Cytoplasmic dynein 2 heavy chain 1

Overview
NameCytoplasmic dynein 2 heavy chain 1
Smed IDSMED30005692
Uniprot Best hitCytoplasmic dynein 2 heavy chain 1 OS=Tripneustes gratilla OX=7673 GN=DYH1B PE=2 SV=2 (E=0)
Length (bp)13065
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytoplasmic dynein 2 heavy chain 1 (SMED30005692) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytoplasmic dynein 2 heavy chain 1 (SMED30005692) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytoplasmic dynein 2 heavy chain 1 (SMED30005692) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytoplasmic dynein 2 heavy chain 1 (SMED30005692) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005692

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30005692SMESG000008384.1 SmedASXL_003686SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_019879SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008384.1 SmedASXL_006349SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_000389SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008384.1 SmedASXL_001570SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_018018SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_003716SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_000933SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30005692SMESG000008382.1 SmedASXL_002732SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v6_9136_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30005692SMESG000008384.1 SMESG000008382.1 dd_Smed_v4_9136_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2962])

HSP 1 Score: 4532.63 bits (11755), Expect = 0.000e+0
Identity = 2338/4334 (53.95%), Postives = 3110/4334 (71.76%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFPNQNSKFVNE---ECLD--KFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVP-------PTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLL-EMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  IF  T+++F   +  +       CL+   F D+ +  +L V+  D    FSN +   D     LVF K  P +IT +N++  I+V+++ E+PISSLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++R+  +  +K +  E    GI +  DE  FW +     +   ++ R N      + +  E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L++II     R +Q +L  L  WED Y LVKESL   I +C  W+ +C+ L  + W++Y+PH W  +     + +     RL E+ ++RT+HE+    LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+LV   K  R DF +R R   +P         KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  K+ L+++  + QEQF+ W++++   L DS + G+ ++   R+MEL   DGLL V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +E Q     +   WK+H +HQLYKALE+QY +GLEALNENLPEI +DL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  + KAE LF+RLSA L++ KEWI++G +D+E  V++H   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC P+K  +D LIQ +FD L+ SL+K+I+  +  +D ++T ++++L+  PQ+++EI +A L +++  + +  I     ++E  N LLRTVAGGG++T+S L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG D++++G       + + IK+KK+E ++L + +  L  DC HF++E   F+L   I KDI+    +W+ +EE+Q G Q +A EDW++FR++ YLFEEFL  W ++LR  E  + MT++LQ E+D YK +IPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQ+ ++ LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA+LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF RVDEDFRSIM+D+ ++NRV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F++  +HI  MKSL+GEVV  +N+V +++ VE WL +L  EMK TL   L   +   R S  +   ++   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YTN   S     ++   + +LKLK+LILD +HNID++ QL      +  +W W KQLRFY KS D  C +QMVD+EF YTYEYQGNA KLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEE+VLSAVSMQIQ IQD +KN      LL + V V+ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS PDN+LIAEVIL S+GFK+AK L RKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL +++KS      N           E+ ++VQALR+NT+SK T+ D   F++LIKDVFP I++KE+EYD L++A+++V +E N   +  Q KK LE+YEQL QRMGVVIVGPSG+GKST+W++LR AL K G+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    ++ L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   ++   F + LI+GLGGNLN  SR  F   V+    E  P+ +K   ++ Y++  + RL TY  +  E+L+ D   +   +  P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S Q+ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLCSI YP ++QL  IY AYL+PVL + +  H IW  +SK+ LLA +M++VY Q+++KFTVDDYSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V +      D IL +    +W  ++ D+++D ++VTWG+R    A A P       GK LGKL S  LKD I +GL+ Y R+ ++LDI+LF EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYELKQFKNDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLL+SGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +N NF+INC+SNPA  K C V W+E WS  SM KIP ML ++    E     +   + K      D L S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL+ IT  MQ A+E+K E+E+L  +  EE V + +RK  IDDEL  ++P V +A+ AV +IK   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I++E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKAN++YS+ LE+I PLE EQ  L+ NL+  E + + LE+ ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E +RWN Q+VE+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD +LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN +F+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL NKDL+ SLN+TK SS  I +SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL +FLRLFQRAL   + S ++  R  SLI+ L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  A+P L+  L  +D  LW  +  +S CE+E P  L  K+SLFQ+IL++QALRPDRLQSA++ F C  L LK +SP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL+      E Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  I+D++   + +++QW+F+HGL ENAI+GGR+DN FD+RVL SY+K++FN SV+      N    F   + LP + S  DY A+I ++ + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G+KFD++IWS EL+PVLN WK LNQ  N+I   +P    R    SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W + +EK  LLS  LDL ELFHPDTFLNALRQ TAR +  S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW+ ++    YS D+ ISLP+Y    RD++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWR-QTEHDHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKESLKAGISICEQWVIVCNHLTGQVWQRYVPHPWKNEKYFPET-LDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTRVFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCR--GIPGDASGPLSGKNLSEVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSRDIQSGLSDSRS-GLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKDGLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSIMIDRNASGFLTIFSKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMPQSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSAKLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQGFQEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKIVIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTIREALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMTDIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWLNDLALEMKKTLEQLLKECVTTGRSSQGA---VDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHTTEDWAWKKQLRFYMKS-DHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLNKSGTTQNAN-----------ESHIVVQALRLNTMSKFTFTDCTRFDALIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGPSGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESPPDFHKP--MDTYYDSTRGRLATYVLKKPEDLTADDFSNG--LTLPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCSIDYPEREQLQTIYGAYLEPVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARHNSGARAAPGQPLPPHGKPLGKLNSTDLKDVIKKGLIHYGRDNQNLDILLFHEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANSNFMINCESNPALHKKCQVLWMEGWSNSSMKKIPEMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMITVSMQDASEQKTELERLKHRIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIRESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLINQLDREHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSRLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAFLRLFQRALQNKQDSENTEQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQILVVQALRPDRLQSAMALFACKTLGLKEVSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYNIIDRLFDGA-KDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVIDVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVPPPNDRQG--SPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLAWQSKWEGPEDPLQYLRGLVARALAIQNWVDKAEKQALLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDACGPYSPDECISLPVYTSAERDRVVTNIDVPC-GGNQDQWIQCGAALFLKN 4306          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2962])

