Heterogeneous nuclear ribonucleoprotein,putative

Overview
NameHeterogeneous nuclear ribonucleoprotein,putative
Smed IDSMED30005694
Length (bp)2434
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Heterogeneous nuclear ribonucleoprotein,putative (SMED30005694) t-SNE clustered cells

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein,putative (SMED30005694) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Heterogeneous nuclear ribonucleoprotein,putative (SMED30005694) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Heterogeneous nuclear ribonucleoprotein,putative (SMED30005694) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005694

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30005694SMESG000029158.1 dd_Smed_v4_3582_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005694SMESG000029158.1 dd_Smed_v4_3582_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005694SMESG000029158.1 dd_Smed_v4_3582_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005694SMESG000078437.1 Contig4190GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005694SMESG000029158.1 Contig4190GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30005694SMESG000029158.1 Contig42777newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30005694SMESG000029158.1 Contig42777uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 188.348 bits (477), Expect = 4.185e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 188.348 bits (477), Expect = 4.185e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 188.348 bits (477), Expect = 4.185e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 188.348 bits (477), Expect = 4.185e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Match: HNRNPDL (heterogeneous nuclear ribonucleoprotein D like [Source:HGNC Symbol;Acc:HGNC:5037])

HSP 1 Score: 188.348 bits (477), Expect = 4.185e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 140.969 bits (354), Expect = 1.225e-36
Identity = 80/242 (33.06%), Postives = 125/242 (51.65%), Query Frame = 3
Query:   87 MSAVINNNFAPIVNMVDCRP----HGDCEININDN----LADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE-----QANRSKGWKGTNNNMFFPYTMLPY 755
            M+  ++     +  + +  P    H +  +N + +     + D  K+F+GGLSW+T+ ++LR YF  FG V  C++  D  T  +RGFGF+ F    +V+KVL  +EH L+ KKIDPK A P R         KKVF+GGL    +   +K+YF  +G++E+    FD    + + + F+TF ++  A K       EI+GK  E + A P+E     Q N+S+     N     P T+L Y
Sbjct:    1 MTTTVSTGATAVATLRETSPPVDGHEEARLNADSDDGSHGSQDPGKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPKVAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPKEVMLPVQLNKSRAAAARNLYGMPPETLLAY 242          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 125.946 bits (315), Expect = 1.582e-31
Identity = 70/190 (36.84%), Postives = 109/190 (57.37%), Query Frame = 3
Query:  123 VNMVDCRPHGDCEININDN----LADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            +   D + +G+    I +N      ++ +KIFVGG+S E + +DL  +F+++G V    +K DR    SRGF FV F + +     L  +E  +  K ++ K AK SRE  KKVFVGGL  D SE  ++ +F QFG++++IE PFD +   R+ + FI F  E  A KA+SQ  Q    ++ +V+ A+P+
Sbjct:    1 MEATDNKINGNASETIKENGHSTKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAK-SRE-NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 125.946 bits (315), Expect = 1.582e-31
Identity = 70/190 (36.84%), Postives = 109/190 (57.37%), Query Frame = 3
Query:  123 VNMVDCRPHGDCEININDN----LADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            +   D + +G+    I +N      ++ +KIFVGG+S E + +DL  +F+++G V    +K DR    SRGF FV F + +     L  +E  +  K ++ K AK SRE  KKVFVGGL  D SE  ++ +F QFG++++IE PFD +   R+ + FI F  E  A KA+SQ  Q    ++ +V+ A+P+
Sbjct:    1 MEATDNKINGNASETIKENGHSTKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAK-SRE-NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 125.946 bits (315), Expect = 1.582e-31
Identity = 70/190 (36.84%), Postives = 109/190 (57.37%), Query Frame = 3
Query:  123 VNMVDCRPHGDCEININDN----LADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            +   D + +G+    I +N      ++ +KIFVGG+S E + +DL  +F+++G V    +K DR    SRGF FV F + +     L  +E  +  K ++ K AK SRE  KKVFVGGL  D SE  ++ +F QFG++++IE PFD +   R+ + FI F  E  A KA+SQ  Q    ++ +V+ A+P+
Sbjct:    1 MEATDNKINGNASETIKENGHSTKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAK-SRE-NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 125.946 bits (315), Expect = 1.582e-31
Identity = 70/190 (36.84%), Postives = 109/190 (57.37%), Query Frame = 3
Query:  123 VNMVDCRPHGDCEININDN----LADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            +   D + +G+    I +N      ++ +KIFVGG+S E + +DL  +F+++G V    +K DR    SRGF FV F + +     L  +E  +  K ++ K AK SRE  KKVFVGGL  D SE  ++ +F QFG++++IE PFD +   R+ + FI F  E  A KA+SQ  Q    ++ +V+ A+P+
Sbjct:    1 MEATDNKINGNASETIKENGHSTKGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPAK-SRE-NKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082854)

HSP 1 Score: 158.303 bits (399), Expect = 1.452e-42
Identity = 75/165 (45.45%), Postives = 109/165 (66.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            DD RK+FVGGLSWET+E +LR +F ++G ++S  +K D  T  SRGF F++F + + ++KV    EHI+N KK+DPK+AK       K+FVGGL  ++S+  IK YF QFG I  +E PFD +K++RK + FITF +E           Q+I+GK+ +V+ A P+
Sbjct:   53 DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKARH---GKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 4.216e-7
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            A   R+  +K+FVGGL  + +E  ++++F ++GEIE+I    D +  + + + FI F+N     K ++ +   I+ KK + + A  R
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR 134          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0309094)

HSP 1 Score: 157.918 bits (398), Expect = 1.637e-42
Identity = 75/165 (45.45%), Postives = 109/165 (66.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            DD RK+FVGGLSWET+E +LR +F ++G ++S  +K D  T  SRGF F++F + + ++KV    EHI+N KK+DPK+AK       K+FVGGL  ++S+  IK YF QFG I  +E PFD +K++RK + FITF +E           Q+I+GK+ +V+ A P+
Sbjct:   53 DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 3.858e-7
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            A   R+  +K+FVGGL  + +E  ++++F ++GEIE+I    D +  + + + FI F+N     K ++ +   I+ KK + + A  R
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR 134          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082856)

HSP 1 Score: 157.918 bits (398), Expect = 1.637e-42
Identity = 75/165 (45.45%), Postives = 109/165 (66.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            DD RK+FVGGLSWET+E +LR +F ++G ++S  +K D  T  SRGF F++F + + ++KV    EHI+N KK+DPK+AK       K+FVGGL  ++S+  IK YF QFG I  +E PFD +K++RK + FITF +E           Q+I+GK+ +V+ A P+
Sbjct:   53 DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 3.858e-7
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            A   R+  +K+FVGGL  + +E  ++++F ++GEIE+I    D +  + + + FI F+N     K ++ +   I+ KK + + A  R
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR 134          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: sqd (gene:FBgn0263396 transcript:FBtr0082855)

HSP 1 Score: 157.918 bits (398), Expect = 3.603e-42
Identity = 75/165 (45.45%), Postives = 109/165 (66.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            DD RK+FVGGLSWET+E +LR +F ++G ++S  +K D  T  SRGF F++F + + ++KV    EHI+N KK+DPK+AK       K+FVGGL  ++S+  IK YF QFG I  +E PFD +K++RK + FITF +E           Q+I+GK+ +V+ A P+
Sbjct:   53 DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR---HGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPK 214          

HSP 2 Score: 53.5286 bits (127), Expect = 4.449e-7
Identity = 26/87 (29.89%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            A   R+  +K+FVGGL  + +E  ++++F ++GEIE+I    D +  + + + FI F+N     K ++ +   I+ KK + + A  R
Sbjct:   48 ASGQRDDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADEHIINSKKVDPKKAKAR 134          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Match: msi (gene:FBgn0011666 transcript:FBtr0333665)

HSP 1 Score: 143.28 bits (360), Expect = 1.517e-35
Identity = 72/167 (43.11%), Postives = 95/167 (56.89%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ-----KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            K+FVGGLSW+TS D L++YF+ FG V   +I  D  T  SRGFGF+ F    TV KVL++  H L+ KKIDPK A P   P+     KK+FVGG+  D S   +K YFSQFG +E      D +  + + + F+TF NE    +        I  KK E + A P+E
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKE 303          

HSP 2 Score: 90.5077 bits (223), Expect = 2.011e-18
Identity = 42/106 (39.62%), Postives = 71/106 (66.98%), Query Frame = 3
Query:  183 ADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-------SREPQKKVFVGGLDPDL 479
            A+ ++KIFVGG+S +TS ++++ YFS+FG V+  ++ +D+ T   RGFGFV F++ED V++V EI  H +  KK++ K+A+P       ++  QK++ +G L   L
Sbjct:  220 ANKTKKIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTLGVQL 325          

