IPR availablePANTHERPTHR24073:SF22RAS-RELATED PROTEIN RAB-8Bcoord: 2..181
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 2..181
NoneNo IPR availablePROSITEPS51419RABcoord: 4..204
score: 36.856
NoneNo IPR availableCDDcd01867Rab8_Rab10_Rab13_likecoord: 6..172
e-value: 2.01805E-112
score: 316.132
IPR001806Small GTPasePFAMPF00071Rascoord: 10..169
e-value: 2.7E-65
score: 218.9
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 9..163
e-value: 8.1E-32
score: 108.2
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 4..178