HSP 1 Score: 4526.85 bits (11740), Expect = 0.000e+0
Identity = 2339/4341 (53.88%), Postives = 3111/4341 (71.67%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFPNQNSKFVNE---ECLD--KFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVP-------PTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLL-EMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGI-------LIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  IF  T+++F   +  +       CL+   F D+ +  +L V+  D    FSN +   D     LVF K  P +IT +N++  I+V+++ E+PISSLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++R+  +  +K +  E    GI +  DE  FW +     +   ++ R N      + +  E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L++II     R +Q +L  L  WED Y LVKESL   I +C  W+ +C+ L  + W++Y+PH W  +     + +     RL E+ ++RT+HE+    LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+LV   K  R DF +R R   +P         KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  K+ L+++  + QEQF+ W++++   L DS + G+ ++   R+MEL   DGLL V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +E Q     +   WK+H +HQLYKALE+QY +GLEALNENLPEI +DL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  + KAE LF+RLSA L++ KEWI++G +D+E  V++H   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC P+K  +D LIQ +FD L+ SL+K+I+  +  +D ++T ++++L+  PQ+++EI +A L +++  + +  I     ++E  N LLRTVAGGG++T+S L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG D++++G       + + IK+KK+E ++L + +  L  DC HF++E   F+L   I KDI+    +W+ +EE+Q G Q +A EDW++FR++ YLFEEFL  W ++LR  E  + MT++LQ E+D YK +IPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQ+ ++ LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA+LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF RVDEDFRSIM+D+ ++NRV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F++  +HI  MKSL+GEVV  +N+V +++ VE WL +L  EMK TL   L   +   R S  +   ++   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YTN   S     ++   + +LKLK+LILD +HNID++ QL      +  +W W KQLRFY KS D  C +QMVD+EF YTYEYQGNA KLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEE+VLSAVSMQIQ IQD +KN      LL + V V+ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS PDN+LIAEVIL S+GFK+AK L RKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL +++KS      N           E+ ++VQALR+NT+SK T+ D   F++LIKDVFP I++KE+EYD L++A+++V +E N   +  Q KK LE+YEQL QRMGVVIVGPSG+GKST+W++LR AL K G+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    ++ L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   ++   F + LI+GLGGNLN  SR  F   V+    E  P+ +K   ++ Y++  + RL TY  +  E+L+ D   +   +  P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S Q+ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLCSI YP ++QL  IY AYL+PVL + +  H IW  +SK+ LLA +M++VY Q+++KFTVDDYSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V +      D IL +    +W  ++ D+++D ++VTWG+R    A A P       GK LGKL S  LKD I +GL+ Y R+ ++LDI+LF EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYELKQFKNDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLL+SGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +N NF+INC+SNPA  K C V W+E WS  SM KIP ML ++    E     +   + K      D L S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL+ IT  MQ A+E+K E+E+L  +  EE V + +RK  IDDEL  ++P V +A+ AV +IK   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I++E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKAN++YS+ LE+I PLE EQ  L+ NL+  E + + LE+ ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E +RWN Q+VE+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ I       + PFLIDPSS AT WLK H KD +LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN +F+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL NKDL+ SLN+TK SS  I +SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL +FLRLFQRAL   + S ++  R  SLI+ L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  A+P L+  L  +D  LW  +  +S CE+E P  L  K+SLFQ+IL++QALRPDRLQSA++ F C  L LK +SP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL+      E Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  I+D++   + +++QW+F+HGL ENAI+GGR+DN FD+RVL SY+K++FN SV+      N    F   + LP + S  DY A+I ++ + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G+KFD++IWS EL+PVLN WK LNQ  N+I   +P    R    SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W + +EK  LLS  LDL ELFHPDTFLNALRQ TAR +  S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW+ ++    YS D+ ISLP+Y    RD++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWR-QTEHDHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKESLKAGISICEQWVIVCNHLTGQVWQRYVPHPWKNEKYFPET-LDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTRVFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCR--GIPGDASGPLSGKNLSEVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSRDIQSGLSDSRS-GLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKDGLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSIMIDRNASGFLTIFSKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMPQSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSAKLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQGFQEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKIVIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTIREALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMTDIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWLNDLALEMKKTLEQLLKECVTTGRSSQGA---VDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHTTEDWAWKKQLRFYMKS-DHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLNKSGTTQNAN-----------ESHIVVQALRLNTMSKFTFTDCTRFDALIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGPSGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESPPDFHKP--MDTYYDSTRGRLATYVLKKPEDLTADDFSNG--LTLPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCSIDYPEREQLQTIYGAYLEPVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARHNSGARAAPGQPLPPHGKPLGKLNSTDLKDVIKKGLIHYGRDNQNLDILLFHEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANSNFMINCESNPALHKKCQVLWMEGWSNSSMKKIPEMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMITVSMQDASEQKTELERLKHRIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIRESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLINQLDREHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQIIGLKSWSRVCPFLIDPSSQATEWLKTHLKDSRLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAFLRLFQRALQNKQDSENTEQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQILVVQALRPDRLQSAMALFACKTLGLKEVSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYNIIDRLFDGA-KDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVIDVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVPPPNDRQG--SPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLAWQSKWEGPEDPLQYLRGLVARALAIQNWVDKAEKQALLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDACGPYSPDECISLPVYTSAERDRVVTNIDVPC-GGNQDQWIQCGAALFLKN 4313          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1213.36 bits (3138), Expect = 0.000e+0
Identity = 962/3538 (27.19%), Postives = 1707/3538 (48.25%), Query Frame = 3
Query: 2787 ITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR----TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNL---------EKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWS-------QFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK-----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTA---RC----EELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDW-------IAKRNEFTISTSNVGTVYNGLSNLKAIKNKAH-----------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ--VTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKL-LANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTS-EYLKDTIDRGLLQY--SRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLAN-----ESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSY----FLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISE--------------AKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEK------TGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWI-DA--DRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQ---LPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD-------SP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYY------DILRDKIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            + ++C+ +K S+        +     LR+   G +  +  YL  + + +S+ PQ ++E+  +         D + + +QI    +   +L      V    ++ +  L  +W  F+  +   + M+++  E  KT ++     F++      + ++    G    + G   A     Q         EE   ++ NL          KD ++ + E +    + EI +D ++N   W        Q E  +T    L       FR    L +E+      K RN EI   T   + +I+ +K  +P++  +R   L + HW ++   +        E+ TL  I++   +  +H E I E++  A  E+ I  A++ +          +V Y D  ++ +   +E   +   + DNQ  L ++K S + + F+     WE  L+ + E ++ +  +QR+W+YLE IF     +  LP E + F +V+ ++++IM  +N++N  L      G+ + L  M   L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I  +   K          + M S DGE ++  + V +   VE+WLG++   M+ TL D L      LR   N+ +  +   ++  Q++  +  I +TA   +C    +E  ++  +  +KK  V  LN Y+ A   +  + T I+  LK+ +L+   +H  D++++L       V  ++WL QLRFY +     CVI+  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +         +N+  +  IFIT+NP   GY GR +LP+NLK +FRP+AM  PD+ LIAE+IL  +GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K + Q + T E V         ++ ++R   ++KLT  D   F ++++D+FPNI++  I+Y  L   +E+ I++  + S      K+ ++YE    R   +IVG +GSGK+  W++L+ +L+ + +        V+ + +NPKA+   +L G  D+ T EW+DG+L+   R    + +  + WI+ DG +D  WIE++NSV+DDN++LT+ +GERI     V+ +FE  DL+ ASPAT+SR GM++        K  V SWL+K+ + +   L    +    K L +       +    E++  TS +  +Y+ L+  +   N A            F   +I  +  +++E  R+    ++ E+ +   P  NK  V  Y+ + K     ++  +  +           KI+ P   T D  R  +Y    L ++ Q P +L GP G GK+ +     Q L S Q  V  ++ SAQTT  +V   +      +   T  VY P   + +I ++ D+N+P  D +G+   +  ++  I Y  +YD   + +       + +       GR+ +S R  S   + ++++P+K Q+  I+   +   L+    +  PI +  ++  L + NT+++ +    +K       HYLF   D+++    +LR +       ++++ L I  +E  R+F DRLV +   +   GI+ + +          S  D+ F      +          + K    LT    LK  ++  L +Y  S     + ++LF+E  +++ ++ RV+ +P G++LL G  G GR++ + L S + +      ++ + Y  ++F++D+K   + AGVE +    +  D Q  +  +LE IN++L+SGEVP LY  +E E I   + D A      ES    SL  Y  +R+++ LHI+L +      F    +  PA     ++ W  +W ++++L++    +  I  + G+Q   +    +  +T   ++  Y     L+L       + T   Y+  +  Y ++  +K+ E+  + N ++ G+ KI E              AK+ VAE + +  E   ++ +++ EAD+  K +T     A   K  +E++  +   +N       A  D E AL  P +++A  A+  +   D+ EI++   PP  +  +++ V+++ G  + +W   +  LG++   + +  FD   I+ +    ++++   C +  F P    R S+AA  L  WV+A   Y      + P     N     L   +  + + ++ + +V + +   +K +++  A   +L  + +     +  A  LV  L  E  RW + +  L  +L  L    LLAAA + YM     + R E + Q+W+ K           F +  FL    +  +W  +GL SD  S EN +++ +G     +IDP + A  W+KN    + L+I++ Q S++  +LE ++ FG  +++Q V + L+P L P+L   +   G R ++++GDK ++YN +F+ ++ T+   P   P+  A  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L+ +K ++  +++ LE S   +++ D  R+A+ P A+  S LFFV++D+  I+ MY+FSL +++ LF  +++ S  S     R   L       VY Y CR++F+  +L+F+ HM  C +           E+  F   G  +  +   +     W+ DA  D    +  L +    + S      D  WH +  ++  E+  +P   +N  +  Q++LI+++LR DR+   ++ F    L  + + P  +N+  + E  T    P++ I+SPG DP+  L +L+  +  ++R++ +++GQGQA I   LL +    G W+ L N HL  SW+P L+K +  L+   PH  FRLW+++ PH  F   +LQ S+K+T E P G+K N+ R Y   SE   S+     +    LFSL +FH+++ ER+ F+  GW   Y F+ +D      +L   + +      W  +  L     +GG V + +D R+L++YI  YF D  ++   +    ++   +P   S   Y   I+ L   + P  F    N D +SQ   +  +   L  LQ   +  T+      +RE        K+L    + +K  +P+ +    T        SP  VV   +++RYN+  L++ +  SL  L K ++G  +++  ++ +  C+     P +W + +   +    + R L ++ +  E WA  +        I  L     P  FL A+ Q +AR   +S+D L +   V     SN+    K  V +  L++EG  +D      C  ++  + L+  +        +    S   M S P YY         R   V  ID+   +   D WI+ G AL +
Sbjct: 1013 VLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEF--KGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGL-------FRRLTKLAKEY------KDRNWEIIETT---RSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMD--QHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRGTEE---VFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVK--EWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEA---IRGNLTKIMR-LKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNP---GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGK-------KRRLQPDLTDEEV---------LLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITS-LCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREI-EGSFP--NKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVP---TVDTVR-YNYLVSSLVAN-QNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESR---VEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKM------HYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWI--HECFRVFSDRLVDAADTEAFMGIISDKL---------GSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESS--DSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCL--IGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRH---NYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVT-----ANSEKIAVEEIKCQALADN-------AQKDLEEAL--PALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN-EPTWAEAKRQLGEQNFIKSLINFDKDNISDKV---LKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHM--CAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRD--WHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDST-PRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEET-PWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQP-QITPTRAGGQ--TREE-------KVLELAAD-VKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNT--LMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARP----PVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRK--NSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLM 4423          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1213.36 bits (3138), Expect = 0.000e+0
Identity = 962/3538 (27.19%), Postives = 1707/3538 (48.25%), Query Frame = 3
Query: 2787 ITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR----TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNL---------EKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWS-------QFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK-----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTA---RC----EELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDW-------IAKRNEFTISTSNVGTVYNGLSNLKAIKNKAH-----------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ--VTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKL-LANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTS-EYLKDTIDRGLLQY--SRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLAN-----ESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSY----FLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISE--------------AKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEK------TGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWI-DA--DRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQ---LPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD-------SP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYY------DILRDKIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            + ++C+ +K S+        +     LR+   G +  +  YL  + + +S+ PQ ++E+  +         D + + +QI    +   +L      V    ++ +  L  +W  F+  +   + M+++  E  KT ++     F++      + ++    G    + G   A     Q         EE   ++ NL          KD ++ + E +    + EI +D ++N   W        Q E  +T    L       FR    L +E+      K RN EI   T   + +I+ +K  +P++  +R   L + HW ++   +        E+ TL  I++   +  +H E I E++  A  E+ I  A++ +          +V Y D  ++ +   +E   +   + DNQ  L ++K S + + F+     WE  L+ + E ++ +  +QR+W+YLE IF     +  LP E + F +V+ ++++IM  +N++N  L      G+ + L  M   L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I  +   K          + M S DGE ++  + V +   VE+WLG++   M+ TL D L      LR   N+ +  +   ++  Q++  +  I +TA   +C    +E  ++  +  +KK  V  LN Y+ A   +  + T I+  LK+ +L+   +H  D++++L       V  ++WL QLRFY +     CVI+  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +         +N+  +  IFIT+NP   GY GR +LP+NLK +FRP+AM  PD+ LIAE+IL  +GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K + Q + T E V         ++ ++R   ++KLT  D   F ++++D+FPNI++  I+Y  L   +E+ I++  + S      K+ ++YE    R   +IVG +GSGK+  W++L+ +L+ + +        V+ + +NPKA+   +L G  D+ T EW+DG+L+   R    + +  + WI+ DG +D  WIE++NSV+DDN++LT+ +GERI     V+ +FE  DL+ ASPAT+SR GM++        K  V SWL+K+ + +   L    +    K L +       +    E++  TS +  +Y+ L+  +   N A            F   +I  +  +++E  R+    ++ E+ +   P  NK  V  Y+ + K     ++  +  +           KI+ P   T D  R  +Y    L ++ Q P +L GP G GK+ +     Q L S Q  V  ++ SAQTT  +V   +      +   T  VY P   + +I ++ D+N+P  D +G+   +  ++  I Y  +YD   + +       + +       GR+ +S R  S   + ++++P+K Q+  I+   +   L+    +  PI +  ++  L + NT+++ +    +K       HYLF   D+++    +LR +       ++++ L I  +E  R+F DRLV +   +   GI+ + +          S  D+ F      +          + K    LT    LK  ++  L +Y  S     + ++LF+E  +++ ++ RV+ +P G++LL G  G GR++ + L S + +      ++ + Y  ++F++D+K   + AGVE +    +  D Q  +  +LE IN++L+SGEVP LY  +E E I   + D A      ES    SL  Y  +R+++ LHI+L +      F    +  PA     ++ W  +W ++++L++    +  I  + G+Q   +    +  +T   ++  Y     L+L       + T   Y+  +  Y ++  +K+ E+  + N ++ G+ KI E              AK+ VAE + +  E   ++ +++ EAD+  K +T     A   K  +E++  +   +N       A  D E AL  P +++A  A+  +   D+ EI++   PP  +  +++ V+++ G  + +W   +  LG++   + +  FD   I+ +    ++++   C +  F P    R S+AA  L  WV+A   Y      + P     N     L   +  + + ++ + +V + +   +K +++  A   +L  + +     +  A  LV  L  E  RW + +  L  +L  L    LLAAA + YM     + R E + Q+W+ K           F +  FL    +  +W  +GL SD  S EN +++ +G     +IDP + A  W+KN    + L+I++ Q S++  +LE ++ FG  +++Q V + L+P L P+L   +   G R ++++GDK ++YN +F+ ++ T+   P   P+  A  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L+ +K ++  +++ LE S   +++ D  R+A+ P A+  S LFFV++D+  I+ MY+FSL +++ LF  +++ S  S     R   L       VY Y CR++F+  +L+F+ HM  C +           E+  F   G  +  +   +     W+ DA  D    +  L +    + S      D  WH +  ++  E+  +P   +N  +  Q++LI+++LR DR+   ++ F    L  + + P  +N+  + E  T    P++ I+SPG DP+  L +L+  +  ++R++ +++GQGQA I   LL +    G W+ L N HL  SW+P L+K +  L+   PH  FRLW+++ PH  F   +LQ S+K+T E P G+K N+ R Y   SE   S+     +    LFSL +FH+++ ER+ F+  GW   Y F+ +D      +L   + +      W  +  L     +GG V + +D R+L++YI  YF D  ++   +    ++   +P   S   Y   I+ L   + P  F    N D +SQ   +  +   L  LQ   +  T+      +RE        K+L    + +K  +P+ +    T        SP  VV   +++RYN+  L++ +  SL  L K ++G  +++  ++ +  C+     P +W + +   +    + R L ++ +  E WA  +        I  L     P  FL A+ Q +AR   +S+D L +   V     SN+    K  V +  L++EG  +D      C  ++  + L+  +        +    S   M S P YY         R   V  ID+   +   D WI+ G AL +
Sbjct: 1013 VLLDCSHLKFSLVQHCNEWQNKFATLLREMAAGRLLELHTYLKENAEKISRPPQTLEELGVSLQLVDALKHDLANVETQIPPIHEQFAILEKYEVPVEDSVLEMLDSLNGEWVVFQQTLLDSKQMLKKHKEKFKTGLIHSADDFKKKAHTLLEDFEF--KGHFTSNVGYMSALDQITQVRAMLMAMREEENSLRANLGIFKIEQPPSKDLQNLEKELDALQQIWEIARDWEENWNEWKTGRFLILQTETMETTAHGL-------FRRLTKLAKEY------KDRNWEIIETT---RSKIEQFKRTMPLISDLRNPALRERHWDQVRDEIQREFDQESESFTLEQIVELGMD--QHVEKIGEISASATKELAIEVALQNIAKTWDVTQLDIVPYKDKGHHRLRGTEE---VFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMILTVQRQWMYLENIFLGEDIRKQLPNESTLFDQVNSNWKAIMDRMNKDNNALRSTHHPGLLDTLIEMNTILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLRIQKVGGPSSKWEAVGMFSGDGEYIDFLHSVFLEGPVESWLGDVEQTMRVTLRDLLRNCHLALRKFLNKRDKWVK--EWAGQVVITASQIQWTADVTKCLLTAKERADKKILKVMKKNQVSILNKYSEA---IRGNLTKIMR-LKIVALVTIEIHARDVLEKLYKSGLMDVNSFDWLSQLRFYWEKDLDDCVIRQTNTQFQYNYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAHQILCILSALAAGLTHFHFDGFEINLVWSCGIFITMNP---GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGK-------KRRLQPDLTDEEV---------LLLSMRDMNIAKLTSVDAPLFNAIVQDLFPNIELPVIDYGKLRETVEQEIRDMGLQSTPFTLTKVFQLYETKNSRHSTMIVGCTGSGKTASWRILQASLSSLCRAGDPNFNIVREFPLNPKALSLGELYGEYDLSTNEWTDGILSSVMRTACADEKPDEKWILFDGPVDTLWIENMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAMASPATVSRCGMVYTDYADLGWKPYVQSWLEKRPKAEVEPLQRMFEKLINKMLAFKKDNCKELVPLPEYSGITS-LCKLYSALATPENGVNPADGENYVTMVEMTFVFSMIWSVCASVDEEGRKRIDSYLREI-EGSFP--NKDTVYEYFVDPKIRSWTSFEDKLPKSWRYPPNAPFYKIMVP---TVDTVR-YNYLVSSLVAN-QNPILLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESR---VEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRTKQTIKYIREMFLMAAMGPPGGGRTVISPRLRSRFNIINMTFPTKSQIIRIFGTMINQKLQDFEEEVKPIGNVVTEATLDMYNTVVQRFLPTPTKM------HYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWI--HECFRVFSDRLVDAADTEAFMGIISDKL---------GSFFDLTFHHLCPSKRPPIFGDFLKEPKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESS--DSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCL--IGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRH---NYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVT-----ANSEKIAVEEIKCQALADN-------AQKDLEEAL--PALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN-EPTWAEAKRQLGEQNFIKSLINFDKDNISDKV---LKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNMEGGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHM--CAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELDKLTNFHGLMNSFEQYPRD--WHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDST-PRSPLVFILSPGVDPTSALLQLAEHMGMAQRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEET-PWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALETYFIPKDGSLASYKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQP-QITPTRAGGQ--TREE-------KVLELAAD-VKQKIPEMIDYEGTQKLLALDPSPLNVVLLQEIQRYNT--LMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYPSQKPLAAWTRDLAMRVEQFELWASRARP----PVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRK--NSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLM 4423          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1204.5 bits (3115), Expect = 0.000e+0
Identity = 895/3263 (27.43%), Postives = 1580/3263 (48.42%), Query Frame = 3
Query: 3378 EHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKE-----DWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFR-----LLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLL---STMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDF------------------NKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFT---ARCEELLNENNIITLKKELVKKLNI-YTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLAL---------NKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWL----KKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTIS---TSNVGTVYNGLSNLKAIKNKAH---------------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEM---NKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ---VTTLHCSAQTTPVHVLQKLNQACIIINSNTGR----VYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSN-LEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVD-----DYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTI--HSEWSVEVQDSLNDVW----FVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANE----SGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAK---PKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEK----LTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT-GLE-----KFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLM--FALHMSHCCRPDLFKPQEWELF-TGTFISDKSDRNITVPKWIDADRTVAISNLASAMP----------------ELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNK--------LSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPH----KD-FRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTR-ANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFN------DSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVI-LQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLK-RSSTDSPVVAFLQ-------------LERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF 12671
            ++F++E  +F  LEE+  ++   QL+W  F E+    Q   K      D      +   + +F+TQ  + L    +     +L+ +++  K+ +P++  +R   L   HW  + +     L++    LTLE L+  H+ D   EI       ++++ +A GE  +   ++++E       F ++ + DS++  + ++    DI   + D+   + +L  S Y    + +   W+ +LA  ++ L+     QR W+YLE IF     +  LP E   F +VD+ ++ IM  VNR    L   +  G+       + ++DQ+Q+C   L  YLE KR +FPRFYF+ +D+LLEIL Q+ NPQ ++ HL+K F  I  ++F                        I+ M S +GE V L   +     VE WLG +   M T+L      A+ D +   ++++ +    +PSQ++     I +      C E  + N+I  LK    +K+N    NA  ++   S   +H   L +LI   VH  DI+ +L+    ++V  ++W +QLR+Y       CV +M  +++ Y YEY G  P+LV TPLTD+CYL L   + + LGG P GPAGTGKTE+ K L      Q +VFNC +G+D K MGR F GL + G+W CFDEFNR++  VLS ++ Q+  I++    K+       R + +    A FIT+NP   GY GR +LPDNLK LFRP AM  P+  LIAEVIL S+GF+++K L RK+  ++ L  E L+ Q HYD+G+RA+K+VL  A +L        K +  D  E+V        ++++AL+ + L K    D + F  +I D+FP + I E +Y  L S I +V+  QN+       +K+++ YE +  R GV++VGP+G GK+T++++L   L         N   Q VK YV+NPK+I   +L G ++  T EW DG++  S R  V +  E   WII DG +D  WIE++N+VLDDN++L + + ERI+  P ++ +FE  DL  ASPAT+SR GM+F+  E       V +W+    KK  E  Q  +      +  + L +I K+    I     S V T+   L +L   K+  +               F  C +  LGGNL EN  ++F  ++    D+  P+    N  ++ + + +    RL  +    E  +   +   D      L+ T D  R     +  L    +   + +G  G GKS++      K++         L+ SAQT+     +       II S   R    +     ++R+++++ D+N+P+LD++G+   I  L+Q   + GFYD N L +  +  V I+ S  +    GR+ ++ RF     +  +  PS+  L  I+ A L   L    P          VK  A++++E   ++ +K +VD       SHY+F   DL++ V  +L+ D     +   + +  +  +E  R+F DRL++++ +     IL      H   +++++  LN       F+ +G+ +        P   K     T+  L+D +D   L   +E +   ++ F++  ++V+++ R++ +  G+ LL G  G G+++ + L +H+   K +  ++ RGY    F  DL+   + AGVE +++V L  D Q +  ++LE IN++L SGEVP L+  +ELE +L + +  A E     G+R  +  YF  +++  LHI+L M      F   C+  P+    C++ W  QW R+++L +     +++  + G++  +           L+ S     Y+ +L       ++T   Y+  I +Y+ +  +K+ +I + ++ ++ G+ K+ E   +V ++K   +    +L  K  + +  ++K+    + A + +  +++      VK  E   I    +  +D+ L    P +  A  A+  +  +D+SEIR    PPD++  ++E + +++      W S +  LG     + +  +D   I  +   ++++ +      F P+  ++ S A   +  WV+A   YS  ++ + P   +    +  L+     +++ +  +  V+  +   + +++K   +   L   +      +  A  L   LE+E  RW + I +   E+S +T    +AAA V Y  +     R+  ++ W++    LE      F +   L    E  +W  +GL  D +S EN +++ QG   P +IDP   A  W++N      L+I+   DSNF  +LE S+R G  ++++E+ + L+P L P+L   +   G R +++LGD  IDY+ +F+ ++ T+ P P   P+    V+ +NFT TK+GL+ QLL+  ++  KP+LEE++  L+      K +L  +EE +L+ L  + GNIL+N++L+ +L  +K +S  I   LEE+   +  ++  R+ + P+A  GS ++FVI+ LS+I+ MY++SL  F +LF   + TS  + +   R   L+       Y  V R +F+  +L+  F L +    +       EW  F  G+   +K         W+      A  +L  + P                 L S     +   W  ++K    ++ + Q  +          LS F K+++I+  + +++  AL+ F  + L  + +    ++L  +Y+  +  N P++ I+S G+DP    Q  + +   SER   +++GQGQ  I   ++    ++G+W+ L+N HL  SW+  +E+ + +        KD FRL++++ P   F   +LQ+S+K+T E P G++ N+ R++   +  F  +   G +    +F + +FHAIIQER+ F P GW   YEF+ +D       L    K+    I W  +  +     +GGRV + +D R L + +KR+F+      D   + SG ++     P A S +++   I  L   + P  F + +N +   Q   +S +I   L +  R S  G     D             +I+ + +  ++  +P+ L+   +++S  V  LQ             ++R+N+  L+K +H+SL +L+K + G  ++++E++ +    L  Q P +W        +P   +++ LIL+   V+ W +  +          +   F P  FL    Q  AR   + +DEL F
Sbjct:  867 KNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPNSVVP---QLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLSQLHVFDFGQEI-------QDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKD--VFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKC---LEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAG--HPSQVILTVSQIMWCRDLTECLETEHSNHIQALKN--FEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNP---GYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSL--------KRENPDLNEDV--------VLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMKGISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESLILGKDGVNLAMEQTKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDD-NPDARLPNSGDLWSIHMDFDTKRLDPW----ERIIPTFKYNRDVPFFEMLVPTTDTVRYGYLMEKLLA--VKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQE-------IIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTII-SACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLSDFPP---------AVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREE--IQIFRLFCHECQRVFHDRLINNEDKHYFHVILTEMANKHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEK-----TANVLQDYLDDYNLTNPKEVK---LVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEQVLAATRPRAKEVGISEGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQV--DAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRY---YTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEAL----PALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNA-KPDWPSAKQLLGDSNFLKRLLEYDKENIKPQILAKLQKYIN--NPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQNILSHPISIRLGSFETYINPQKWEGYSKMKHEDKHMRQEKEAAHQDPWSAGLSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMS-CNTPLVFILSTGSDPMGAFQRFARESGYSERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKEG--KIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLEEDYKYSESGIYFA----PMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSND-------------EIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNN--LLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYW-----ISGFFFPQGFLTGTLQNHARKYNLPIDELSF 4018          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 2952.54 bits (7653), Expect = 0.000e+0
Identity = 1713/4317 (39.68%), Postives = 2631/4317 (60.95%), Query Frame = 3
Query:   99 SKIEDQRKDTIFLITKSHFPNQN---SKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNA--LVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDTDPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHR---ERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRL-FQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTL-PWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLN-ENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSR-HYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGL-EKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSY---DNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGN--FYGKIQLPSAASKRDYLAIINQ-LSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            S  +DQRK T FL   S+    N    K  + E L+ F D+ + N+LV    + K   SN++ ++    N   +VF KT    +  DN  S + V + +          +QN++G  L    + ++   ++ELE  L + +                + G  S+ DEI  W       ++D      NE    LQ + E M+  + + L+E     E+     +++W   T    YPQ+RMK L+E  A+ L   I  +++    W +    V + L  AI+VC   + +   L  + WK+ + H W  D  + + +++ F+ RL EI SL+++  Q+ ++L  R   E  E  IE A +    + PLAYNP+TEP WK  +    R IE     I   L ++ +  A A    Q + L  ++    + R  I   L  ERE  L +LV    Q  ++F  +S Q      +  ++  ++IVW +Q  +++  I S++  +L ++  +  F  +   F+E++    +E F+ W +E T  L D+ N+ I L+  G++M L   +  L VNYSDRL+ L++EVR L  LG++I   +++ A+NG+K+Y   VILKQ+A FYNTI+ QMIP QQ++ML+ AI FEKLV      S + + V WN+P++L +FI +LQ A   + ++NR LR  H  + E +  LM +++++Q  +WK+ + +IR  + + E      +N + PW  H D QLYKAL  QY  G+E++   L  I V LV+   ++Q  PT EEI+SKY+KE+ +F+ +P++F+G+ +     +  +  +IER+       Y+KAE L  ++  C   F +W+++  +DLEE ++++     D+E  FK +K K +EAE+LP+E+K +CI V+ A +K +++  IQ ++DAL  +LR +I  T  S+  +L+ +I++L+  PQ+IDEIAEA   H  F ++  R++ +    E+   LLR+VAG G++ +  L+Q WD+FELM++  Q M+++Q+EV+K+N+ +  K  + +  K   RW+  KP  D L  G  +  L A+Q IK+K+++ ++L   +  +EK+C  F +EP +  +++EI +DI Q +  W  +E +   L  +++E+W+ FRS+ YLF+EFL +W EKL+     T M++RL K+++ +K++   LK+ RG+ LS DHW EMFR L +PRG T+E L    +L  +  II + + +K+LN +AQGEV IR+AI+EL LW A   F L +Y  S   ++ +IKEW++ I+ + D+Q LLQSLK SPYY  F DK AVWE +LADLD +L  +N+IQRKW+YLEPIFG+ ALP E SRF RVD ++R+I++DV+++ R++SLCS   +K  L  ++DQL RCQKALN++LE+KR+ FPRFYFIGDDDLLEILGQSTNPQVI++H+KKLFQGI  V F+   + II+M S +GE V L   V I  +VE+WL  L++EM+ TL D  + A+ D + S          KYPSQ+LCL+E + F+A  E  LN  +++ + K +L++KL  YTN K+         V DLKLKSLILD +H+ID++DQLL    +S+  W W +QLRFY    + G V++ V +EF YTYEYQGN  KLVHTPLTDKCYLTLTQ M+MGLGGNPYGPAGTGKTESVKAL +L GRQVLVFNCDEGIDV SMGRIF G+V+CG+WGCFDEFNRL+  VLSAVSMQIQ IQ  IK++    T   + V V+ NSAIF+TLNPAGKGYGGRQK+PDNLKQLFR V M +PDN+LI+  IL S+GF +A  L RK+V++F LSR++L+ QQHYDWGLRALK VL G   L        +TQ N           ET L+VQAL +NTLSKLT++D   F SLI D+F N+  +  +++ L   +    +E  +     Q +K+ ++YEQ+RQR+GVV+VG +GSGKSTIWK+L+ +L    + +K    NPKA+ R++LLG++D+DTREWSDG++T +AR+V K+   +  WI+CDGDIDPEW+E+LNSVLDDNRLLTMPSGERIQFG NVNF+FET  L  ASPAT+SRMGMI++S E    K +V SWL K  E     + +++++ F++ L W+  R+      ++   + NGL++LKA K K  F V L  G    +   +R+ FA  V          M+  +  N  ++E+ + +++Y+ +  + ++ +++  +++ L P + TAD QR  D    WL S  ++ F+++G  GCGK  +L HCFQ     Q+ +L+CSAQ++  H+LQ + Q C+  ++ TGRV+RPK+   +IL+LK INLP  DK+GT++L++ LQQ++TY+GF+D NLE+V ++ +Q V SMN        S+S R  S++R  S++     QL  IY  YL P+L+       +  +NS++  +AN M+++Y++++S F   D   +LF+P DLT WV+SLLR++L          L  ++ +E+ RIF DRL + + + + + IL N I    + E       V +VT G+  P  +    P+   ++    ++ L  +I+R    ++ E  + +  L  ++    A +DRVLT PGG + L G+ G GRR +  LV+HMHNI++ SP +   +  KQF N+LK+ +  A    EH+VL+LEDHQ  +  +L+ INSLLASG VPGL+T +EL+ ++  + + AN++   G+L  + A RI+  +H++LI++    +F IN   NPA  K+C+V + +++ R+S+++IP     KI  E               +T +D + + F D+    P   S     Y  F++ + ++   K+  +  R   ++ G+ K++EA++ VA+++ KA ++SKLL EKQ EAD+ALK IT  M GA ++K  ME+L   T +ENV + ++KA ID++L  ++P + +AR AV  IKS  LSEIR+LRAPP+ +RDIL+ VLL MG +DTSW +MR FL K G++++I  FDA RIT E   +V  L+ +  +SF+  NAKRAS AAAPLAAWVKAN++YS  LEKIAPLE E+N+L +NL+ AEK+M++L KG+  VD+ V   ++ FE    +A +++ +L    +TI  A  LV  L  EFERW  QI     E S + + SL+ +A + Y+    E  RK  ++   +   +   F    F + E EQL WK +GL +D+LS+EN  ++      P +ID S   + +L    +  K E       +  T +EL++RFGKT+II ++   +  L P+LR DL SQGPRQV+  G K ID+NPDFK++  TR+ +  + P++   ++ VNFTTT + L  QLL + +   KP+LEER ++LL++ E  K+EL  +E+ LLQ+LA++ GN+L N  LL SLNK+KES+  I++S+ ES +L   L  ++D ++PL+   SSLFF  S+L   N MY +S+ + + LF + + + E    S+ R  +L   ++  V+ ++ R IF+ DRLMFA+   +   P +F+P+EWELFTG  + + +D +    +WI  DR  +++ + + +P L++   I+DD  W++F+K+ +CE   P++++ K++ FQK+L IQA++P+RL + L  F    L +  ++P +  L  I++ E+ S EPIL I++ GADPSQ+L E ++ +  +  Y+ ++MGQGQ       + + +  G+WLCL NLHL+   +P + K L+   PH++FRLW+T E    F +++LQ SLKIT+E PPGV+NNLLR+Y   D  +++ I+         ++F LAW HA++QERR FIPQGWTKFYEF  +D+R     ++Q+   +     W+F+ G+ +  I+GGR++N FD +VL SY+   F D  +NG         I L +  + ++Y+  I++ +   + P  F LP+NI  S Q + + + I  +R L   ++  TK      S +++ +++ WK L Q  ++ K  LP +++ +    P+   L LE  N++ L+K +H S+  ++K +K   L +  VQ   + L+  QTP+ W   W GP +P DY+ +++ K +   +  E S+   LLS+ +D  +LF+P+ FLNALRQ T+R IKI +D+L     W  S + AK  V++  L ++G  FD + + E    S +    P V + W   ++ +S    + I +P+Y    R  ++  +++PC+    D+W  + VALFL+
Sbjct:    3 SDSKDQRK-TYFLRVASYLLGLNIVEEKLKSTEPLEIFLDS-NTNLLVFSRSEQKLELSNKMKSSAPSANVFRVVFYKTQSVPLNNDNFKSVVNVISANGTLNHVFLKSVQNVFGKELTEGNNMQLIAAVNELEESLLATVE---------------MSGGGSLHDEIRSWKGQTGKPAND-----YNEAFKQLQLLVETMEERSIDELSELVECFEDT---CDELWNCGT---PYPQNRMKMLIEYGASYLCETITFKIDDSAIWRNDK--VADQLRSAIDVCDQMLIIVRLLTAQTWKRNVEHTWEGDA-MEMKFLNGFKDRLDEILSLKSLGGQLEELLEERGVREETEKTIETAMR---GMAPLAYNPFTEPNWKSRLLVSERSIE---GTIDRTLPILKQRLAPANGDSQSIVLSLEKLKSFLCRSNIKEKLQHEREMFLNRLVSMLSQKNQEFNEKSLQVDAKNFQFLTEVAARIVWIRQQTSQMESIRSLSKMMLNNISNYSAFASKLDEFIEKLQYAEKECFDDWCRE-TVGLIDNKNETINLETTGKIMYLEASNRELNVNYSDRLLRLLKEVRQLISLGFNIPSKIMSCANNGEKYYRFGVILKQIAHFYNTIDQQMIPSQQSLMLEEAIAFEKLVIPRKDASNSASKVTWNDPKQLEEFIVQLQSAEQKLSNRNRRLRNVHMELIEMVEKLMDLNIVKQNNEWKEIILKIRSKMKEEEIVHGAVKNNMKPWLIHWDFQLYKALLIQYEWGIESIQSQLSTISVSLVFADQKIQLRPTIEEIRSKYYKELCRFLRIPDKFRGVQEDENSTKF-YAQMIERSMHLLPTVYEKAEQLMMKVETCDAIFVDWLVISQVDLEELIEENLKTAADWESQFKILKGKAREAERLPHELKFECILVSTAGVKSAIEDAIQRLYDALSWTLRHSISTTSQSISTFLSQAIEVLNTVPQSIDEIAEANAKHVIFAENNRRLKEEWKVMEEQLTLLRSVAGTGMEQIDNLEQTWDRFELMLDGHQSMIKDQVEVLKSNVETSVKGMKDEAEKLKARWEQFKPRNDALQ-GDREEMLKAIQFIKEKRVQWQQLSDGREKIEKECGQFGLEPPKMDIIDEIDEDIKQFEDNWLIYEMFNNELDTMSQEEWIVFRSKTYLFDEFLQKWMEKLKGTGSQTHMSVRLMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALLQSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGRGALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSSEGETVPLSKAVRIVPQVESWLQELSDEMRRTLKDLTAQAVADAQPS--------LAKYPSQVLCLAEEVKFSASIENNLNGSSDLNSFKSQLLEKLKAYTNMKVDDK------VSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYL--VNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGAL-------RRTQTNKN---------ETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLILTKKPLKVTQFNPKAVNRSKLLGNMDMDTREWSDGIITMAAREVTKDTS-VHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWLVKTTEDLHADMPSWIEEHFWRCLKWV--RSHKISGITSFAILKNGLTHLKASKTKTQFLVLLFNGFLPTVTPENRQEFAKGVV------FQGMSVPDPKNICYDERIDGIMSYTDDVSQNVTKEEV--EREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQLASLYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFDHNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEE------VGERNSEI--IANRMVDIYNKVQSNFRPTDSVVFLFSPRDLTNWVVSLLRHEL------DQGKLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKEKV-YVTTGTVVPGESNTGLPLTPINMSDF-NQLLAKSINR----FAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASFTGALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIP-----KIQMESQG------------ITTTDAILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSMCKMFNMPPTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLE--KSETFKAAQPDLMTQIELAIRFGKTIIIDDIVEFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCE--DKSSTRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATMPKMFQPKEWELFTGVLVDESTDLSALRVQWISPDRLQSLARIRTHLPSLFNNFQIQDDATWNEFSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQ-ESESTEPILFILADGADPSQELSEFASSM--NVPYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLSLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDRSTKNVIT-------CQSIFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQL---TANKADWEFVRGILKFVIYGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTL---ALGDTKNALSDQSDKISQIVSLWKKLCQSDDLPKRELPTAIRSA---DPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDFSDLFYPNIFLNALRQTTSRQIKIPLDQLILSSAWTPSQLPAKQCVQVQGLLLQGATFD-SFLRETTVSSAAYSQAPIVFLAWT--SESSSTITGEQIQVPVYSSSERSDLICSVNMPCRGA--DQWNIAAVALFLR 4171          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 521/2030 (25.67%), Postives = 1010/2030 (49.75%), Query Frame = 3
Query: 6894 LILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKE-SERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEW--SVEVQDSLN-DVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIP-----YMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMG-TMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEK---TGLE-KFDMRK--FLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEIS--TDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHC-CRPDLFKP---QEWELFTGT--FISDKSDRNITVPKWID-----ADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIP---QSLKNKLS----LFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSS-MNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILD---QIIKKSNRNIQ-----WKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFN------DSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQ-LRILQR---FSVHGTKFDKDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEE--PFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGC 12746
            ++ T D  R+      WL     +P +L GP G GK++ L    +  + ++V  ++ S+ TTP  +L+  +  C    +  G V  P + S+ L+++  +INLP  DK+GT ++ISFL+Q++   GFY  S+  +V L+ +Q V + N  +  GR  +++RF   V +  + YP +  L  IY  + + +LK       +  Q      L N M++VY   +  FT DD  HY+++P +LT+WV  +     P+ S  +A  L+ + ++E++R+FQDRLV+ + R+  D ++  T    +  +  + ++L   + +  W SR                  +T E L+D +   L  +  E  D+ ++LF ++ D+V ++DR+  +  G +LL G +G G+ T S  V+ ++ + +   K+H  Y    F  D+++ L+ AG   E +  ++++   L+  +LE +N+LLA+GEVPGL+  +E   ++  +K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS +++ ++       M +++   E   +LT +     +Q T  D + +    +H T              V   T RH+++FIK ++ ++ +K++++E  + H+ +G+ KISE +E V EL+     +S  L EK+  A+  LK++    Q A E K   E+L  +  E+   +A++K  ++++LA +EP V +A+ AV  IK S L E++++ +PP  ++  LE + +++G  + T W ++R  + K      I  FD   +T E   Q+E+ +      FD  N  RAS+A  P+  W +A + YS  L K+ PL NE  +L++      ++ K ++  ++++++++  Y++++ +    A  ++ +L +  E ++ + +L+  L +E +RW+      + ++ +L   +LL++A + Y     +  R E    W       GL  + D+ +  +L+T  ++L+W+   L  D+L  ENA+++ +    P +IDPS  A  ++   F  + ++  +  D +F   LE ++RFG +L++Q+V+  +P+L P+L  ++   G R ++ +GD+ ID +P F++F+ TR+   +  PD  + V+ VNFT T + L  Q L   ++  +P +++++ +LL+ + +  + L  +E++LL  L  + G IL++  ++ +L K K  +  ++Q   E+ K+   +D     +  L+   S ++  +  L++I+ +Y +SL   + +F   L T E+S  TD   R   +   L + V+  V R +  +D+++ AL +     R +   P   Q ++L  G   F++   + + T+P  +D       +++A +        +++ L   +      +  +   E  +P        KLS        ++++ ALRPDRL ++  +      +   +     +++  I ++E   +EP+L+  + G D S  +++L+ +   + +   +A+G      QAD  L      +++G W+ LKN+HL  SWL  LEK L+S+KPH  FRL++TAE H    + +L++S  + +E   G+K NLLRS  +     ++K  +  R+     + W HA++QER  + P GW+  YEFS ADLR   + LD     + +   N++     W  +  L    I+GG++DN FD  +L   ++  F       D V+    +    +  P+ + K   +  + +L +   P++  LP+N ++         ++   L++      F+  G +  K  W  +L  +  +W ++L + +  ++ ++       +   P+  F + E     +L+K +   L  +S V +  +    E + L+  L  G+ P  W +++  P E    D+M  L  + K + +   +   D L      LG  F P+ ++ A RQ  A+    S+++L      G ++ +  +  +I  + I G 
Sbjct: 2510 VVPTIDTVRHEMLLAAWLAE--HKPLVLCGPPGSGKTMTLLAALRSQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQ------LTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLES-LSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYV--------------PVTREELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVN--RASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQ-HNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET--NRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPT-ERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTV------ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGW-KRYTVPREVTVMDWMTDLNERLKQLIR---IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVF--RISGIDIRGA 4495          