HSP 3 Score: 50.0618 bits (118), Expect = 7.625e-6
Identity = 28/88 (31.82%), Postives = 43/88 (48.86%), Query Frame = 3
Query:  447 KVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR---EQANRSK 701
            K+FVGGL    S   +KEYF+ FG + ++    D    + + + FITF       K        + GKK + + A P+    QAN++K
Sbjct:  137 KLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVEKVLKVPIHTLDGKKIDPKHATPKNRPRQANKTK 224          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/Bb [Source:ZFIN;Acc:ZDB-GENE-040426-2516])

HSP 1 Score: 179.489 bits (454), Expect = 4.181e-50
Identity = 84/167 (50.30%), Postives = 119/167 (71.26%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F   D+V++VL+ KEH L+ ++IDPKRA    +EP KK+FVGGL+P+ +E  I+EYF  FGEIE IE P D + +KR+ ++FITF  E   +K   ++   + G K E++IA P+E
Sbjct:   42 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKE 208          

HSP 2 Score: 65.4698 bits (158), Expect = 6.297e-11
Identity = 43/132 (32.58%), Postives = 71/132 (53.79%), Query Frame = 3
Query:   69 GFVIFVMSAVINNNFAPIVNMVDCRPHGDCEININDNLA---DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVF 455
            GF++F  S  ++       + +D R     +I+    +A   +  +KIFVGGL+ ET+E+ +R+YF  FG +++  +  D  T+  RGF F+ F  E  V K+LE K H +   K + K A+P    Q++ F
Sbjct:   89 GFILFKESDSVDRVLQQKEHRLDGR-----QIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKEIYQQQQF 215          

HSP 3 Score: 49.6766 bits (117), Expect = 9.165e-6
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVR--IAIPRE 683
            A    E   K+FVGGL  D S+  +K+YFS+FGE+ +     D+   + + + FI F       +   Q+   + G++ + +  +AI +E
Sbjct:   37 ASKCEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKE 126          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/Bb [Source:ZFIN;Acc:ZDB-GENE-040426-2516])

HSP 1 Score: 179.489 bits (454), Expect = 4.181e-50
Identity = 84/167 (50.30%), Postives = 119/167 (71.26%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F   D+V++VL+ KEH L+ ++IDPKRA    +EP KK+FVGGL+P+ +E  I+EYF  FGEIE IE P D + +KR+ ++FITF  E   +K   ++   + G K E++IA P+E
Sbjct:   42 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKE 208          

HSP 2 Score: 65.4698 bits (158), Expect = 6.297e-11
Identity = 43/132 (32.58%), Postives = 71/132 (53.79%), Query Frame = 3
Query:   69 GFVIFVMSAVINNNFAPIVNMVDCRPHGDCEININDNLA---DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVF 455
            GF++F  S  ++       + +D R     +I+    +A   +  +KIFVGGL+ ET+E+ +R+YF  FG +++  +  D  T+  RGF F+ F  E  V K+LE K H +   K + K A+P    Q++ F
Sbjct:   89 GFILFKESDSVDRVLQQKEHRLDGR-----QIDPKRAMAIKKEPVKKIFVGGLNPETTEEKIREYFGSFGEIETIELPTDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKEIYQQQQF 215          

HSP 3 Score: 49.6766 bits (117), Expect = 9.165e-6
Identity = 26/90 (28.89%), Postives = 46/90 (51.11%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVR--IAIPRE 683
            A    E   K+FVGGL  D S+  +K+YFS+FGE+ +     D+   + + + FI F       +   Q+   + G++ + +  +AI +E
Sbjct:   37 ASKCEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVLQQKEHRLDGRQIDPKRAMAIKKE 126          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 178.333 bits (451), Expect = 8.891e-50
Identity = 92/190 (48.42%), Postives = 124/190 (65.26%), Query Frame = 3
Query:  144 PHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIP----REQANR 695
            P G  +IN + N  DD  K+F+GGLSW+TS+ DL  Y S FG V  C IK D  T  SRGFGFV+F   ++V++VLE+ EH L+ K IDPKRAK    +EP KKVFVGGL PD++E  ++EYF  +GEIE+IE P DT+ N+R+ + F+TF+ E   +K       +I   K E+++A P    R+Q NR
Sbjct:   15 PEG-SKINASKNQEDDG-KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKEVYRQQQNR 202          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 178.333 bits (451), Expect = 8.891e-50
Identity = 92/190 (48.42%), Postives = 124/190 (65.26%), Query Frame = 3
Query:  144 PHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIP----REQANR 695
            P G  +IN + N  DD  K+F+GGLSW+TS+ DL  Y S FG V  C IK D  T  SRGFGFV+F   ++V++VLE+ EH L+ K IDPKRAK    +EP KKVFVGGL PD++E  ++EYF  +GEIE+IE P DT+ N+R+ + F+TF+ E   +K       +I   K E+++A P    R+Q NR
Sbjct:   15 PEG-SKINASKNQEDDG-KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKEVYRQQQNR 202          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:ZFIN;Acc:ZDB-GENE-040426-2717])

HSP 1 Score: 178.333 bits (451), Expect = 8.891e-50
Identity = 92/190 (48.42%), Postives = 124/190 (65.26%), Query Frame = 3
Query:  144 PHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIP----REQANR 695
            P G  +IN + N  DD  K+F+GGLSW+TS+ DL  Y S FG V  C IK D  T  SRGFGFV+F   ++V++VLE+ EH L+ K IDPKRAK    +EP KKVFVGGL PD++E  ++EYF  +GEIE+IE P DT+ N+R+ + F+TF+ E   +K       +I   K E+++A P    R+Q NR
Sbjct:   15 PEG-SKINASKNQEDDG-KMFIGGLSWDTSKKDLTDYLSRFGEVLDCTIKTDPLTGRSRGFGFVLFKDAESVDRVLELTEHKLDGKLIDPKRAKAIKGKEPPKKVFVGGLSPDITEEQLREYFGVYGEIESIELPTDTKTNERRGFCFVTFALEEPVQKLLENRYHQIGSGKCEIKVAQPKEVYRQQQNR 202          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: h2bc21 (H2B clustered histone 21 [Source:Xenbase;Acc:XB-GENE-6452473])

HSP 1 Score: 179.489 bits (454), Expect = 2.796e-50
Identity = 89/177 (50.28%), Postives = 118/177 (66.67%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  D+  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE KEH L+ K IDPKRAK    +EP KKVFVGGL P+ +E  IK+YF  FGEIENIE P DT+ N+R+ + F+T++ E   +K       +I   K E+++A P+E
Sbjct:   15 KINASKNQQDEG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 190          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: h2bc21 (H2B clustered histone 21 [Source:Xenbase;Acc:XB-GENE-6452473])

HSP 1 Score: 179.874 bits (455), Expect = 2.906e-50
Identity = 89/177 (50.28%), Postives = 118/177 (66.67%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  D+  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE KEH L+ K IDPKRAK    +EP KKVFVGGL P+ +E  IK+YF  FGEIENIE P DT+ N+R+ + F+T++ E   +K       +I   K E+++A P+E
Sbjct:   15 KINASKNQQDEG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 190          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: h2bc21 (H2B clustered histone 21 [Source:Xenbase;Acc:XB-GENE-6452473])

HSP 1 Score: 179.489 bits (454), Expect = 5.057e-50
Identity = 91/189 (48.15%), Postives = 122/189 (64.55%), Query Frame = 3
Query:  123 VNMVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
             N++ C      +IN + N  D+  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE KEH L+ K IDPKRAK    +EP KKVFVGGL P+ +E  IK+YF  FGEIENIE P DT+ N+R+ + F+T++ E   +K       +I   K E+++A P+E
Sbjct:   18 ANIIFC-----SKINASKNQQDEG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 200          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: adam17 (ADAM metallopeptidase domain 17 [Source:Xenbase;Acc:XB-GENE-492534])

HSP 1 Score: 178.718 bits (452), Expect = 8.534e-50
Identity = 87/176 (49.43%), Postives = 118/176 (67.05%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGW 707
            +D  K+F+GGLSW+T++ DL+ YFS+FG V  C +KLD  T  SRGFGFV+F   + V+KV+E KEH LN K IDPKRAK   ++EP KK+FVGGL PD  E  I+EYF  FGEIE IE P D + NKR+ + FITF  E   +K   ++   +   K E+++A+ +EQ  + + W
Sbjct:   35 EDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESEGVDKVMEQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPVKKIMEKKYHNVGLSKCEIKVALSKEQYQQQQQW 210          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Match: cep112 (centrosomal protein 112kDa [Source:Xenbase;Acc:XB-GENE-6047288])

HSP 1 Score: 177.178 bits (448), Expect = 1.150e-49
Identity = 85/167 (50.90%), Postives = 117/167 (70.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F    +V+KVLE KEH L+ + IDPK+A    ++P KK+FVGGL+P+  E  I+EYF  FGEIE IE P D + NKR+ ++FITF  E   +K   ++   +SG K E++IA P+E
Sbjct:   49 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKDPIKKIFVGGLNPEAGEDKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPKE 215          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:MGI Symbol;Acc:MGI:1355299])

HSP 1 Score: 188.734 bits (478), Expect = 3.480e-53
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   40 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 215          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:MGI Symbol;Acc:MGI:1355299])

HSP 1 Score: 189.889 bits (481), Expect = 1.290e-52
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:  137 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 312          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpdl (heterogeneous nuclear ribonucleoprotein D-like [Source:MGI Symbol;Acc:MGI:1355299])

HSP 1 Score: 189.889 bits (481), Expect = 1.290e-52
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:  137 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 312          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpab (heterogeneous nuclear ribonucleoprotein A/B [Source:MGI Symbol;Acc:MGI:1330294])

HSP 1 Score: 177.563 bits (449), Expect = 1.019e-49
Identity = 86/176 (48.86%), Postives = 123/176 (69.89%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  +D+ K+FVGGLSW+TS+ DL+ YF++FG V  C IK+D  T  SRGFGF++F    +V KVL+ KEH L+ + IDPK+A    ++P KK+FVGGL+P+ +E  I+EYF QFGEIE IE P D + NKR+ ++FITF  E   +K   ++   +SG K E+++A P+E
Sbjct:   64 QINASKN-EEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDSSSVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKRRGFVFITFKEEDPVKKVLEKKFHTVSGSKCEIKVAQPKE 238          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Match: Hnrnpd (heterogeneous nuclear ribonucleoprotein D [Source:MGI Symbol;Acc:MGI:101947])

HSP 1 Score: 177.563 bits (449), Expect = 1.328e-49
Identity = 85/176 (48.30%), Postives = 120/176 (68.18%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGW 707
            +D  K+F+GGLSW+T++ DL+ YFS+FG V  C +KLD  T  SRGFGFV+F   ++V+KV++ KEH LN K IDPKRAK   ++EP KK+FVGGL PD  E  I+EYF  FGE+E+IE P D + NKR+ + FITF  E   +K   ++   +   K E+++A+ +EQ  + + W
Sbjct:   75 EDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQW 250          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q5ZI72|HNRDL_CHICK (Heterogeneous nuclear ribonucleoprotein D-like OS=Gallus gallus OX=9031 GN=HNRNPDL PE=2 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.950e-52
Identity = 94/177 (53.11%), Postives = 119/177 (67.23%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   19 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVEKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 194          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q9Z130|HNRDL_MOUSE (Heterogeneous nuclear ribonucleoprotein D-like OS=Mus musculus OX=10090 GN=Hnrnpdl PE=1 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 2.030e-52
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   18 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 193          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|O14979|HNRDL_HUMAN (Heterogeneous nuclear ribonucleoprotein D-like OS=Homo sapiens OX=9606 GN=HNRNPDL PE=1 SV=3)

HSP 1 Score: 189.889 bits (481), Expect = 1.006e-51
Identity = 94/177 (53.11%), Postives = 120/177 (67.80%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  DD  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:  137 KINASKNQQDDG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 312          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q3SWU3|HNRDL_RAT (Heterogeneous nuclear ribonucleoprotein D-like OS=Rattus norvegicus OX=10116 GN=Hnrnpdl PE=1 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 4.822e-51
Identity = 89/164 (54.27%), Postives = 113/164 (68.90%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE+KEH L+ K IDPKRAK    +EP KKVFVGGL PD SE  IKEYF  FGEIENIE P DT+ N+R+ + FIT+++E   +K       +I   K E+++A P+E
Sbjct:   52 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQPKE 215          

HSP 2 Score: 68.1662 bits (165), Expect = 5.874e-11
Identity = 31/78 (39.74%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            +K+FVGGLS +TSE+ +++YF  FG +++  + +D  TN  RGF F+ +  E+ V K+LE + H +   K + K A+P
Sbjct:  136 KKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQP 213          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Match: sp|Q640A2|HNRDL_XENTR (Heterogeneous nuclear ribonucleoprotein D-like OS=Xenopus tropicalis OX=8364 GN=hnrnpdl PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 1.540e-49
Identity = 89/177 (50.28%), Postives = 118/177 (66.67%), Query Frame = 3
Query:  159 EININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +IN + N  D+  K+F+GGLSW+TS+ DL +Y S FG V  C IK D  T  SRGFGFV+F    +V+KVLE KEH L+ K IDPKRAK    +EP KKVFVGGL P+ +E  IK+YF  FGEIENIE P DT+ N+R+ + F+T++ E   +K       +I   K E+++A P+E
Sbjct:   15 KINASKNQQDEG-KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKLDGKLIDPKRAKALKGKEPPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNERRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKE 190          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: C1LIX0 (Heterogeneous nuclear ribonucleoprotein D0 OS=Schistosoma japonicum OX=6182 GN=hnRNP-D0 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 2.464e-71
Identity = 119/225 (52.89%), Postives = 163/225 (72.44%), Query Frame = 3
Query:   99 INNNFAPIVNMVDC--RPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQD 767
            +N N    ++ +DC  +P      ++ D   DDSRK+FVGGLSWET+E DL++YFS +G V  CIIKLDR+T +SRGFGFV  +SED V+KVL + EH L  KKIDPK+AKPSREP +K+FVGG+DP+++E  I+EYFS FG++E+++ P+DT+K KRK Y+F++FS E+ ARKA S+E QEI G++ +VR+A+ R+QANR K  K   N     Y+   Y Y D
Sbjct:   25 LNENSPDPLSPLDCDEKPTNGAGDSVTDENDDDSRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKALKQWYNWFDPSYSYPGYAYGD 249          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: A0A4Z2CMS8 (Heterogeneous nuclear ribonucleoprotein A/B isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_009235 PE=4 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 8.245e-71
Identity = 120/226 (53.10%), Postives = 164/226 (72.57%), Query Frame = 3
Query:   99 INNNFAPIVNMVDC--RPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFP-YTMLPYMYQD 767
            +N N    ++ +DC  +P      ++ D   DDSRK+FVGGLSWET+E DL++YFS +G V  CIIKLDR+T +SRGFGFV  +SED V+KVL + EH L  KKIDPK+AKPSREP +K+FVGG+DP+++E  I+EYFS FG++E+++ P+DT+K KRK Y+F++FS E+ ARKA S+E QEI G++ +VR+A+ R+QANR K       N F P Y+   Y Y D
Sbjct:   25 LNENSPDPLSPLDCDEKPTNGAGDSVTDENDDDSRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKVALKQWYNWFDPSYSYPGYAYGD 250          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: A0A4Z2CMJ4 (Heterogeneous nuclear ribonucleoprotein A/B isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_009235 PE=4 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 8.578e-71
Identity = 120/226 (53.10%), Postives = 164/226 (72.57%), Query Frame = 3
Query:   99 INNNFAPIVNMVDC--RPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFP-YTMLPYMYQD 767
            +N N    ++ +DC  +P      ++ D   DDSRK+FVGGLSWET+E DL++YFS +G V  CIIKLDR+T +SRGFGFV  +SED V+KVL + EH L  KKIDPK+AKPSREP +K+FVGG+DP+++E  I+EYFS FG++E+++ P+DT+K KRK Y+F++FS E+ ARKA S+E QEI G++ +VR+A+ R+QANR K       N F P Y+   Y Y D
Sbjct:   25 LNENSPDPLSPLDCDEKPTNGAGDSVTDENDDDSRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKVALKQWYNWFDPSYSYPGYAYGD 250          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: Q5DH48 (Heterogeneous nuclear ribonucleoprotein D0 OS=Schistosoma japonicum OX=6182 GN=hnRNP-D0 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 8.593e-71
Identity = 120/226 (53.10%), Postives = 164/226 (72.57%), Query Frame = 3
Query:   99 INNNFAPIVNMVDC--RPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFP-YTMLPYMYQD 767
            +N N    ++ +DC  +P      ++ D   DDSRK+FVGGLSWET+E DL++YFS +G V  CIIKLDR+T +SRGFGFV  +SED V+KVL + EH L  KKIDPK+AKPSREP +K+FVGG+DP+++E  I+EYFS FG++E+++ P+DT+K KRK Y+F++FS E+ ARKA S+E QEI G++ +VR+A+ R+QANR K       N F P Y+   Y Y D
Sbjct:   25 LNENSPDPLSPLDCDEKPTNGAGDSVTDENDDDSRKLFVGGLSWETNESDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVSEHWLKNKKIDPKKAKPSREPLRKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAARKAISKERQEIFGRQCDVRVAVTRDQANRHKVALKQWYNWFDPSYSYPGYAYGD 250          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Match: G4LYB8 (Heterogeneous nuclear ribonucleoprotein,putative OS=Schistosoma mansoni OX=6183 GN=Smp_056810.3 PE=4 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 2.822e-70
Identity = 115/214 (53.74%), Postives = 161/214 (75.23%), Query Frame = 3
Query:  132 VDC--RPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQD 767
            +DC  +P    + ++ D   DDSRK+FVGGLSWET+E+DL++YFS +G V  CIIKLDR+T +SRGFGFV  +SED V+KVL + EH L  KKIDPK+AKPSREP KK+FVGG+DP+++E  I+EYFS FG++E+++ P+DT+K KRK Y+F++FS E+ A+KA S+E Q+I G++ +VR+A+ R+QANR K  K   N +   ++   Y Y D
Sbjct:   28 LDCDEKPTNGADDSVTDENDDDSRKLFVGGLSWETNENDLKEYFSRWGKVTQCIIKLDRFTGNSRGFGFVTLESEDCVSKVLSVPEHWLKNKKIDPKKAKPSREPLKKIFVGGIDPEVTEDQIREYFSSFGKVESLDLPYDTQKGKRKHYIFVSFSTEAAAKKAISKERQDIFGRQCDVRVAVTRDQANRQKALKQWYNWLDPNFSYPGYAYGD 241          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 180.259 bits (456), Expect = 2.507e-50
Identity = 84/167 (50.30%), Postives = 120/167 (71.86%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F    +V KVL+ KEH L+ ++IDPK+A    ++P KK+FVGGL+P+ +E  I+EYF  FGEIE+IE P D + NKR+ ++FITF  ES  +K   ++   ++G K E++IA P+E
Sbjct:   50 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPKE 216          