HSP 2 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 404/1072 (37.69%), Postives = 625/1072 (58.30%), Query Frame = 3
Query: 3372 DCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIR----LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVE--NWLGNLNNEMKTTLSDQLSYALQDL-RMSNQS----NYGINADKYPSQILCLSEMIHFTARCEELLNEN-NIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKD----QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIK-NKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMV--SLKGQH-----KKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKF-YVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQV---VKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWL 6488
            D  H   E ++ T+  E   ++   + +W   +   TG+    ++ WLS + R     + L +   +L+   +   T +    +++ +  Y  +  ++  ++ E L + HW +M +   M     L  LTL  + DA  +I+RH   IK++   AQGE+ + E +RE+  +      +LV Y     N   LIK W D+ +++ ++Q  L ++K SPYY+ F++ A  W+ KL  ++        +QR+WVYLE +F  +A     LP E SRF  +  D  ++M  V  + R+L + +M G + LL  + D L + QKAL EYLE +RS FPRFYF+GD+DLLEI+G S +   I+ HLKK+F GI  +D N++ + I    S +GE V+L  +++ T +V   +WL  L  EMK TL+ QL+ +L    +M+ Q+    +Y    DK+P+Q++ L+  I +    E+ L +      +++ +VK L +  ++ +         +   K+++LI + VH  D   +L+    ++  ++ WL+ +RFY   K     + CV++M +++F Y +EY G   +LV TPLTD+CYLT+TQ +H  LGG+P+GPAGTGKTESVKALG   GR VLVFNCDE  D ++MGRI +GL + G+WGCFDEFNRLEE +LSAVS QIQ IQ+ ++      + L+ +R+NV+ N  IFIT+NP   GY GR  LPDNLKQLFR +AM++PD  LIA+V+L S GF+ A+ L  K+V +F L +E L+ Q HYD+GLRALK VL  A N+    + K+   G+  +E+V     E ++++Q++    + KL   D     SL+ DVFP I     +   L   +  V  E  ++   ++G+       K+L++Y+      G+++VG SGSGK+  WK+L  AL +        +V++ KA+ +  L G +D +TREW+DG+ T   R++   V+   + + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  IFE  DL  A+ AT+SR GM++ S E    + L   +L
Sbjct: 1275 DSAHAPSEGDKLTVATE---ELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRK--IRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMK--EMRVNWNLSDLTLGQVWDA--DILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLV-KIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPP----IRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNP---GYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNI---KRDKLDKMGSAALEDVA----EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYL 2318          