HSP 2 Score: 75.0998 bits (183), Expect = 3.684e-14
Identity = 44/123 (35.77%), Postives = 68/123 (55.28%), Query Frame = 3
Query:   69 GFVIFVMSAVINNNFAPIVNMVDCRPHGDCEININDNLA---DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            GF++F  +A +        + +D R     +I+    +A   D  +KIFVGGL+ ET+E+ +R+YF  FG ++S  +  D  TN  RGF F+ F  E  V K++E K H +N  K + K A+P
Sbjct:   97 GFILFKEAASVEKVLQQKEHRLDGR-----QIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQP 214          

HSP 3 Score: 53.9138 bits (128), Expect = 3.352e-7
Identity = 26/85 (30.59%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            A  S E   K+FVGGL  D S+  +K+YFS+FGE+ +     D+   + + + FI F   +   K   Q+   + G++ + + A+
Sbjct:   45 ASKSEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAM 129          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 180.259 bits (456), Expect = 5.299e-50
Identity = 84/167 (50.30%), Postives = 120/167 (71.86%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F    +V KVL+ KEH L+ ++IDPK+A    ++P KK+FVGGL+P+ +E  I+EYF  FGEIE+IE P D + NKR+ ++FITF  ES  +K   ++   ++G K E++IA P+E
Sbjct:   50 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPKE 216          

HSP 2 Score: 74.7146 bits (182), Expect = 6.832e-14
Identity = 44/123 (35.77%), Postives = 68/123 (55.28%), Query Frame = 3
Query:   69 GFVIFVMSAVINNNFAPIVNMVDCRPHGDCEININDNLA---DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            GF++F  +A +        + +D R     +I+    +A   D  +KIFVGGL+ ET+E+ +R+YF  FG ++S  +  D  TN  RGF F+ F  E  V K++E K H +N  K + K A+P
Sbjct:   97 GFILFKEAASVEKVLQQKEHRLDGR-----QIDPKKAMAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQP 214          

HSP 3 Score: 54.299 bits (129), Expect = 2.602e-7
Identity = 26/85 (30.59%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            A  S E   K+FVGGL  D S+  +K+YFS+FGE+ +     D+   + + + FI F   +   K   Q+   + G++ + + A+
Sbjct:   45 ASKSEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAM 129          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpdl (heterogeneous nuclear ribonucleoprotein D like [Source:NCBI gene;Acc:103023995])

HSP 1 Score: 176.407 bits (446), Expect = 3.651e-49
Identity = 89/189 (47.09%), Postives = 122/189 (64.55%), Query Frame = 3
Query:  144 PHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKG 704
            P G  +IN + N  DD  K+F+GGLSW+TS+ DL  Y S+FG V  C IK D  T  SRGFGFV+F   ++V++VLE+KEH L+ K IDPKRAK    +EP KKVFVGGL P+ +E  ++EYF  +G IENIE P D + N+R+ + F+T+  E   +K       +I   K EV++A P+E   + +G
Sbjct:   16 PEG-SKINASRNQQDDG-KMFIGGLSWDTSKKDLTDYLSKFGEVLDCTIKTDPMTGRSRGFGFVLFRDAESVDRVLELKEHKLDGKLIDPKRAKAMKGKEPPKKVFVGGLHPETTEEQVREYFGNYGTIENIELPVDGKTNERRGFCFVTYVEEEPVQKLLENRYHQIGSGKCEVKVAQPKEVYRQQQG 202          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0 [Source:NCBI gene;Acc:103022948])

HSP 1 Score: 173.711 bits (439), Expect = 3.948e-48
Identity = 88/183 (48.09%), Postives = 123/183 (67.21%), Query Frame = 3
Query:  150 GDCE---ININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            GD E   I+ + N  D+  K+FVGGLSW+T++ DL+ YFS+FG V  C +KLD  T  SRGFGFV+F   ++V KV++ KEH LN K IDPK+AK   S+EP KK+FVGGL PD  E  I+EYF+ +GE+E+IE P + + NKR+ + FITF  E   +K   ++   I   K E+++A+ +E
Sbjct:   33 GDAEGSKIDASKNEEDEG-KMFVGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPMTGRSRGFGFVLFKEAESVEKVIQQKEHKLNGKVIDPKKAKAMKSKEPVKKIFVGGLSPDTPEEKIREYFNAYGEVESIELPMENKTNKRRGFCFITFKEEEPVKKIMEKKYHNIGLSKCEIKVAMSKE 214          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B-like [Source:NCBI gene;Acc:103028658])

HSP 1 Score: 169.859 bits (429), Expect = 1.583e-46
Identity = 84/175 (48.00%), Postives = 117/175 (66.86%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKK--------FEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGF++F    +V KVL  KEH L+ ++IDPK+A    +EP KK+FVGGL+P+ +E  I+EYF  FGEIE IE P D + NKR+ ++FI+F  E   +K   ++   +SG K         E++IA P+E
Sbjct:   58 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKDSASVEKVLTQKEHRLDGRQIDPKKAMAMKKEPVKKIFVGGLNPETTEERIREYFGAFGEIETIELPMDPKTNKRRGFVFISFKEEEPVKKILEKKYHNVSGTKDSNGKEGLCEIKIAQPKE 232          

HSP 2 Score: 51.6026 bits (122), Expect = 1.802e-6
Identity = 25/85 (29.41%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            A    E   K+FVGGL  D S+  +K+YFS+FGE+ +     D    + + + FI F + +   K  +Q+   + G++ + + A+
Sbjct:   53 ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDPNTGRSRGFGFILFKDSASVEKVLTQKEHRLDGRQIDPKKAM 137          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 129.798 bits (325), Expect = 1.931e-34
Identity = 64/180 (35.56%), Postives = 106/180 (58.89%), Query Frame = 3
Query:  177 NLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRA-------KPSREPQ-KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQAN 692
            N  +  RK+F+GGLS+ET+ED +RK+F ++G +  C++  D +T  SRGFGFV +   + V+  ++ + H L+ + ++ KRA       KP    + KK+FVGG+  D  E  ++EYF  +G++E  E   D    K++ + F+TFS+     K   Q+   I+G K EVR A+ +++ N
Sbjct:    3 NGDEQQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVRKALSKQEMN 182          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 130.954 bits (328), Expect = 2.097e-33
Identity = 62/181 (34.25%), Postives = 112/181 (61.88%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRA-------KPSREPQ-KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKG 704
            +  RK+F+GGLS+ET+E+ ++K+F ++G +  C++  D +T  SRGFGFV + S + V+  +E++ H L+ + ++ KRA       KP    + KK+FVGG+  +  E  +++YFS++G +E+++   D +  K++ + F+TFS+     K   Q+   I+G K EVR A+ +++ N   G
Sbjct:   30 EQQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVRKALSKQEMNSLGG 210          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 8.148e-33
Identity = 62/173 (35.84%), Postives = 103/173 (59.54%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ---------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQ 686
            RK+FVGGLS+ET+E+ LR+YF ++G +  C++  D  +  SRGFGFV F S   V+  +  + H ++ + ++PKRA  SRE           KK+FVGG+  D  E  +++YF ++G IE +E   +    K++ + F+TF++     K   Q+   I+G   E+R A+P+++
Sbjct:   11 RKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRA-VSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQE 182          

HSP 2 Score: 63.1586 bits (152), Expect = 2.717e-11
Identity = 30/83 (36.14%), Postives = 50/83 (60.24%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ 443
            +KIFVGG+  +T E+ LR YF ++G ++   +  +R +   RGF FV F+  D V+K++  K H +N    + ++A P +E Q
Sbjct:  102 KKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPKQELQ 184          

HSP 3 Score: 59.6918 bits (143), Expect = 3.376e-10
Identity = 31/90 (34.44%), Postives = 53/90 (58.89%), Query Frame = 3
Query:  432 REPQ--KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANR 695
            REP+  +K+FVGGL  + +E  +++YF Q+G + +     DT+  + + + F+TFS+ SE   A S    +I G+  E + A+ RE + R
Sbjct:    5 REPEQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMR 94          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 122.479 bits (306), Expect = 1.724e-31
Identity = 56/171 (32.75%), Postives = 104/171 (60.82%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ-------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQ 686
            RK+F+GGLS+ET+E+ LR+Y+ ++G +  C++  D  +  SRGFGF+ +   + VN  ++ + H ++ + ++ KRA P  + +       KK+FVGG+  +  ES +++YFS+FG +E+++   D +  K++ + F+TF +     +   Q+   I+  K EVR A+ R +
Sbjct:   14 RKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVRKALSRHE 184          

HSP 2 Score: 51.2174 bits (121), Expect = 3.303e-7
Identity = 24/85 (28.24%), Postives = 44/85 (51.76%), Query Frame = 3
Query:  435 EPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQA 689
            E  +K+F+GGL  + +E  ++EY+ Q+G I +     D    + + + FIT+S   E   A       + G+  E + A+PR+ +
Sbjct:   11 EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDS 95          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009806.1 (pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 gene:ENSPMAG00000008859.1 transcript:ENSPMAT00000009806.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 4.702e-19
Identity = 52/170 (30.59%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  201 IFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPK----RAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRS 698
            + V GL W T+ED+L+ YFS FG V    IK D  T  S+G+GFV F   ++  K + ++ H++  +  D K    +  P+   + ++FVG    D++   ++ +F QFG++ ++  P   R     ++ F+TF+NE  A+    Q+   + G    +  A P+ Q  RS
Sbjct:  113 LVVLGLPWTTTEDELKDYFSAFGSVVLSQIKTDPATGKSKGYGFVRFADHESQLKAMGMR-HMIGGRWCDAKLPQSKMYPTDPDRNRIFVGRCPEDITPEDLRSFFGQFGDVTDVYIPKPFR-----SFGFVTFANEHVAQSLCGQDVI-VKGASVHIASAEPKNQLKRS 275          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 126.331 bits (316), Expect = 6.290e-31
Identity = 64/176 (36.36%), Postives = 106/176 (60.23%), Query Frame = 3
Query:  177 NLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQK--KVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRS 698
            +L+ +S K+F+GGL+W+T+ED+LR+YF ++G V    I  D  T  SRGFGF+ F+   +V++V++  +HIL+ K IDPKRA P  E  K  K+FVGG+ PD+     +E+FSQ+G I + +   D    + + + F+T+ +     +    +  +   +K E++ A PR    +S
Sbjct:  153 DLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT-QHILDGKVIDPKRAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPRHMQQKS 327          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 66.2402 bits (160), Expect = 6.623e-12
Identity = 44/155 (28.39%), Postives = 77/155 (49.68%), Query Frame = 3
Query:  201 IFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVL-EIKEHILNKKKI--DPKRAKPS-------------REPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKA 617
            IFVG LSW   ++ L+K F   G V    +  +R T+ SRG+G+V F+++    K + E++   ++ + I  D   +KP+              EP   +F+G L  +     I E F++ GE+ ++  P      + K + ++ FSN  +A+KA
Sbjct:  170 IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKA 324          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 55.4546 bits (132), Expect = 2.174e-8
Identity = 40/173 (23.12%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKK---------VFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAA-SQESQEISGKKFEVRIAIPRE 683
            R ++VG L    +ED L++YF   G + +  I +D+  N +  + FV +      N  L+     LN K+I+    K +   Q +         +FVG L+ ++ +  ++  F  F    +    +D +    + Y F++F+++ +A+ A  S + Q+++G+   +  A  R+
Sbjct:   75 RVLYVGNLDKAITEDILKQYFQVGGPIANIKIMIDK-NNKNVNYAFVEYHQSHDANIALQ----TLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKRD 242          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 50.447 bits (119), Expect = 6.554e-7
Identity = 42/182 (23.08%), Postives = 89/182 (48.90%), Query Frame = 3
Query:  201 IFVGGLSWETSEDDLRKYF--------------SEFGIVKSCIIKLDRYTNHS---RGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPK-----RAKPSRE---------PQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQES-QEISGK 650
            +++G LS++T++DDL ++F              +E  I +  + ++    +++   +GF ++ F + + +  VLE+ E  LN + +  K       +P ++         P + +FVG L  D+++ +++++F   G+I  I         K K + FI F NE  +  A   +S ++I+G+
Sbjct:  127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKNKGFCYMFFKNVEQMKAVLELSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGR 308          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Match: SNP1 (Component of U1 snRNP required for mRNA splicing via spliceosome; substrate of the arginine methyltransferase Hmt1p; may interact with poly(A) polymerase to regulate polyadenylation; homolog of human U1 70K protein; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001323])

HSP 1 Score: 49.6766 bits (117), Expect = 8.486e-7
Identity = 23/66 (34.85%), Postives = 40/66 (60.61%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKE 383
            D  R IF+G L ++  E +L+KYF +FG ++   I  D+ T  S+G+ F++F  +D ++  +  KE
Sbjct:  104 DPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVF--KDPISSKMAFKE 167          

HSP 2 Score: 46.2098 bits (108), Expect = 9.791e-6
Identity = 29/80 (36.25%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  435 EPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            +P + +F+G L  DL E  +++YF +FGEIE I    D    K K Y FI F +   + K A +E     G + + RI I
Sbjct:  104 DPYRTIFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISS-KMAFKEIGVHRGIQIKDRICI 182          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 137.887 bits (346), Expect = 2.287e-37
Identity = 71/168 (42.26%), Postives = 101/168 (60.12%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            K+F+GGLSW+T+ + LR++F +FG +K C++  D  T  SRGFGF+ F     V+ VL      L+ KKIDPK A P R P       KK+F+GGL  + SE  +K+YFSQFG+I      FD    + + + F+TF +E+ A KA   +   I+ KK EV+ A P+E
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPAKMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPKE 168          

HSP 2 Score: 88.1965 bits (217), Expect = 4.870e-20
Identity = 36/84 (42.86%), Postives = 60/84 (71.43%), Query Frame = 3
Query:  177 NLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
             +   ++KIF+GGLS  TSE+D++KYFS+FG +   ++  D+ T   RGFGFV F+SE++ +K  + + H++N KK++ K+A+P
Sbjct:   83 KMVTTTKKIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQP 166          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 128.257 bits (321), Expect = 1.194e-32
Identity = 66/172 (38.37%), Postives = 104/172 (60.47%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVL-EIKEHILNKKKIDPKRAKPSREPQ----KKVFVGGLDPDLSESMIKEYFSQ-FGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            DD  K+FVGGLS+ET+++ L++YFS++G +    IK+D  T   RGF FV F  +   + VL ++  H+L+ + IDPK A P  +P     KK+FVGGL P+ S+  I+EYF + +  ++ IE   +   N+R+ + F++F +E    K    +   I G K EV+ A+P+E
Sbjct:   26 DDIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVDPHVLDGRTIDPKPAAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPKE 197          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 120.939 bits (302), Expect = 1.245e-31
Identity = 67/176 (38.07%), Postives = 105/176 (59.66%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREP--------QKKVFVGGLDPDLSESMIKEYFSQF------GEIENIETPFDTRKNKR-KAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPR 680
            KIF+GGL+W T+E+ L+ YFS++G +  C+I   +    SRGFGFV ++S D+VN+VL+ K+H+L+ ++I+PKR+ P  E          +K+FVGGL     E  IKEYF+        GE+ +++   D    KR + + F+TF N+    K  + +  EI  K+ EV+ A P+
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 174          

HSP 2 Score: 57.3806 bits (137), Expect = 1.643e-9
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = 3
Query:  192 SRKIFVGGLSWETSEDDLRKYFSEF------GIVKSCIIKLDRYT-NHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            +RKIFVGGL+  T E+D+++YF+        G V    +K DR      RGF FV FD+++ V KV  +K H +  K+ + K+A+P
Sbjct:   88 TRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEP 173          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 107.842 bits (268), Expect = 3.725e-27
Identity = 57/162 (35.19%), Postives = 87/162 (53.70%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQK----------KVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGK 650
            RKIFVGGL+  T    L+ YF ++G V  C++  D  T  SR FGF+ F     V  V++ K H L+ K IDPK A P    Q           K+FVGGL    S+  +++YF+ +G++ ++    D +  K + + F+TF ++    KAA +   +I+GK
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGK 162          