HSP 3 Score: 72.4034 bits (176), Expect = 1.201e-11
Identity = 99/439 (22.55%), Postives = 172/439 (39.18%), Query Frame = 3
Query:  789 YPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLI---------------KRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPH---------RERQEFKIEE-------------AFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIH-RSRQG-KVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVL-----KDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRR---LDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQ 1964
            YP  R   L+E I+ +L   +   L+         A   E ++Q   + S W D  DK I               K  WK    HK               + RL +I   R  HEQ   ++           RER++  I+              A+++  N+  L  +    P W+ A K++   I   ET I TRLK    +  S+    ++  +F RYN L  RP+I   + + +  L+ ++     +L+  F   R  QG K+  T       +KI+W +  E +L   +    +VL       +DG  +   +  NF  +++   Q  F++W + +  +   L +      R+ + GR M+L      L +NY      L +EV  L  +G+ +   ++  A    +    A  L + A+ + ++N  +   Q
Sbjct:  368 YPLQRALRLVEAISRDLNSQLLKVLSSYNLMRTPIAEFNEIMSQCQALFSKWDDEYDKFIALLRDINKKKRDDPSKLSWKVTAVHK-------------RLETRLMQILQFRKQHEQFRTVIERVLRPVGNGSREREQLMIDSSEGEKSPDEQVDIAYEFLKNVDFLDVD---SPAWENAFKRYEDQIGVVETAITTRLK---SQLESSRNSNEMFSIFSRYNALFIRPRIRGAIYEYQTRLINRVKEDINELQARFTKARGEQGVKIMQTVGLPPFSAKIMWIRNYERQLQRYMKRVEDVLGKQWENHVDG-RQLKADGDNFKVKLNT--QPMFDEWVESVQSQNWTLPNKILTVDRVQVDGR-MQLQ-----LKINYHSDSSVLYKEVSHLKSMGFRVPLKIVNWAHQANQMRPSATSLIEAARTFASVNAALASVQ 778          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 521/2030 (25.67%), Postives = 1010/2030 (49.75%), Query Frame = 3
Query: 6894 LILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKE-SERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEW--SVEVQDSLN-DVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIP-----YMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMG-TMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEK---TGLE-KFDMRK--FLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEIS--TDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHC-CRPDLFKP---QEWELFTGT--FISDKSDRNITVPKWID-----ADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIP---QSLKNKLS----LFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSS-MNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILD---QIIKKSNRNIQ-----WKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFN------DSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQ-LRILQR---FSVHGTKFDKDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEE--PFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGC 12746
            ++ T D  R+      WL     +P +L GP G GK++ L    +  + ++V  ++ S+ TTP  +L+  +  C    +  G V  P + S+ L+++  +INLP  DK+GT ++ISFL+Q++   GFY  S+  +V L+ +Q V + N  +  GR  +++RF   V +  + YP +  L  IY  + + +LK       +  Q      L N M++VY   +  FT DD  HY+++P +LT+WV  +     P+ S  +A  L+ + ++E++R+FQDRLV+ + R+  D ++  T    +  +  + ++L   + +  W SR                  +T E L+D +   L  +  E  D+ ++LF ++ D+V ++DR+  +  G +LL G +G G+ T S  V+ ++ + +   K+H  Y    F  D+++ L+ AG   E +  ++++   L+  +LE +N+LLA+GEVPGL+  +E   ++  +K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS +++ ++       M +++   E   +LT +     +Q T  D + +    +H T              V   T RH+++FIK ++ ++ +K++++E  + H+ +G+ KISE +E V EL+     +S  L EK+  A+  LK++    Q A E K   E+L  +  E+   +A++K  ++++LA +EP V +A+ AV  IK S L E++++ +PP  ++  LE + +++G  + T W ++R  + K      I  FD   +T E   Q+E+ +      FD  N  RAS+A  P+  W +A + YS  L K+ PL NE  +L++      ++ K ++  ++++++++  Y++++ +    A  ++ +L +  E ++ + +L+  L +E +RW+      + ++ +L   +LL++A + Y     +  R E    W       GL  + D+ +  +L+T  ++L+W+   L  D+L  ENA+++ +    P +IDPS  A  ++   F  + ++  +  D +F   LE ++RFG +L++Q+V+  +P+L P+L  ++   G R ++ +GD+ ID +P F++F+ TR+   +  PD  + V+ VNFT T + L  Q L   ++  +P +++++ +LL+ + +  + L  +E++LL  L  + G IL++  ++ +L K K  +  ++Q   E+ K+   +D     +  L+   S ++  +  L++I+ +Y +SL   + +F   L T E+S  TD   R   +   L + V+  V R +  +D+++ AL +     R +   P   Q ++L  G   F++   + + T+P  +D       +++A +        +++ L   +      +  +   E  +P        KLS        ++++ ALRPDRL ++  +      +   +     +++  I ++E   +EP+L+  + G D S  +++L+ +   + +   +A+G      QAD  L      +++G W+ LKN+HL  SWL  LEK L+S+KPH  FRL++TAE H    + +L++S  + +E   G+K NLLRS  +     ++K  +  R+     + W HA++QER  + P GW+  YEFS ADLR   + LD     + +   N++     W  +  L    I+GG++DN FD  +L   ++  F       D V+    +    +  P+ + K   +  + +L +   P++  LP+N ++         ++   L++      F+  G +  K  W  +L  +  +W ++L + +  ++ ++       +   P+  F + E     +L+K +   L  +S V +  +    E + L+  L  G+ P  W +++  P E    D+M  L  + K + +   +   D L      LG  F P+ ++ A RQ  A+    S+++L      G ++ +  +  +I  + I G 
Sbjct: 2510 VVPTIDTVRHEMLLAAWLAE--HKPLVLCGPPGSGKTMTLLAALRSQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQ------LTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLES-LSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYV--------------PVTREELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVN--RASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQ-HNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET--NRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPT-ERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTV------ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGW-KRYTVPREVTVMDWMTDLNERLKQLIR---IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVF--RISGIDIRGA 4495          