HSP 2 Score: 65.4698 bits (158), Expect = 2.247e-12
Identity = 32/70 (45.71%), Postives = 44/70 (62.86%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKI 407
            KIFVGGL+  TS+ DL  YF+ +G V S  + +D  T   RGFGFV F+S+D+V K  +   H +N K +
Sbjct:   95 KIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 3 Score: 47.3654 bits (111), Expect = 3.523e-6
Identity = 25/96 (26.04%), Postives = 46/96 (47.92%), Query Frame = 3
Query:  444 KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMF 731
            +K+FVGGL      + ++ YF ++GE+ +     D    + + + FITF + S  +     +  ++ GK  + + A+PR         +G  NN F
Sbjct:    1 RKIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPP--QGNQNNEF 94          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Match: EDO33402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE0])

HSP 1 Score: 102.064 bits (253), Expect = 1.392e-25
Identity = 56/114 (49.12%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  195 RKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIE 536
            RKIFVGGL+  T+++ L +YF  FG V  C++  D  T  SRGFGFV F    T+  VL  K HIL+ K IDPK A+ S     KVF+GGL    +E  +KEYFS +G + NIE
Sbjct:   14 RKIFVGGLATSTTKEGLHQYFENFGEVTDCVLMTDPTTKRSRGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPARGSAN-DGKVFIGGLAFGTTEEDLKEYFSTYGMV-NIE 125          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101170948])

HSP 1 Score: 180.259 bits (456), Expect = 2.354e-50
Identity = 84/167 (50.30%), Postives = 118/167 (70.66%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            DD+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D  T  SRGFGFV+F    +V+KVLE KEH L+ ++IDPKRA    +E  +K+FVGGL+P+ +E  I+EYF  FGEIE IE P D +  KR+ ++FIT+ +E+  +K   ++   I G + E++IA P+E
Sbjct:   53 DDAGKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDSNTGRSRGFGFVLFKDSSSVDKVLEQKEHRLDGRQIDPKRAMAMKKEAVRKIFVGGLNPEATEEAIREYFGAFGEIETIELPIDPKSKKRRGFIFITYKDEASVKKCLEKKYHTIEGGRCELKIAQPKE 219          

HSP 2 Score: 64.6994 bits (156), Expect = 1.056e-10
Identity = 39/123 (31.71%), Postives = 67/123 (54.47%), Query Frame = 3
Query:   69 GFVIFVMSAVINNNFAPIVNMVDCRPHGDCEININDNLA---DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            GFV+F  S+ ++       + +D R     +I+    +A   +  RKIFVGGL+ E +E+ +R+YF  FG +++  + +D  +   RGF F+ +  E +V K LE K H +   + + K A+P
Sbjct:  100 GFVLFKDSSSVDKVLEQKEHRLDGR-----QIDPKRAMAMKKEAVRKIFVGGLNPEATEEAIREYFGAFGEIETIELPIDPKSKKRRGFIFITYKDEASVKKCLEKKYHTIEGGRCELKIAQP 217          

HSP 3 Score: 51.6026 bits (122), Expect = 1.866e-6
Identity = 27/91 (29.67%), Postives = 48/91 (52.75%), Query Frame = 3
Query:  402 KIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            KID   A    +   K+FVGGL  D S+  +K+YFS+FGE+ +     D+   + + + F+ F + S   K   Q+   + G++ + + A+
Sbjct:   45 KID---ASKGEDDAGKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDSNTGRSRGFGFVLFKDSSSVDKVLEQKEHRLDGRQIDPKRAM 132          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0-like [Source:NCBI gene;Acc:101171014])

HSP 1 Score: 177.948 bits (450), Expect = 3.838e-50
Identity = 95/212 (44.81%), Postives = 129/212 (60.85%), Query Frame = 3
Query:  105 NNFAPIVNMVDCRPHGD----CEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNN 722
            NN  P+    D    GD      I+ + N  D+  K+FVGGLSW+T++ DL+ YF++FG V  C +KLD  T  SRGFGFV+F   ++V KV   KEH LN K IDPK+AK   S+EP KKVFVGGL PD  E  ++EYF  FGE+E+IE P + + NKR+ + FITF  E   +K   ++   I   K EV++A+ +EQ  + + W G   
Sbjct:   23 NNDDPMSAQGDGGLMGDEAEGSRIDASKNEEDEG-KMFVGGLSWDTTKKDLKDYFAKFGEVVDCTLKLDPMTGRSRGFGFVLFKDAESVEKVASQKEHKLNGKVIDPKKAKAMKSKEPVKKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVALSKEQYQQQQYWGGRGG 233          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101162934])

HSP 1 Score: 177.948 bits (450), Expect = 2.197e-49
Identity = 90/195 (46.15%), Postives = 123/195 (63.08%), Query Frame = 3
Query:  138 CRPHGDCEININDNLA------------DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            C   GD E   + N              +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D+ T  SRGFGF++F    +V+KVLE KEH L+ ++IDPKRA    +E  KK+FVGGL PDLS+  I+EYF  FGEIE IE P D +  KR+ ++FIT+  E   +K   ++   + G K E++IA P+E
Sbjct:   41 CDQSGDAEDGSSQNGGNEGGQIDASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQPKE 235          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpaba (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101162934])

HSP 1 Score: 178.333 bits (451), Expect = 2.364e-49
Identity = 85/167 (50.90%), Postives = 117/167 (70.06%), Query Frame = 3
Query:  186 DDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP-SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPRE 683
            +D+ K+FVGGLSW+TS+ DL+ YFS+FG V  C IK+D+ T  SRGFGF++F    +V+KVLE KEH L+ ++IDPKRA    +E  KK+FVGGL PDLS+  I+EYF  FGEIE IE P D +  KR+ ++FIT+  E   +K   ++   + G K E++IA P+E
Sbjct:   84 EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAMAMKKEIVKKIFVGGLKPDLSKEEIEEYFGAFGEIETIELPQDPKTEKRRGFVFITYKEEPSVKKVLEKKYHTVGGSKCEIKIAQPKE 250          

HSP 2 Score: 52.373 bits (124), Expect = 1.116e-6
Identity = 25/85 (29.41%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  420 AKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAI 674
            A    E   K+FVGGL  D S+  +K+YFS+FGE+ +     D +  + + + FI F + +   K   Q+   + G++ + + A+
Sbjct:   79 ASKGEEDAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDQQTGRSRGFGFILFKDAASVDKVLEQKEHRLDGRQIDPKRAM 163          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Match: hnrnpd (heterogeneous nuclear ribonucleoprotein D0-like [Source:NCBI gene;Acc:101171014])

HSP 1 Score: 175.637 bits (444), Expect = 8.959e-49
Identity = 94/207 (45.41%), Postives = 128/207 (61.84%), Query Frame = 3
Query:  105 NNFAPIVNMVDCRPHGD----CEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP--SREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGW 707
            NN  P+    D    GD      I+ + N  D+  K+FVGGLSW+T++ DL+ YF++FG V  C +KLD  T  SRGFGFV+F   ++V KV   KEH LN K IDPK+AK   S+EP KKVFVGGL PD  E  ++EYF  FGE+E+IE P + + NKR+ + FITF  E   +K   ++   I   K EV++A+ +EQ  + + W
Sbjct:   23 NNDDPMSAQGDGGLMGDEAEGSRIDASKNEEDEG-KMFVGGLSWDTTKKDLKDYFAKFGEVVDCTLKLDPMTGRSRGFGFVLFKDAESVEKVASQKEHKLNGKVIDPKKAKAMKSKEPVKKVFVGGLSPDTPEEKVREYFGAFGEVESIELPMENKTNKRRGFCFITFKEEEAVKKVMEKKYHNIGLSKCEVKVALSKEQYQQQQYW 228          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000029158.1 (SMESG000029158.1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 348/353 (98.58%), Postives = 348/353 (98.58%), Query Frame = 3
Query:   87 MSAVINNNFAPIVNMVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDXXXXXXXXXXXXXXXXXXXXEQLLNYDPVNLSRQFSTGVMINNSTSAPRXXXXXXXXXXXXXXXXPFITNADSHSANVTSLPNGNVFMTHSPSVQRXXXXXXXXX---XXXXXXDAPGNNIFETNK 1136
            MSAVINNNFAPIVNMVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDYFYSYLYNNPNLYNSFYNPYEQLLNYDPVNLSRQFSTGVMINNSTSAPRPKIPGNNNNNISNKSNPFITNADSHSANVTSLPNGNVFMTHSPSVQRTNNNNN N    TKSNSNDAPGNNIFETNK
Sbjct:    1 MSAVINNNFAPIVNMVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDYFYSYLYNNPNLYNSFYNPYEQLLNYDPVNLSRQFSTGVMINNSTSAPRPKIPGNNNNNISNKSNPFITNADSHSANVTSLPNGNVFMTHSPSVQRTNNNNNNNNQNFTKSNSNDAPGNNIFETNK 353          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000029158.1 (SMESG000029158.1)

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 334/339 (98.53%), Postives = 334/339 (98.53%), Query Frame = 3
Query:  129 MVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDXXXXXXXXXXXXXXXXXXXXEQLLNYDPVNLSRQFSTGVMINNSTSAPRXXXXXXXXXXXXXXXXPFITNADSHSANVTSLPNGNVFMTHSPSVQRXXXXXXXXX---XXXXXXDAPGNNIFETNK 1136
            MVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDYFYSYLYNNPNLYNSFYNPYEQLLNYDPVNLSRQFSTGVMINNSTSAPRPKIPGNNNNNISNKSNPFITNADSHSANVTSLPNGNVFMTHSPSVQRTNNNNN N    TKSNSNDAPGNNIFETNK
Sbjct:    1 MVDCRPHGDCEININDNLADDSRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGWKGTNNNMFFPYTMLPYMYQDYFYSYLYNNPNLYNSFYNPYEQLLNYDPVNLSRQFSTGVMINNSTSAPRPKIPGNNNNNISNKSNPFITNADSHSANVTSLPNGNVFMTHSPSVQRTNNNNNNNNQNFTKSNSNDAPGNNIFETNK 339          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 125.561 bits (314), Expect = 3.141e-30
Identity = 70/193 (36.27%), Postives = 106/193 (54.92%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ--------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGW-KGTNNNMFFPYTML 749
            K+FVGGL+  T+ + L+ YFS+FG +K  ++  D     SRGFGFV F     V KVL+ + HIL+ KKIDPK A P    Q        KK+F+GG+    +   I++YF+++GE+EN E   D   N+ + + F+TF +E  A +        I+ K  E + A+P+E  + S    K  N ++  P  +L
Sbjct:   38 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAIL 230          

HSP 2 Score: 77.411 bits (189), Expect = 1.449e-14
Identity = 30/79 (37.97%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  192 SRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            ++KIF+GG++  ++ +++R+YF+ +G V++C + +D+ TN  RGFGFV F  ED   ++ +I  H +N K ++ K+A P
Sbjct:  127 TKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALP 205          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 125.561 bits (314), Expect = 3.198e-30
Identity = 70/193 (36.27%), Postives = 106/193 (54.92%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQ--------KKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQANRSKGW-KGTNNNMFFPYTML 749
            K+FVGGL+  T+ + L+ YFS+FG +K  ++  D     SRGFGFV F     V KVL+ + HIL+ KKIDPK A P    Q        KK+F+GG+    +   I++YF+++GE+EN E   D   N+ + + F+TF +E  A +        I+ K  E + A+P+E  + S    K  N ++  P  +L
Sbjct:   46 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPKELLSTSNATPKSENKSLQVPLAIL 238          

HSP 2 Score: 77.411 bits (189), Expect = 1.485e-14
Identity = 30/79 (37.97%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  192 SRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKP 428
            ++KIF+GG++  ++ +++R+YF+ +G V++C + +D+ TN  RGFGFV F  ED   ++ +I  H +N K ++ K+A P
Sbjct:  135 TKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALP 213          
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Match: SMESG000020492.1 (SMESG000020492.1)

HSP 1 Score: 122.479 bits (306), Expect = 1.974e-29
Identity = 58/164 (35.37%), Postives = 95/164 (57.93%), Query Frame = 3
Query:  198 KIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRA----KPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIETPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIP 677
            K+F+GGLS  T++D LR YF +FG ++ C++ +D  T  SRGFG++ F  E TV  VLE   H+L+ K +D K+     K       K+FVGG+  D +E  I+++FSQFG + ++    D  K + + + F+ F +ES  ++   +    ++GK  E++   P
Sbjct:   11 KVFIGGLSQATNDDSLRNYFDQFGSIEDCVVMMDNKTGRSRGFGYIKFHEESTVRTVLEEGPHLLDGKIVDVKQCNIHMKGRNRRSLKIFVGGIGLDDNEETIRQFFSQFGNVTDVNLMLDQTKQRHRGFAFVGFDDESVVKELIVRHFVTMNGKHVEIKAMEP 174          