HSP 2 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 404/1072 (37.69%), Postives = 625/1072 (58.30%), Query Frame = 3
Query: 3372 DCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIR----LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVE--NWLGNLNNEMKTTLSDQLSYALQDL-RMSNQS----NYGINADKYPSQILCLSEMIHFTARCEELLNEN-NIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKD----QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIK-NKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMV--SLKGQH-----KKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKF-YVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQV---VKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWL 6488
            D  H   E ++ T+  E   ++   + +W   +   TG+    ++ WLS + R     + L +   +L+   +   T +    +++ +  Y  +  ++  ++ E L + HW +M +   M     L  LTL  + DA  +I+RH   IK++   AQGE+ + E +RE+  +      +LV Y     N   LIK W D+ +++ ++Q  L ++K SPYY+ F++ A  W+ KL  ++        +QR+WVYLE +F  +A     LP E SRF  +  D  ++M  V  + R+L + +M G + LL  + D L + QKAL EYLE +RS FPRFYF+GD+DLLEI+G S +   I+ HLKK+F GI  +D N++ + I    S +GE V+L  +++ T +V   +WL  L  EMK TL+ QL+ +L    +M+ Q+    +Y    DK+P+Q++ L+  I +    E+ L +      +++ +VK L +  ++ +         +   K+++LI + VH  D   +L+    ++  ++ WL+ +RFY   K     + CV++M +++F Y +EY G   +LV TPLTD+CYLT+TQ +H  LGG+P+GPAGTGKTESVKALG   GR VLVFNCDE  D ++MGRI +GL + G+WGCFDEFNRLEE +LSAVS QIQ IQ+ ++      + L+ +R+NV+ N  IFIT+NP   GY GR  LPDNLKQLFR +AM++PD  LIA+V+L S GF+ A+ L  K+V +F L +E L+ Q HYD+GLRALK VL  A N+    + K+   G+  +E+V     E ++++Q++    + KL   D     SL+ DVFP I     +   L   +  V  E  ++   ++G+       K+L++Y+      G+++VG SGSGK+  WK+L  AL +        +V++ KA+ +  L G +D +TREW+DG+ T   R++   V+   + + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  IFE  DL  A+ AT+SR GM++ S E    + L   +L
Sbjct: 1275 DSAHAPSEGDKLTVATE---ELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRK--IRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMK--EMRVNWNLSDLTLGQVWDA--DILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLV-KIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPP----IRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNP---GYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNI---KRDKLDKMGSAALEDVA----EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYL 2318          

HSP 3 Score: 72.4034 bits (176), Expect = 1.201e-11
Identity = 99/439 (22.55%), Postives = 172/439 (39.18%), Query Frame = 3
Query:  789 YPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLI---------------KRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPH---------RERQEFKIEE-------------AFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIH-RSRQG-KVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVL-----KDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRR---LDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQ 1964
            YP  R   L+E I+ +L   +   L+         A   E ++Q   + S W D  DK I               K  WK    HK               + RL +I   R  HEQ   ++           RER++  I+              A+++  N+  L  +    P W+ A K++   I   ET I TRLK    +  S+    ++  +F RYN L  RP+I   + + +  L+ ++     +L+  F   R  QG K+  T       +KI+W +  E +L   +    +VL       +DG  +   +  NF  +++   Q  F++W + +  +   L +      R+ + GR M+L      L +NY      L +EV  L  +G+ +   ++  A    +    A  L + A+ + ++N  +   Q
Sbjct:  368 YPLQRALRLVEAISRDLNSQLLKVLSSYNLMRTPIAEFNEIMSQCQALFSKWDDEYDKFIALLRDINKKKRDDPSKLSWKVTAVHK-------------RLETRLMQILQFRKQHEQFRTVIERVLRPVGNGSREREQLMIDSSEGEKSPDEQVDIAYEFLKNVDFLDVD---SPAWENAFKRYEDQIGVVETAITTRLK---SQLESSRNSNEMFSIFSRYNALFIRPRIRGAIYEYQTRLINRVKEDINELQARFTKARGEQGVKIMQTVGLPPFSAKIMWIRNYERQLQRYMKRVEDVLGKQWENHVDG-RQLKADGDNFKVKLNT--QPMFDEWVESVQSQNWTLPNKILTVDRVQVDGR-MQLQ-----LKINYHSDSSVLYKEVSHLKSMGFRVPLKIVNWAHQANQMRPSATSLIEAARTFASVNAALASVQ 778          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 521/2030 (25.67%), Postives = 1010/2030 (49.75%), Query Frame = 3
Query: 6894 LILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKE-SERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEW--SVEVQDSLN-DVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIP-----YMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMG-TMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEK---TGLE-KFDMRK--FLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEIS--TDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHC-CRPDLFKP---QEWELFTGT--FISDKSDRNITVPKWID-----ADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIP---QSLKNKLS----LFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSS-MNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILD---QIIKKSNRNIQ-----WKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFN------DSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQ-LRILQR---FSVHGTKFDKDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEE--PFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGC 12746
            ++ T D  R+      WL     +P +L GP G GK++ L    +  + ++V  ++ S+ TTP  +L+  +  C    +  G V  P + S+ L+++  +INLP  DK+GT ++ISFL+Q++   GFY  S+  +V L+ +Q V + N  +  GR  +++RF   V +  + YP +  L  IY  + + +LK       +  Q      L N M++VY   +  FT DD  HY+++P +LT+WV  +     P+ S  +A  L+ + ++E++R+FQDRLV+ + R+  D ++  T    +  +  + ++L   + +  W SR                  +T E L+D +   L  +  E  D+ ++LF ++ D+V ++DR+  +  G +LL G +G G+ T S  V+ ++ + +   K+H  Y    F  D+++ L+ AG   E +  ++++   L+  +LE +N+LLA+GEVPGL+  +E   ++  +K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS +++ ++       M +++   E   +LT +     +Q T  D + +    +H T              V   T RH+++FIK ++ ++ +K++++E  + H+ +G+ KISE +E V EL+     +S  L EK+  A+  LK++    Q A E K   E+L  +  E+   +A++K  ++++LA +EP V +A+ AV  IK S L E++++ +PP  ++  LE + +++G  + T W ++R  + K      I  FD   +T E   Q+E+ +      FD  N  RAS+A  P+  W +A + YS  L K+ PL NE  +L++      ++ K ++  ++++++++  Y++++ +    A  ++ +L +  E ++ + +L+  L +E +RW+      + ++ +L   +LL++A + Y     +  R E    W       GL  + D+ +  +L+T  ++L+W+   L  D+L  ENA+++ +    P +IDPS  A  ++   F  + ++  +  D +F   LE ++RFG +L++Q+V+  +P+L P+L  ++   G R ++ +GD+ ID +P F++F+ TR+   +  PD  + V+ VNFT T + L  Q L   ++  +P +++++ +LL+ + +  + L  +E++LL  L  + G IL++  ++ +L K K  +  ++Q   E+ K+   +D     +  L+   S ++  +  L++I+ +Y +SL   + +F   L T E+S  TD   R   +   L + V+  V R +  +D+++ AL +     R +   P   Q ++L  G   F++   + + T+P  +D       +++A +        +++ L   +      +  +   E  +P        KLS        ++++ ALRPDRL ++  +      +   +     +++  I ++E   +EP+L+  + G D S  +++L+ +   + +   +A+G      QAD  L      +++G W+ LKN+HL  SWL  LEK L+S+KPH  FRL++TAE H    + +L++S  + +E   G+K NLLRS  +     ++K  +  R+     + W HA++QER  + P GW+  YEFS ADLR   + LD     + +   N++     W  +  L    I+GG++DN FD  +L   ++  F       D V+    +    +  P+ + K   +  + +L +   P++  LP+N ++         ++   L++      F+  G +  K  W  +L  +  +W ++L + +  ++ ++       +   P+  F + E     +L+K +   L  +S V +  +    E + L+  L  G+ P  W +++  P E    D+M  L  + K + +   +   D L      LG  F P+ ++ A RQ  A+    S+++L      G ++ +  +  +I  + I G 
Sbjct: 1578 VVPTIDTVRHEMLLAAWLAE--HKPLVLCGPPGSGKTMTLLAALRSQQEMEVVNVNFSSSTTPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIYGTFNRAMLKMTPAVRGLADQ------LTNAMVDVYLASQEHFTQDDQPHYVYSPRELTRWVRGISEAITPLES-LSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNYV--------------PVTREELQDYVSARLKGFYEEELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVN--RASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAKNDEADSTIPGGLDFLTVENKKSIAKARKVVGFENVFAHLQ-HNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVET--NRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSMKPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPT-ERSRLYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEIVKMRRTV------ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGW-KRYTVPREVTVMDWMTDLNERLKQLIR---IGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTDSTDVF--RISGIDIRGA 3563          

HSP 2 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 404/1072 (37.69%), Postives = 625/1072 (58.30%), Query Frame = 3
Query: 3372 DCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIR----LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVE--NWLGNLNNEMKTTLSDQLSYALQDL-RMSNQS----NYGINADKYPSQILCLSEMIHFTARCEELLNEN-NIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKD----QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIK-NKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMV--SLKGQH-----KKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKF-YVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQV---VKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWL 6488
            D  H   E ++ T+  E   ++   + +W   +   TG+    ++ WLS + R     + L +   +L+   +   T +    +++ +  Y  +  ++  ++ E L + HW +M +   M     L  LTL  + DA  +I+RH   IK++   AQGE+ + E +RE+  +      +LV Y     N   LIK W D+ +++ ++Q  L ++K SPYY+ F++ A  W+ KL  ++        +QR+WVYLE +F  +A     LP E SRF  +  D  ++M  V  + R+L + +M G + LL  + D L + QKAL EYLE +RS FPRFYF+GD+DLLEI+G S +   I+ HLKK+F GI  +D N++ + I    S +GE V+L  +++ T +V   +WL  L  EMK TL+ QL+ +L    +M+ Q+    +Y    DK+P+Q++ L+  I +    E+ L +      +++ +VK L +  ++ +         +   K+++LI + VH  D   +L+    ++  ++ WL+ +RFY   K     + CV++M +++F Y +EY G   +LV TPLTD+CYLT+TQ +H  LGG+P+GPAGTGKTESVKALG   GR VLVFNCDE  D ++MGRI +GL + G+WGCFDEFNRLEE +LSAVS QIQ IQ+ ++      + L+ +R+NV+ N  IFIT+NP   GY GR  LPDNLKQLFR +AM++PD  LIA+V+L S GF+ A+ L  K+V +F L +E L+ Q HYD+GLRALK VL  A N+    + K+   G+  +E+V     E ++++Q++    + KL   D     SL+ DVFP I     +   L   +  V  E  ++   ++G+       K+L++Y+      G+++VG SGSGK+  WK+L  AL +        +V++ KA+ +  L G +D +TREW+DG+ T   R++   V+   + + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  IFE  DL  A+ AT+SR GM++ S E    + L   +L
Sbjct:  343 DSAHAPSEGDKLTVATE---ELAAMKDVWKALQPVYTGIDEAKEKTWLSVQPRK--IRQSLDELMNQLKQLPVKCRTYKSYEHVKQMLHTYGKMNMLVAELKSEALKERHWHQMMK--EMRVNWNLSDLTLGQVWDA--DILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNY----QNKTRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLADMLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLV-KIVSTKDVRINDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPP----IRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNP---GYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNI---KRDKLDKMGSAALEDVA----EQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLKALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVWFSEEVVTSEMLFERYL 1386          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 87.8113 bits (216), Expect = 2.322e-16
Identity = 116/576 (20.14%), Postives = 239/576 (41.49%), Query Frame = 3
Query: 3573 LRNAEITTMTIRLQKEIDM--YKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKN----ALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNL-LSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDG-EVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKY----PSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSM--GRIFIG 5258
            ++  E T+    L+ EI +  ++ ++P+L  I  + +   HW  +  L +    + +E   L   L      I  A+  +++  +A+ E  +  +I +++     A F     +  Q   +   +    + + +  +Q +L     SP+     D    W + L +L+ ++    Q   +W  +E +F        +P E   F+++   +  I + +     +L    +    NL LS +     R +   + YL +KR++FPR + + D+ +L ++  S  P   KS++  LF  +   D N  ++ I     L+   +V+  N  L    VE W+  L++++K TL  ++   ++ +      NY ++  +     P Q+  +   I FT + E  + +N++  L  EL   +    +A +       F+     L  +   + H   ++++L+++    + ++ W  QLR+Y     +   I++      Y YE QG    ++   L D+         H G  G   G       +   ALG  F     + + ++ ID K +  G +  G
Sbjct:  667 IKEHETTSKEALLKIEIVLAEFEKLLPVLGAISCQAMKDRHWKMI--LQDSETSVKVEGNPLVSEL-LEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATF-----VTHQGGELLTTELNVQMQAHLARSQTIL----SSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPILEQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIISVSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKM------NYKLSPVETILNEPIQVAAVYLKIAFTWQMENSMKQNSLTILASELKICIRDCQHAVLHKHDRWEFLP---VLYHIYKSSTH---LVNKLMNEQVIFIDDYRWTSQLRYYWHL--ENVFIRVGTVSTRYDYEVQG-VDCMIDNQLVDEAVKYFICMNHFGFNGFVNGMDVNLARQIAGALGKPFA----ICDTEQEIDCKMLIEGALLFG 1211          

HSP 2 Score: 86.6557 bits (213), Expect = 5.412e-16
Identity = 87/363 (23.97%), Postives = 165/363 (45.45%), Query Frame = 3
Query: 8751 KKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKI---TSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGT------------MDTSWVSMRNFLGKRGIQEEIQTFDARRITRES-RIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAP----LENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQ 9779
            KK+ E+       + G++K+  A+E VA ++ +       L    +E    +  I   T  ++ A E     E    K  E        KA  + ELA   P ++ A +A+  +  SD+S ++ +R PP  +R  +E V +++G             ++  WVS +  L       +I++F    +++++ ++  E+ L+  K+ FDP+N K+ S+AA  L  WV A   Y+   + + P    L   +  +K++L+  E K K L K    V + + G    F +      +LE ++ +    +  AE LV  L  E ++W  +I  +  E S     S+ ++ ++      P DQR+++++
Sbjct: 2113 KKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANEN---KANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLS--KEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLK----VTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVFGKLPIDQREKELR 2466          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Match: btv (gene:FBgn0023096 transcript:FBtr0273418)

HSP 1 Score: 1987.62 bits (5148), Expect = 0.000e+0
Identity = 1370/4324 (31.68%), Postives = 2326/4324 (53.79%), Query Frame = 3
Query:  366 VTTLSENPISSLYNIIQNIYGP----ILLSDTDPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSL---SASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFS-YLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMT--------RRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPN-EIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQME--PEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQ-STNPQVIKSHLKKLFQGIYDVDFNK---------DIQH--IITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKD----------QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFT--ISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQ--PFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQN---SKVKL--LANTMIEVYSQLKSKFT--VDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSH-MHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQF-LEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGL-EKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQ-------GILIPFLIDPSSNATAWLKNHFK--DRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIA-CLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNIT------VPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWF--HAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRN-IQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYG-KIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWS-----------------RELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD---SPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGS-ELLTKEVQNLSECLLTGQTPNVWLQQWEGP--EEPFDYMRILILKAKAVEKWAELSEKDEL-LSTILDLG--ELFHPDTFLNALRQLTARTIKISMDELKF-VCRWGGSNVSAKYS---VKIGNLHIEGCLFDGTMITECN--------RDSNSIVLLPPVSVGWVDKNQPNSYSEDDMIS---LPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            + TL    + S+YN +  ++ P       S+  P++  ++  L   LGS +  P S             GI S+ +EI +W   L   S+S  D+  +++   I  L+ + +++  I   + + +   +L++    L+++W+   +  NYPQ RM  L++II   L+ +  TQL     W  + + V   ++Q+I+    WI +CD L + +W  Y+ H W  D+++       F+ RL+EI S++ +++QI  +L   E QE   E+A     NI   +     +  W  A++ F + ++P +  I   LK       S   P+Q++ +F +Y  LI RP +   L  ERE  L  L I  + LR+  +  + +   P T + S   ++  W K ++ ++ EI  + S+++   +GF+K  K  +   EE  +  +  FE W+ + +        R  DD +   ++ + +GR         L+ V ++ +LV   ++VR    LGY++   + AAA +  K+   A  L+Q+A F+NTI  +MIPCQ+ +ML  A+  ++LV+S          V W +   + +++D LQ A   + S N LL   H      ++ LM  DL  Q Q WKD L  +R+++  +E Q +   +   +K H DHQLYK LEYQY +GL  +N  LP+I V LV RQ  L F+P  EEI+  YF ++++FI  P  F GL++ S   Q +F S++  N   F   YQ+A  LF +L      +  WI LG +D+++    H  +  D+++NF++ K   ++  KL   E  IDCI +N  P++  ++ + +  +++L NSLR  I   +  +  +L ++++ L   P     I+++ + + +      +I   ++     ++ L       +  +S +  +W++ + ++E+  +++Q Q++++K    ++ +  + +  KF  RW+      +     +  + LD  ++ +    +L+E     T L ++C  F ME   E  T   EI + +++    W  ++ + T LQ +  E+W  +R R Y+  EF+ +W E   +A I   + R++++++  +  +PIL+ ++ E LS+ HW  +F+LLN      L ++ L+ IL     +   A+ I  + ++A  E  +R+A+ EL+ W   A  +L+   D+   S+SLIK+++++++++GDNQ LLQS  +S  +  F D+A +WE++L  LD  L +LN  QR+WVYLEP+FG   L  E++ F+R+D+DFR +M ++  + RV SL  ++ +  +++ +  QL RCQ+ L  Y+ +KR+ FPRFYF+GDDDLLE+LGQ S + +VI+ H++KLF G + +   +         D+    I ++ S +G+ ++L   V +  ++E WL  L   ++ TL DQ+          + +       KY SQ+L  +  +HFT + E+ +   ++  LK++L  ++  +  A  + S + T I   LKL++L+LD VH   + +QL   N    ++W WL QLR+Y   K           Q CV +MV AEF Y YE+ G A KLVHT LT +CYL LTQ MHMGLGGNP+GPAGTGKTE VKALG++ GR VLVFNCDE +D +SM  I  GL +CG+WGCFDEFNRL+EA LS++SM IQ IQ  +K +   + + ER++ ++ +  IF+TLNPAG  YGGRQKLP N++ LFRP+ M +P+   IA V+L  +GF  A  +  ++V +F LS ++L+ Q+HYDWGLR LKTVL      L   + ++ ++ N    N   ++FE  ++V+ LR +T+SKL   D   FE L+++VFP I         L  ++     +  +   + Q +K L+++EQL++RMGVV+VGP G GKSTI  LL+ AL   G  +K + ++PK++ R QLLG +D DTR+W DGVLT++A  V +E  ++ SWI+CDG IDPEWIE+LNSVLDDN+LLT+PSG RIQFG NVNFIFET D+  ASPATISRMG++ +S +      ++   L K+   D  LL +Y+D  F  +++WI  +   T     +    + + L  L   ++   +    ++ L G +  + +  FA  + +  +      N   + +Y     +N L        E+ ++D + + +K  + LI+T+ ++  LD  +  L +   +  PF+L GP G GK+L+L     +    Q+ T++CS Q TP ++L  L   C+ ++   GR YRPK++ RL+L++K+++L + D WG  +++  L Q+    GFY  NLE++G+ G+Q+      S       ++ R+ +I +   +S P+   + +I    L+P+L+    +H   S+N   S V L  ++ ++++ + +L++ FT      +HY F+P  + + + +L+ Y  P +  N A+        E + +F+DRL+S +  ++ +GIL  T+   +  E       V+FV    +               L  LT +   + + R +   + E   +   + +E+  +VA++ RVL++    +L+ G+SG GR   ++  +      K+++ +    Y+L  F NDLK  +QTA +E +   LL+E       P  L+ I +LL   E+  L+  ++LE +  +LK  A   G++ S+  YF  R + YLHII+++D ++        + PA  +   + ++   SR+++  +P   I         +L   S        G     S+F D+ D  P E  TS+ Y   I+ Y  +Y    NEI+ R   +Q+G+ K++ A  +V  LKS AA Q + L EK+  A++AL+ I+  M+ A E+K  M +L  +T + +  L  R+  I  ELA +EP + +A +AV  IKS  LSEIR+LRAPP+ +RDILEGVL +MG  DTSW SM+ FL KRG++E+I++ D  RI+ E+   VE LL    DS++ KNAKRAS AAAPLAAWV+A+V+YS  ++ I PLE EQN+L++NL  AE +M++L  G+ DVDK V       + +T +AA LE +L+ A+ T+ AAE LV KL  E+  W+ Q+ EL      L  K+LL A ++ Y      +QR   ++       L   FD+R  L TE++Q+ W+ +GL+ D   +E+A ++ +          IP L+DP+  A AWL  H K   R  E+    +      LEL+VRFGKTL++ + + L P +  LL+G +  +  ++ + +G KL+D +  F+L L +++ +  LP +  + ++ + FT T AGL  QL++  +     +LE+++  LLQ+E  L  +  +M++ LL++L+ + G+IL N+ LL SLN+ K+ S  I ++L++S +++ +L  +  +   L+   ++ +      + +   Y  S   ++ LF  AL+ S+       R+ S +  CL + VY  + R+  +  +L  +L + H   PD   P+EWELF   F+   SD ++       +P  +  +  + ++ L    P+L S L ++ D +W  F      E +    L    S FQ++LI Q  RPD +   L +   D+L +   + +  ++ Q+ + ++  + PIL++     DP+ +L++ +     +++Y ++A+G+G     L+ + + + +G WLC+KN+HLV  +L  +E+EL+ ++  KDFRLW+  E   GFS   +   LK+ YE P G+K  ++R   N++ +   K  +  ++  +  L +F   A++Q+RR FIPQGW+K+YEF  ADL+A   IL  + ++ N     W  +  L E   +GGRV+N  D+ +L++Y+ ++ +  V++   +  G  + +P++   +DY A + +L D + PS + L +   +  +   + +VI +LR L     +G    KD                    +++ P+LN W+ L     II+     ++K + TD   SP   F+  E      L   VH +L  +   LK S E+    ++ L+E     Q P  WL+ W GP      D++R LI++A+A    AEL  ++++ L  + D+   ++F+ +  L+ L+ L +R + +S + L+   C  G SN+ +  S   +K+  L I+G     + + + N        +D    V     S     KN  + YS  +  S   LP+Y    RDK++  +++   +G  ++ + +G AL ++
Sbjct:   91 ILTLEGGMVKSIYNSVSRVFSPSANSARRSEYGPELSGILENLHQNLGSSLGLPQS-------------GITSLRNEIKYWQQKLGQKSSSRLDREAAQV--FIGVLENMEKQISTIDGANPSGTIEEFLDHAHTNLDELWR---LPYNYPQQRMADLLDIIGKRLLEVCLTQLLAEDVWSLNSSHVNNLMSQSIDTVDAWIQLCDSLTRLFWPNYVKHPWLGDSHVP-KRGQQFKERLSEIRSIKQLYKQIATLLEDTELQEMFQEQAPFTEFNIFDTS--SLGQNKWHKALQHFEQVLQPIDERIAAALKRQLHNHLSN--PRQVIFIFSKYETLIQRPAVLELLTIEREQFLQSLHILLQDLRKAMVDSNME---PDTGHLSVICNECRWLKVVQHQIQEIEKV-SHLISGREGFDKINKAVQEIKEETESLLRTNFEIWSGQCSTAVKSGELRLRDDQAV--VKFEKEGR--------QLMRVTFNPKLVTFCQDVREFENLGYNVPLELRAAATHAAKYMCYARRLQQIATFHNTIGDRMIPCQRPIMLKNALELQRLVQS--------ETVAWQDESSVQRYVDILQAAVSKLSSDNTLLVGYHEQAKRSVLKLMSTDLFTQNQIWKDELRHLRELVATLERQGYTHLDA--FKLHWDHQLYKVLEYQYILGLLDMNNKLPDIHVKLVLRQRELVFSPPEEEIRELYFSQLRRFIERPCNFHGLSEHS---QELFKSMVTVNRHHFGPLYQRAAELFDKLQDFKTIWLPWIALGCVDVDQLCGIHLNEAGDWDRNFRSCKHFSQQLAKLQQAEESIDCIVINVLPLRSDIEYISRRYWESLANSLRTAILTDVSLIQEFLQSALQFLQNVPMDEGSISQSGMKYEKIMSKLPQIEKTLEAVRAKDSCLGGWCKERVTALSGILLQWEQLQPLLENHAVILQRQVDMIKNQAETQLQNLKNEAEKFLLRWESTISELE----ANEHSTLDVFKERRLHWQQLQEKK---TQLLEECSKFNMEFPAEMLTPFTEIEEQMEKQSKQWQVYDSFLTELQPVLHEEWAIYRRRPYVLNEFIGKW-EGSVHASIDLPSKRIRQQVEQLQSALPILQQLQSESLSERHWARIFQLLNHKETKPLHSILLQDILQDFDVLQSAAQEISSIVRQASSEQIVRQALIELDQWSVTAQLKLITRTDASGQSVSLIKDYQEVLNKIGDNQSLLQSANNSAAFESFSDQAELWESRLNTLDALLSSLNHSQRRWVYLEPVFGSGTLQHEQALFKRIDKDFRFVMREIEMDPRVTSLTKINNITTIVNALETQLARCQQNLMSYITDKRNSFPRFYFLGDDDLLELLGQASKDAEVIQRHIRKLFPGCHSLSIRQVGPNPATSSDVNQYSITSVHSAEGDELKLSQPVEMKGDIERWLNQLVTVVQDTLRDQIYECYTGTTGGSDNLDEKILKKYASQVLATARALHFTRQAEQAIGSMSLGKLKQQLKDEIT-HLAALKNKSENGTLI--SLKLRALLLDLVHYSGVTEQLQKHNVVHTSDWHWLCQLRYYLGKKGGTSGEVNANRQVCV-RMVYAEFEYAYEFLGQASKLVHTRLTHRCYLILTQAMHMGLGGNPFGPAGTGKTECVKALGAMLGRLVLVFNCDENVDTESMSLILTGLARCGAWGCFDEFNRLQEATLSSISMLIQPIQSALKERANSVQIGERQIQLNQHCGIFVTLNPAGAEYGGRQKLPGNIQALFRPIVMQQPEPGEIARVMLFVEGFTEASAIASRIVELFELSGKMLSAQRHYDWGLRELKTVLMVCGEGL---RDQLTSEDN----NQSSANFEMSVVVRCLRSSTMSKLAPHDVNRFEMLLRNVFPEIGSSPAPETQLHQSLSAAFAQLGLCRSERQIEKALQLHEQLQKRMGVVLVGPPGCGKSTIISLLKQAL--CGTQLKVHTISPKSMSRIQLLGRLDADTRQWQDGVLTHTAVAVNQESSQVHSWIVCDGSIDPEWIEALNSVLDDNKLLTLPSGWRIQFGSNVNFIFETDDVRHASPATISRMGIVNMSYDYYPADGILKHELSKEPYGD--LLQSYVDGNFQYAVNWIESQLLLTHLPGINRAHLLRSLLLQLHGTQSLEEYGAATLRALFGYMPNDRQREFAQLILKHANLYVANPNYAELTHY--ESSRNSL--------EQYAVDAIETPEKG-SQLIITSYMKSYLDILETLLKTQGTRLPPFMLIGPSGSGKTLLLQRAVLENSGYQLATINCSTQLTPRYILHTLKTHCVTVSGIKGREYRPKQA-RLVLFMKNLDLCQQDSWGACEVVELLFQLAQRGGFYAENLEWIGVSGLQLCA----SIGGNTGKIAPRYFAINQFVRVSRPTSQDMLEIVQRRLEPLLE----EHFRGSENRGRSGVNLQHVSESLMDCFEKLQATFTNVGGRQAHYQFSPKCIMKLLDALVFY--PASDFNEALYC------ELLGMFRDRLISEEHVQQFEGILKQTMRKYYGKE------KVFFVPKSPK-----------SRGHLHCLTHDEWMEEVQRQVTICNTENYSITAPITEELLSHVARITRVLSRTDAHMLILGQSG-GRHLDAIFTAATFQEAKVVTLQGGPSYDLTDFYNDLKVAMQTAALEQQMSYLLIEQCWLSYVPDILKPIEALLEGSEILELF-GDDLETVASTLKQAAQLEGYQESMGTYFLKRARDYLHIIIVLDPNSAKVQDYFNNFPALHRQMDLLYVRGESRETIAILPKQFI---------ELLNESIAGGGSGRGKVPTCSHFADISDELPSE-ETSQRYYQLIRTYFHMYNNAANEIDQRLGKLQMGVDKLASAHALVDTLKSNAAAQEQALGEKRQLANEALEMISFTMRNANEQKSSMLELKQQTQKSSEQLKIRQKEIQQELAEVEPILAEASNAVGQIKSEALSEIRSLRAPPEAVRDILEGVLRLMGIRDTSWNSMKTFLAKRGVKEDIRSLDPARISPENCEAVERLLLAKGDSYEAKNAKRASAAAAPLAAWVQASVRYSRVIQSIKPLEREQNELQKNLNAAEDEMQELASGLDDVDKRVKQLSAKLQTYTQEAAVLELKLQEASGTLQAAELLVEKLSAEYTTWSLQLTELKKAHKTLDAKTLLIAIAINYCAGLGLEQRCSSLKRLAADFHLPSDFDLRGSLLTEQQQIIWESQGLARDAQIIESAALLREMLSLPYGACPIPLLLDPTQTAAAWLMAHLKGSGRPCELTTHGNDRLPYQLELAVRFGKTLLVTDCEQLRPPVLQLLQGHVFVRFNKRQLAIGSKLVDLHESFQLVLISKSHRLDLPEEQRSQLNVLKFTVTAAGLADQLMSKAIVLKNGELEQQRIELLQKEGHLLKQRMEMQDKLLEQLSKSEGDILKNEQLLESLNEIKQGSTQIDEALKQSGQIRDTLLAQFGSLRELSSRAATFY------AGLIQGYELSPLVYIELFLGALSKSQ-------RDESKVYDCLVRSVYMNLARATSRDSQLSLSLWVCHQAYPDRLNPKEWELFVNNFMGS-SDGSMVLSQLGKLPDCMPKEAQLKLAMLLQLFPDLRSKLQLEKDYIWRGF-----IEAQADDVLPALGSSFQRVLIAQIFRPDLMLHQLRKVSSDLLGISPDASTQPSVEQLLQ-QSSCDRPILMVSHAENDPTTELRKWA-----NQKYREMAIGKGVEKRVLSEMRQAAIDGHWLCVKNVHLVPEFLTQMERELSEIQKSKDFRLWLLCESTEGFSEAAIYKCLKVRYEQPKGLKQIVMRLLQNFAAEQDQKLKNQPKSLKM-RLVYFVLTAVLQQRRQFIPQGWSKYYEFGEADLKAALGILRMMDQQLNSGKCDWLLMQRLSEALAYGGRVNNQRDLEILTTYLNQFCSADVLSNRWSPLGLSLSIPTSGQLQDYYAALEKLPDTDEPSMYGLANQAQQQREIEQAKRVIKELRGLH----YGRGLAKDSGGAGESKGNDQLTGRQKLEQQIKPLLNLWRKLAASCTIIQ-----TMKEAKTDVGESPWALFVLAELKLGADLYGIVHQTLSQMHAWLKESQEVDGSTLRTLAE----QQIPASWLKLWPGPGSNSAVDFLRALIVRAQA----AELRFREQMHLDFVEDINFVQVFNCENLLSCLKLLQSRKLAVSTERLELQTC--GSSNLESDSSDIILKLAPLKIDGA---QSGMGKSNPFYIKYKIKDEVQNVSHTTTSSSKYGKN--SLYSTQNAESKPKLPLYSRSSRDKLICHLNVDIVTGTAEQILLAGTALIVE 4234          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0332745)