HSP 2 Score: 59.3066 bits (142), Expect = 7.745e-9
Identity = 31/87 (35.63%), Postives = 49/87 (56.32%), Query Frame = 3
Query:  192 SRKIFVGGLSWETSEDDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEHILNKKKIDPKRAKPSREPQKKV 452
            S KIFVGG+  + +E+ +R++FS+FG V    + LD+     RGF FV FD E  V +++      +N K ++ K  +P    +K V
Sbjct:   96 SLKIFVGGIGLDDNEETIRQFFSQFGNVTDVNLMLDQTKQRHRGFAFVGFDDESVVKELIVRHFVTMNGKHVEIKAMEPPNFARKLV 182          
The following BLAST results are available for this feature:
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPDL4.185e-5353.11heterogeneous nuclear ribonucleoprotein D like [So... [more]
HNRNPDL4.185e-5353.11heterogeneous nuclear ribonucleoprotein D like [So... [more]
HNRNPDL4.185e-5353.11heterogeneous nuclear ribonucleoprotein D like [So... [more]
HNRNPDL4.185e-5353.11heterogeneous nuclear ribonucleoprotein D like [So... [more]
HNRNPDL4.185e-5353.11heterogeneous nuclear ribonucleoprotein D like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msi-11.225e-3633.06MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
sqd-11.582e-3136.84Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-11.582e-3136.84Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-11.582e-3136.84Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-11.582e-3136.84Homologous to Drosophila SQD (Squid) protein [Sou... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sqd1.452e-4245.45gene:FBgn0263396 transcript:FBtr0082854[more]
sqd1.637e-4245.45gene:FBgn0263396 transcript:FBtr0309094[more]
sqd1.637e-4245.45gene:FBgn0263396 transcript:FBtr0082856[more]
sqd3.603e-4245.45gene:FBgn0263396 transcript:FBtr0082855[more]
msi1.517e-3543.11gene:FBgn0011666 transcript:FBtr0333665[more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpabb4.181e-5050.30heterogeneous nuclear ribonucleoprotein A/Bb [Sour... [more]
hnrnpabb4.181e-5050.30heterogeneous nuclear ribonucleoprotein A/Bb [Sour... [more]
hnrnpdl8.891e-5048.42heterogeneous nuclear ribonucleoprotein D-like [So... [more]
hnrnpdl8.891e-5048.42heterogeneous nuclear ribonucleoprotein D-like [So... [more]
hnrnpdl8.891e-5048.42heterogeneous nuclear ribonucleoprotein D-like [So... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h2bc212.796e-5050.28H2B clustered histone 21 [Source:Xenbase;Acc:XB-GE... [more]
h2bc212.906e-5050.28H2B clustered histone 21 [Source:Xenbase;Acc:XB-GE... [more]
h2bc215.057e-5048.15H2B clustered histone 21 [Source:Xenbase;Acc:XB-GE... [more]
adam178.534e-5049.43ADAM metallopeptidase domain 17 [Source:Xenbase;Ac... [more]
cep1121.150e-4950.90centrosomal protein 112kDa [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpdl3.480e-5353.11heterogeneous nuclear ribonucleoprotein D-like [So... [more]
Hnrnpdl1.290e-5253.11heterogeneous nuclear ribonucleoprotein D-like [So... [more]
Hnrnpdl1.290e-5253.11heterogeneous nuclear ribonucleoprotein D-like [So... [more]
Hnrnpab1.019e-4948.86heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
Hnrnpd1.328e-4948.30heterogeneous nuclear ribonucleoprotein D [Source:... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZI72|HNRDL_CHICK1.950e-5253.11Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|Q9Z130|HNRDL_MOUSE2.030e-5253.11Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|O14979|HNRDL_HUMAN1.006e-5153.11Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|Q3SWU3|HNRDL_RAT4.822e-5154.27Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
sp|Q640A2|HNRDL_XENTR1.540e-4950.28Heterogeneous nuclear ribonucleoprotein D-like OS=... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LIX02.464e-7152.89Heterogeneous nuclear ribonucleoprotein D0 OS=Schi... [more]
A0A4Z2CMS88.245e-7153.10Heterogeneous nuclear ribonucleoprotein A/B isofor... [more]
A0A4Z2CMJ48.578e-7153.10Heterogeneous nuclear ribonucleoprotein A/B isofor... [more]
Q5DH488.593e-7153.10Heterogeneous nuclear ribonucleoprotein D0 OS=Schi... [more]
G4LYB82.822e-7053.74Heterogeneous nuclear ribonucleoprotein,putative O... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpabb2.507e-5050.30heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpabb5.299e-5050.30heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpdl3.651e-4947.09heterogeneous nuclear ribonucleoprotein D like [So... [more]
hnrnpd3.948e-4848.09heterogeneous nuclear ribonucleoprotein D0 [Source... [more]
hnrnpaba1.583e-4648.00heterogeneous nuclear ribonucleoprotein A/B-like [... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPA01.931e-3435.56heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA02.097e-3334.25heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
ENSPMAT00000004893.18.148e-3335.84pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA2B11.724e-3132.75heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
ENSPMAT00000009806.14.702e-1930.59pep scaffold:Pmarinus_7.0:GL479354:9188:12030:-1 g... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HRP16.290e-3136.36Subunit of cleavage factor I; cleavage factor I is... [more]
NSR16.623e-1228.39Nucleolar protein that binds nuclear localization ... [more]
PUB12.174e-823.12Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NOP136.554e-723.08Nucleolar protein found in preribosomal complexes;... [more]
SNP18.486e-734.85Component of U1 snRNP required for mRNA splicing v... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398792.287e-3742.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384171.194e-3238.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.245e-3138.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333893.725e-2735.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334021.392e-2549.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpabb2.354e-5050.30heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpd3.838e-5044.81heterogeneous nuclear ribonucleoprotein D0-like [S... [more]
hnrnpaba2.197e-4946.15heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpaba2.364e-4950.90heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpd8.959e-4945.41heterogeneous nuclear ribonucleoprotein D0-like [S... [more]
back to top
BLAST of Heterogeneous nuclear ribonucleoprotein,putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029158.10.000e+098.58SMESG000029158.1[more]
SMESG000029158.10.000e+098.53SMESG000029158.1[more]
SMESG000071202.13.141e-3036.27SMESG000071202.1[more]
SMESG000071202.13.198e-3036.27SMESG000071202.1[more]
SMESG000020492.11.974e-2935.37SMESG000020492.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005694 ID=SMED30005694|Name=Heterogeneous nuclear ribonucleoprotein,putative|organism=Schmidtea mediterranea sexual|type=transcript|length=2434bp
AGTTAACGTAAGAAAGTTTTTTGTTTTGCTGAATCACATATGTTTTGTAT
TACGACATTTTGAATGTGGGATTTGTAATATTTGTCATGAGTGCTGTGAT
AAATAATAATTTTGCTCCAATTGTAAATATGGTTGATTGTAGACCACACG
GAGATTGTGAGATAAATATAAATGATAACCTTGCAGATGATTCCAGAAAA
ATATTTGTGGGGGGCTTGAGTTGGGAAACTAGCGAAGATGATTTACGAAA
GTACTTTAGCGAGTTTGGAATCGTGAAATCGTGCATAATTAAGCTTGATC
GTTATACGAATCATTCTAGAGGATTTGGATTTGTAATTTTTGATTCAGAA
GATACTGTTAATAAGGTTTTGGAGATTAAAGAACATATATTGAATAAGAA
AAAAATCGATCCTAAAAGAGCTAAACCAAGTCGAGAACCCCAGAAAAAAG
TTTTTGTTGGTGGATTAGATCCGGATCTATCGGAATCTATGATAAAGGAA
TATTTTAGTCAATTTGGAGAGATAGAAAATATCGAGACACCTTTCGATAC
TCGCAAAAACAAAAGAAAAGCATATTTATTCATAACATTTTCTAATGAAT
CCGAAGCTCGCAAAGCAGCTTCCCAAGAAAGCCAAGAGATTAGTGGCAAA
AAGTTTGAAGTGAGAATTGCTATTCCACGTGAACAGGCTAATCGAAGCAA
AGGATGGAAAGGCACCAATAATAATATGTTCTTTCCATACACGATGCTTC
CGTACATGTACCAAGATTATTTCTATTCCTATCTATACAATAATCCAAAT
TTGTATAATTCATTCTATAATCCTTATGAACAACTGCTCAACTATGATCC
AGTTAATTTAAGTAGACAATTTTCAACGGGAGTCATGATCAACAATTCAA
CTTCGGCTCCGCGACCTAAAATTCCCGGAAACAACAATAATAACATATCC
AATAAATCGAATCCTTTCATAACTAATGCCGATAGTCATTCAGCAAATGT
AACATCCTTGCCAAATGGCAATGTTTTCATGACTCATTCACCATCTGTCC
AACGAACGAATAATAATAATAATCAAAATTTCACAAAATCAAATAGTAAT
GACGCGCCCGGAAACAATATATTTGAAACAAATAAATAATCTCCTGATAT
ATGATATGTCTATCTATATCTATCAATATAATATATTTATATATACACAC
ATATACATATACTCTTTGTTACCATGGATTTTGTGAAATTGTTTATTATT
GCCCCATCCCTCCCACATTACCATATTTGTCATATTTTATTTGACTTTCC
TTCACTTTGTCCTTTTAATCCACTATTTCAATTTCGTTCAATATGCAGTT
GCGAATTCGGTTTAGTGGTTATTATTATTTTTTCTGTAATCGATACTTTT
GTTTATTACTTGAAATTGTCTTTGTGTAGCTCTACATTGAGAAATGTAGT
CGCTACACATATCTTTTCTGCTTTGTTTTGTGAAATTTGTATAAAACAAA
AGTGCAAAAAAGAGATTAGGTGATGGGATTGATAATTGAAATATGCGGTT
GTGTACGCATATATTGTACTTTTTTTTGAGTATGCTGCATGTAAAAAATA
ACGAGCTGTGTTGTACTGTTTGTACCGTTATTTTGTGCGATTGTGTGCAT
GTTTCCAGATAATGTGTATACTGATGGGGTGTCATGTTCAAATCAAATGC
CTTTATTTATTTAATTGAAGACTTCCATTTTCTGGGAATATTATATACTA
TGAGTAATTTACGATTGTTGAATCTATGGGATCTATGTGCATTTCCGAAT
TTGTACGTTAAAATTATGTCATACTGTGAAATAATATTGCTCAGTCATTT
CACTTTATTGCTCATATTTATCCTGATTTTGCAGGGCGGCCGATGTCTCT
ATATATAAATATAAATATATATTTATTTTAAAGTTGCCTAAGCTTGCGGT
GTGAATGTGTACAACCTTGTACCTCTATCTGTAATGTGCATTGCTTTGTT
GTGAATAATACTGCTTTTTCTTTCATGACTATTTTATTGACTTAAAATTG
AAGTTTCATTATTTTTTCCAAAATATCGATATTATGGAAAATTTTTTTGA
TTAACACTCAATTCGATGCATTATTTGGTATTAATTTGTCGAGGATCTGG
TTATTATTTAGTTTACCTTCACAATTTTGTACAGGTTTTTAATTGGGCTG
TTATAATTAAATGTATTTGGATTACTTTTCATTATTATTGAATTAATCCA
TTCTAACCTAAATTATATTTTGCCTTAACAAGATTTAATGATAGGTAATT
ATATATGACGACTGGGGAATTGATACGTGATGGGTCCTTGGTTATACCAT
CAGTGTTGTGTCATGTAATTATGTGAGTCTTCAATGTTATTTTAACGAAT
CATTTTCTGCTTTGTTGGATGGTAAATTGATTTA
back to top

protein sequence of SMED30005694-orf-1

>SMED30005694-orf-1 ID=SMED30005694-orf-1|Name=SMED30005694-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=351bp
MSAVINNNFAPIVNMVDCRPHGDCEININDNLADDSRKIFVGGLSWETSE
DDLRKYFSEFGIVKSCIIKLDRYTNHSRGFGFVIFDSEDTVNKVLEIKEH
ILNKKKIDPKRAKPSREPQKKVFVGGLDPDLSESMIKEYFSQFGEIENIE
TPFDTRKNKRKAYLFITFSNESEARKAASQESQEISGKKFEVRIAIPREQ
ANRSKGWKGTNNNMFFPYTMLPYMYQDYFYSYLYNNPNLYNSFYNPYEQL
LNYDPVNLSRQFSTGVMINNSTSAPRPKIPGNNNNNISNKSNPFITNADS
HSANVTSLPNGNVFMTHSPSVQRTNNNNNQNFTKSNSNDAPGNNIFETNK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 121..193
e-value: 6.2E-17
score: 72.2
coord: 38..110
e-value: 1.2E-22
score: 91.2
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 39..107
e-value: 5.2E-16
score: 58.2
coord: 122..180
e-value: 9.2E-14
score: 51.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 37..114
score: 16.824
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 120..199
score: 16.534
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 32..107
e-value: 2.7E-24
score: 87.2
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 108..214
e-value: 5.2E-23
score: 83.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..353
NoneNo IPR availablePANTHERPTHR15241:SF43HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A/Bcoord: 24..205
NoneNo IPR availablePANTHERPTHR15241TRANSFORMER-2-RELATEDcoord: 24..205
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 117..213
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 35..119