HSP 1 Score: 1382.85 bits (3578), Expect = 0.000e+0
Identity = 1018/3530 (28.84%), Postives = 1777/3530 (50.34%), Query Frame = 3
Query: 3087 VSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQME--------PEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRL---------QKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITS--EVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINA-----DKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTF----IVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFY----QKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQE------ITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIE--NVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHK------KMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQ-EI--QSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATI-----------------------SRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHL-----LSTYLDDFFYKSLDWIAKRN-EFTISTSNVG--TVYNGLSNLKAIKNKAHFSV---------------------------CLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEK------QNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAV-SLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX-XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN---SAKP--KTQLTGSDNLNSYFLDLHDTCPVEFS------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENE----QNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMR------KFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTS---EISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFT--GTFISDKSD--RNITVPKWIDADRTVAISNLASAMP----ELWSVLNIKDDDLWHQFAKSSECEREIPQ------SLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHL--SPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFND----------SVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRF----------------SVHGTKFD-KDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPE--EPFDYMRILILKAKAVEKWAEL---SEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRD----SNSIVLLPPVSV-GWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQD-KWIQSGVALF 12983
            V  ++ +W  F  +++     +Q Q+  ++  I++  K  +   + F + W+  KP      +G      DA+Q+++  + +   L   + N+ K  E  +++         E   +  E  +D+   + +WS+  +  T +    ++ WLS + R       L Q  E +  A++  +  RL         +K I  Y  +  ++  ++ + L + HW ++ + L +     L  L+L  + D    + ++   +K++   AQGE+ + E ++++          L+ Y     N   +I+ W D+ ++V ++   + ++K SPYY+ F+++A  WE KL  ++        +QR+WVYLE IF  +A     LP E SRF+ +  +F  +M  V ++ +V+ + ++  ++  L  + D L + QKAL EYLE +R+ FPRFYF+GD+DLLEI+G S N   ++ H KK+F G+  +  N++   I+ + S +GE V   N V      ++  WL  +  +M+ TL+  L+ A+QD++          A     DKY +QI+ L+  I ++   E  L + +     K + + L     + +++ ADS       +   KL+ LI + VH   +  +LL+    S   ++WL ++RFY    Q    Q   I M +A F Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVKALG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSA S QIQ IQ+ +K ++        + L+ ++V V  + AIFIT+NP   GY GR  LPDNLK+LFR +AM+ PD  LIAEV+L S GF++A++L  K+V  F L  E L+ Q HYD+GLRALK+VL  A N+    +   K +MK +G++ I+  +V ++  E ++++Q++    + KL   D     SL+ DVFPN+     E   L   I +V +E  +V  +G  +      K+L++Y+      G+++VGPSGSGKST WK L  AL +  G     +V++PKAI +  L G +D +TREW+DG+ T+  R+++   + EI  + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+                       SR+  I L     D   ++     K++E    L     ++  L  FF  S D I  R  E+ +   ++   T    LS+L ++ N+A  +V                            ++    G+     R     +V  +T    P      +++Y  N         N++     E  +  S D       I+ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +  C    +  G V  P +  + L+L+  +INLP +D +GT ++ISFL+Q++ +KGFY  S+  +V L+ +Q V + N  +  GR  LS RF   V +  + YP +  L  IY  + + +L RL+P     +     + L N M+E Y   + +FT D   HY+++P ++T+WV  +     P+  D+  V  L+ + ++E++R+FQDRLV    R+             W+ E  D +    F      E             K    +  E L++ +   L  +  E  D+ ++LF EV D+V ++DR+  +P G +LL G SG G+ T S  V+ M+ + +   K+H  Y  + F  DL+  L+ +G + E I  +L++   L+  +LE +N+LLA+GEVPGL+  +E   ++   K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS  ++ ++      ++  E+ +    +   S  P      T  D + +  + +H T     +            T RHY++FI  ++++Y +K++++E +Q H+ VG+ KI+E  E V E++   A + + L  K   A+  LK++    Q A ++K + +++ ++  ++ V + +++  +  +LA +EP V  A+ AVS IK   L+E+R++  PP V++  LE V  ++    T W ++R  L K      I   +  +IT + R +++       D ++ +   RAS+A  P+  W  A ++Y+  L+++ PL  E    + Q   NL +A K+ KDL   V  +++++A Y++++ +  + A  ++ +L+N    +  +  L+  L  E ERW        +++S +    LL+AA + Y     +  R      W +         R      ++L+   E+L W+   L +D+L  ENA+++ +    P +IDPS  AT +L N +  +K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  +L   G R ++ LGD+ ID +P F +FL+TR+P  + PPD  + V+ VNFT T++ L+ Q L   ++  +P ++E++++LL+ + + ++ L ++E+SLLQ L +A G IL++  ++ +L   K+ +  I+Q ++E+ K+   ++     +LPL+   S+++F +  L++++ +Y++SL  FL +F   L  +   E  TD + R   +   L ++ YE V R +   DRL FAL M   C+  L    E  L      F+  +     N T  + + A++  +++ LA  +P     L  V +I +   W Q    S  E+ +PQ      +L    S   ++L+IQA RPDR+ +A       VL    +  +   ++   + + +   N P L+   PG D S  + +L+ +   +++ + +A+G      QA+  +N+     + G W+ LKN+HL   WL  LEK+++SL+PH  FRL++T E +      LL++     +E PPG++ NLLR++       + KT S  RA   F LAWFHAI+QER  ++P GW K YEF+ +DLR   + LD  I  +           + W  +  L   +I+GG++DN FD R+L+S++K+ F            + V+G+      I +P    +  +L  I  L+D  +PS+  LP+N ++       + ++ +L  +Q+                 S  G   D +  W + L+     W ++L + L ++K ++       +   P+  + + E  +  +L++ V   L  +  + +G +  T   +++   L+ G  P  W +++  P       ++     + + ++K ++L   +   EL    + LG L +P+ ++ A RQ  A+    S++EL     +   G  N        +  L ++G         +C  +    +++I++  PV++  W+  +     S+   ++LP+Y +  R +++  +D+   +GQ+   + + GVA+ 
Sbjct: 1214 VDNIEGEWSAFNEIIKRKDTAIQTQVASLQAKIVAEDKAVETRTVDFLNDWEKTKP------TGGKIRPDDALQQLQIFESKYSRLKEERDNVVKAKEALELQESAVPNNSAERMNVALEELQDL---RGVWSELSKVWTQIDETREKPWLSVQPRK------LRQQLEAMM-AQLKELPARLRMYESYEYVKKLIQSYIKVNMLIVELKSDALKERHWKQLTKQLRV--NWVLSDLSLGQVWDV--NLQKNEGIVKDIILVAQGEMALEEFLKQVRESWQNYELDLINY----QNKCRIIRGWDDLFNKVKEHINSVAAMKLSPYYKVFEEEALTWEEKLNRINALFDVWIDVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAVQRSLERLADLLGKIQKALGEYLERERTSFPRFYFVGDEDLLEIIGNSKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVEKQMRFTLASLLAQAVQDIKQFRDGKIDPQAYMEWCDKYQAQIVVLAAQILWSEDVESALQQASENNQSKPMQRVLG-NVESTLNVLADSVLQEQPPLRRRKLEHLINEFVHKRTVTRRLLNNGVTSPKSFQWLCEMRFYFDPRQTEVLQQLTIHMANARFFYGFEYLGVQDRLVQTPLTDRCYLTMTQALESRLGGSPFGPAGTGKTESVKALGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQIQTIQEALKYEMDSNKESITVELVGKQVRVSPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTTPDRQLIAEVMLFSQGFRSAEKLACKIVPFFKLCDEQLSNQSHYDFGLRALKSVLISAGNVKRDRIMKIKEQMKQRGDENIDEASVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPNVGYTRAEMKGLKEEIRKVCQEDYLVCGEGDEQGAAWMEKVLQLYQISNLNHGLMMVGPSGSGKSTAWKTLLKALERFEGVEGVAHVIDPKAISKEALYGVLDPNTREWTDGLFTHILRKIIDNVRGEINKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRVMFEVQDLKFATLATVSRCGMVWFSEDVLSTEMIFENYLSRLRSIPLEDGDEDFVGVIKPAKDKEEEVSPSLQVQRDIALLLLPFF--SADGIVVRTLEYAMDQEHIMDFTRLRALSSLFSMLNQAARNVLTFNAQHPDFPCSADQLEHYIPKALVYSVLWSFAGDAKLKVRIDLGDFVRSVTTVPLPGAAGAPIIDYEVNMSGDWVPWSNKVPVIEVETHKVASPD-------IVVP---TLDTVRHESLLYTWLAE--HKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRKTPNGVVLSPVQIGKWLVLFCDEINLPDMDSYGTQRVISFLRQLVEHKGFYRASDQAWVSLERIQFVGACNPPTDPGRKPLSHRFLRHVPIIYVDYPGETSLKQIYGTFSRAML-RLMP-----ALRGYAEPLTNAMVEFYLASQDRFTQDMQPHYVYSPREMTRWVRGICEAIRPL--DSLPVEGLVRLWAHEALRLFQDRLVDDSERR-------------WTNENIDLVGQKHFPGINQEEALQRPILYSNWLSKDYMPVNREELREYVHARLKVFYEEELDVPLVLFDEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSIFQIKVHNKYTSEDFDEDLRCVLRRSGCKDEKIAFILDESNVLDSGFLERMNTLLANGEVPGLFEGDEYTTLMTQCKEGAQREGLMLDSSDELYKWFTQQVMRNLHVVFTMNPSTDGLKDRAATSPALFNRCVLNWFGDWSDSALFQVGKEFTTRVDLEKPNWHAPDFFPSVCPLVPANPTHRDAVINSCVYVHQTLHQANARLAKRGGRTMAVTPRHYLDFIHHFVKLYNEKRSDLEEQQLHLNVGLNKIAETVEQVEEMQKSLAVKKQELQAKNEAANAKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVSSIKKKHLAEVRSMANPPAVVKLALESVCELLNESATDWKAIRGILVKDSFISSIVNLETDKITDDVREKMKSKYLSNPD-YNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADVNLASA-KETKDL---VEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETFKSQMSTIIGDVLLSAAFIAYGGYFDQHYRLNLFTTWSQHLQAASIQYRADIARTEYLSNPDERLRWQANALPTDDLCTENAIMLKRFNRYPLIIDPSGQATTFLLNEYAGKKITKTSFLDDSFRKNLESALRFGNPLLVQDVENYDPILNPVLNRELRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDICSRVTFVNFTVTRSSLQSQCLNQVLKAERPDIDEKRSDLLKLQGEFRLRLRQLEKSLLQALNDAKGKILDDDSVITTLETLKKEAYDINQKVDETDKVIAEIETVSQQYLPLSVACSNIYFTMDSLNQVHFLYQYSLKMFLDIFSTVLYNNPKLEGRTDHSERLGIVTRDLFQVCYERVARGMIHIDRLTFALLM---CKIHLKGTSESNLDAEFNFFLRSREGLLANPTPVEGLSAEQIESVNRLALRLPIFRKLLEKVRSIPELGAWLQ---QSSPEQVVPQLWDESKALSPIASSVHQLLLIQAFRPDRVIAAAHNVVNTVLGEDFMPNAEQELDFTSVVDKQLNCNTPALLCSVPGFDASGRVDDLAAE--QNKQISSIAIGSAEGFNQAERAINM---ACKTGRWVLLKNVHLAPQWLVQLEKKMHSLQPHSGFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGIRANLLRTFSTVPAARMMKTPS-ERARLYFLLAWFHAIVQERLRYVPLGWAKKYEFNESDLRVACDTLDTWIDTTAMGRTNLPPEKVPWDALVTLLSQSIYGGKIDNDFDQRLLTSFLKKLFTARSFEADFALVANVDGASGGLRHITMPDGTRRDHFLKWIENLTDRQTPSWLGLPNNAEKVLLTTRGTDLVSKLLKMQQLEDDDELAYSVEDQSEQSAVGRGEDGRPSWMKTLHNSATAWLELLPKNLQVLKRTV------ENIKDPLYRYFEREVTSGSRLLQTVILDLQDVVLICQGEKKQTNHHRSMLSELVRGIIPKGW-KRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGFPVWLGGLLNPEAYITATRQCVAQANSWSLEELALDVTITDAGLKNDQKDCCFGVTGLKLQGA--------QCKNNELLLASTIMMDLPVTILKWIKISSEPRISK---LTLPVYLNSTRTELLFTVDLAVAAGQESHSFYERGVAVL 4645          

HSP 2 Score: 76.2554 bits (186), Expect = 8.355e-13
Identity = 87/428 (20.33%), Postives = 176/428 (41.12%), Query Frame = 3
Query:  780 NPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKL-------IKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQIL-----PHRE-----------RQEFKIEEAFKYFLNILPLAYNPYTE-----------PIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETK------NFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGL-LYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFY 1931
            N  YP  R   L+E I+ +L + +   L         +   +  + Q  E+ S W D  DKL       +K+   ++L   W              Q R+  +   R  HEQ+  ++     P +            +Q + ++ A    +  + LAY    E             W+ AVK++   I+  ET I   L+    +  +A+   ++ R+F R+N L  RP I   + + +  L+ ++    + L E F     +S+  ++   ++       I+W++Q++ +L   L    +VL    G+E  ++  K      +F  ++S    + F +W +++  R  +  + G    ++     + + + L L VN+   ++ L +EVR +  LG+ +  +++  A    + Y  A+ L +  + Y
Sbjct:  369 NTKYPIQRCLKLIEAISRDLSQQLLKVLGTRRLMHIPFDEFERVMNQCFEIFSCWDDEYDKLQGLLRDIVKKKRDEHLKMVWRVS-----PAHKKLQTRMEHMRKFRRQHEQLRTVILRVLRPTKPAVGDDGNVVETKQPYSLDAADANAIEEVNLAYENVKEVDCLDITKEGSEAWEAAVKRYEEKIDRVETRITAHLR---DQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIEALHEKFKVQYPQSKSCRLSSVRDLPPVAGSIIWARQIDNQLTMYLKRVEDVLGK--GWETHIEGQKLKADGDSFRAKLSI--SDVFHEWARKVQER--NFGSTGRIFTIESTRSRIGRGNVLRLRVNFLPEIITLAKEVRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTY 782          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0273370)

HSP 1 Score: 1382.85 bits (3578), Expect = 0.000e+0
Identity = 1018/3530 (28.84%), Postives = 1777/3530 (50.34%), Query Frame = 3
Query: 3087 VSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQME--------PEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRL---------QKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITS--EVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINA-----DKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTF----IVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFY----QKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQE------ITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIE--NVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHK------KMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQ-EI--QSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATI-----------------------SRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHL-----LSTYLDDFFYKSLDWIAKRN-EFTISTSNVG--TVYNGLSNLKAIKNKAHFSV---------------------------CLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEK------QNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAV-SLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX-XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN---SAKP--KTQLTGSDNLNSYFLDLHDTCPVEFS------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENE----QNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMR------KFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTS---EISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFT--GTFISDKSD--RNITVPKWIDADRTVAISNLASAMP----ELWSVLNIKDDDLWHQFAKSSECEREIPQ------SLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHL--SPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFND----------SVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRF----------------SVHGTKFD-KDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPE--EPFDYMRILILKAKAVEKWAEL---SEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRD----SNSIVLLPPVSV-GWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQD-KWIQSGVALF 12983
            V  ++ +W  F  +++     +Q Q+  ++  I++  K  +   + F + W+  KP      +G      DA+Q+++  + +   L   + N+ K  E  +++         E   +  E  +D+   + +WS+  +  T +    ++ WLS + R       L Q  E +  A++  +  RL         +K I  Y  +  ++  ++ + L + HW ++ + L +     L  L+L  + D    + ++   +K++   AQGE+ + E ++++          L+ Y     N   +I+ W D+ ++V ++   + ++K SPYY+ F+++A  WE KL  ++        +QR+WVYLE IF  +A     LP E SRF+ +  +F  +M  V ++ +V+ + ++  ++  L  + D L + QKAL EYLE +R+ FPRFYF+GD+DLLEI+G S N   ++ H KK+F G+  +  N++   I+ + S +GE V   N V      ++  WL  +  +M+ TL+  L+ A+QD++          A     DKY +QI+ L+  I ++   E  L + +     K + + L     + +++ ADS       +   KL+ LI + VH   +  +LL+    S   ++WL ++RFY    Q    Q   I M +A F Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVKALG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSA S QIQ IQ+ +K ++        + L+ ++V V  + AIFIT+NP   GY GR  LPDNLK+LFR +AM+ PD  LIAEV+L S GF++A++L  K+V  F L  E L+ Q HYD+GLRALK+VL  A N+    +   K +MK +G++ I+  +V ++  E ++++Q++    + KL   D     SL+ DVFPN+     E   L   I +V +E  +V  +G  +      K+L++Y+      G+++VGPSGSGKST WK L  AL +  G     +V++PKAI +  L G +D +TREW+DG+ T+  R+++   + EI  + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+                       SR+  I L     D   ++     K++E    L     ++  L  FF  S D I  R  E+ +   ++   T    LS+L ++ N+A  +V                            ++    G+     R     +V  +T    P      +++Y  N         N++     E  +  S D       I+ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +  C    +  G V  P +  + L+L+  +INLP +D +GT ++ISFL+Q++ +KGFY  S+  +V L+ +Q V + N  +  GR  LS RF   V +  + YP +  L  IY  + + +L RL+P     +     + L N M+E Y   + +FT D   HY+++P ++T+WV  +     P+  D+  V  L+ + ++E++R+FQDRLV    R+             W+ E  D +    F      E             K    +  E L++ +   L  +  E  D+ ++LF EV D+V ++DR+  +P G +LL G SG G+ T S  V+ M+ + +   K+H  Y  + F  DL+  L+ +G + E I  +L++   L+  +LE +N+LLA+GEVPGL+  +E   ++   K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS  ++ ++      ++  E+ +    +   S  P      T  D + +  + +H T     +            T RHY++FI  ++++Y +K++++E +Q H+ VG+ KI+E  E V E++   A + + L  K   A+  LK++    Q A ++K + +++ ++  ++ V + +++  +  +LA +EP V  A+ AVS IK   L+E+R++  PP V++  LE V  ++    T W ++R  L K      I   +  +IT + R +++       D ++ +   RAS+A  P+  W  A ++Y+  L+++ PL  E    + Q   NL +A K+ KDL   V  +++++A Y++++ +  + A  ++ +L+N    +  +  L+  L  E ERW        +++S +    LL+AA + Y     +  R      W +         R      ++L+   E+L W+   L +D+L  ENA+++ +    P +IDPS  AT +L N +  +K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  +L   G R ++ LGD+ ID +P F +FL+TR+P  + PPD  + V+ VNFT T++ L+ Q L   ++  +P ++E++++LL+ + + ++ L ++E+SLLQ L +A G IL++  ++ +L   K+ +  I+Q ++E+ K+   ++     +LPL+   S+++F +  L++++ +Y++SL  FL +F   L  +   E  TD + R   +   L ++ YE V R +   DRL FAL M   C+  L    E  L      F+  +     N T  + + A++  +++ LA  +P     L  V +I +   W Q    S  E+ +PQ      +L    S   ++L+IQA RPDR+ +A       VL    +  +   ++   + + +   N P L+   PG D S  + +L+ +   +++ + +A+G      QA+  +N+     + G W+ LKN+HL   WL  LEK+++SL+PH  FRL++T E +      LL++     +E PPG++ NLLR++       + KT S  RA   F LAWFHAI+QER  ++P GW K YEF+ +DLR   + LD  I  +           + W  +  L   +I+GG++DN FD R+L+S++K+ F            + V+G+      I +P    +  +L  I  L+D  +PS+  LP+N ++       + ++ +L  +Q+                 S  G   D +  W + L+     W ++L + L ++K ++       +   P+  + + E  +  +L++ V   L  +  + +G +  T   +++   L+ G  P  W +++  P       ++     + + ++K ++L   +   EL    + LG L +P+ ++ A RQ  A+    S++EL     +   G  N        +  L ++G         +C  +    +++I++  PV++  W+  +     S+   ++LP+Y +  R +++  +D+   +GQ+   + + GVA+ 
Sbjct: 1201 VDNIEGEWSAFNEIIKRKDTAIQTQVASLQAKIVAEDKAVETRTVDFLNDWEKTKP------TGGKIRPDDALQQLQIFESKYSRLKEERDNVVKAKEALELQESAVPNNSAERMNVALEELQDL---RGVWSELSKVWTQIDETREKPWLSVQPRK------LRQQLEAMM-AQLKELPARLRMYESYEYVKKLIQSYIKVNMLIVELKSDALKERHWKQLTKQLRV--NWVLSDLSLGQVWDV--NLQKNEGIVKDIILVAQGEMALEEFLKQVRESWQNYELDLINY----QNKCRIIRGWDDLFNKVKEHINSVAAMKLSPYYKVFEEEALTWEEKLNRINALFDVWIDVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAVQRSLERLADLLGKIQKALGEYLERERTSFPRFYFVGDEDLLEIIGNSKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVEKQMRFTLASLLAQAVQDIKQFRDGKIDPQAYMEWCDKYQAQIVVLAAQILWSEDVESALQQASENNQSKPMQRVLG-NVESTLNVLADSVLQEQPPLRRRKLEHLINEFVHKRTVTRRLLNNGVTSPKSFQWLCEMRFYFDPRQTEVLQQLTIHMANARFFYGFEYLGVQDRLVQTPLTDRCYLTMTQALESRLGGSPFGPAGTGKTESVKALGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQIQTIQEALKYEMDSNKESITVELVGKQVRVSPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTTPDRQLIAEVMLFSQGFRSAEKLACKIVPFFKLCDEQLSNQSHYDFGLRALKSVLISAGNVKRDRIMKIKEQMKQRGDENIDEASVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPNVGYTRAEMKGLKEEIRKVCQEDYLVCGEGDEQGAAWMEKVLQLYQISNLNHGLMMVGPSGSGKSTAWKTLLKALERFEGVEGVAHVIDPKAISKEALYGVLDPNTREWTDGLFTHILRKIIDNVRGEINKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRVMFEVQDLKFATLATVSRCGMVWFSEDVLSTEMIFENYLSRLRSIPLEDGDEDFVGVIKPAKDKEEEVSPSLQVQRDIALLLLPFF--SADGIVVRTLEYAMDQEHIMDFTRLRALSSLFSMLNQAARNVLTFNAQHPDFPCSADQLEHYIPKALVYSVLWSFAGDAKLKVRIDLGDFVRSVTTVPLPGAAGAPIIDYEVNMSGDWVPWSNKVPVIEVETHKVASPD-------IVVP---TLDTVRHESLLYTWLAE--HKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRKTPNGVVLSPVQIGKWLVLFCDEINLPDMDSYGTQRVISFLRQLVEHKGFYRASDQAWVSLERIQFVGACNPPTDPGRKPLSHRFLRHVPIIYVDYPGETSLKQIYGTFSRAML-RLMP-----ALRGYAEPLTNAMVEFYLASQDRFTQDMQPHYVYSPREMTRWVRGICEAIRPL--DSLPVEGLVRLWAHEALRLFQDRLVDDSERR-------------WTNENIDLVGQKHFPGINQEEALQRPILYSNWLSKDYMPVNREELREYVHARLKVFYEEELDVPLVLFDEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSIFQIKVHNKYTSEDFDEDLRCVLRRSGCKDEKIAFILDESNVLDSGFLERMNTLLANGEVPGLFEGDEYTTLMTQCKEGAQREGLMLDSSDELYKWFTQQVMRNLHVVFTMNPSTDGLKDRAATSPALFNRCVLNWFGDWSDSALFQVGKEFTTRVDLEKPNWHAPDFFPSVCPLVPANPTHRDAVINSCVYVHQTLHQANARLAKRGGRTMAVTPRHYLDFIHHFVKLYNEKRSDLEEQQLHLNVGLNKIAETVEQVEEMQKSLAVKKQELQAKNEAANAKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVSSIKKKHLAEVRSMANPPAVVKLALESVCELLNESATDWKAIRGILVKDSFISSIVNLETDKITDDVREKMKSKYLSNPD-YNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADVNLASA-KETKDL---VEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETFKSQMSTIIGDVLLSAAFIAYGGYFDQHYRLNLFTTWSQHLQAASIQYRADIARTEYLSNPDERLRWQANALPTDDLCTENAIMLKRFNRYPLIIDPSGQATTFLLNEYAGKKITKTSFLDDSFRKNLESALRFGNPLLVQDVENYDPILNPVLNRELRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDICSRVTFVNFTVTRSSLQSQCLNQVLKAERPDIDEKRSDLLKLQGEFRLRLRQLEKSLLQALNDAKGKILDDDSVITTLETLKKEAYDINQKVDETDKVIAEIETVSQQYLPLSVACSNIYFTMDSLNQVHFLYQYSLKMFLDIFSTVLYNNPKLEGRTDHSERLGIVTRDLFQVCYERVARGMIHIDRLTFALLM---CKIHLKGTSESNLDAEFNFFLRSREGLLANPTPVEGLSAEQIESVNRLALRLPIFRKLLEKVRSIPELGAWLQ---QSSPEQVVPQLWDESKALSPIASSVHQLLLIQAFRPDRVIAAAHNVVNTVLGEDFMPNAEQELDFTSVVDKQLNCNTPALLCSVPGFDASGRVDDLAAE--QNKQISSIAIGSAEGFNQAERAINM---ACKTGRWVLLKNVHLAPQWLVQLEKKMHSLQPHSGFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGIRANLLRTFSTVPAARMMKTPS-ERARLYFLLAWFHAIVQERLRYVPLGWAKKYEFNESDLRVACDTLDTWIDTTAMGRTNLPPEKVPWDALVTLLSQSIYGGKIDNDFDQRLLTSFLKKLFTARSFEADFALVANVDGASGGLRHITMPDGTRRDHFLKWIENLTDRQTPSWLGLPNNAEKVLLTTRGTDLVSKLLKMQQLEDDDELAYSVEDQSEQSAVGRGEDGRPSWMKTLHNSATAWLELLPKNLQVLKRTV------ENIKDPLYRYFEREVTSGSRLLQTVILDLQDVVLICQGEKKQTNHHRSMLSELVRGIIPKGW-KRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGFPVWLGGLLNPEAYITATRQCVAQANSWSLEELALDVTITDAGLKNDQKDCCFGVTGLKLQGA--------QCKNNELLLASTIMMDLPVTILKWIKISSEPRISK---LTLPVYLNSTRTELLFTVDLAVAAGQESHSFYERGVAVL 4632          

HSP 2 Score: 76.2554 bits (186), Expect = 8.284e-13
Identity = 87/428 (20.33%), Postives = 176/428 (41.12%), Query Frame = 3
Query:  780 NPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKL-------IKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQIL-----PHRE-----------RQEFKIEEAFKYFLNILPLAYNPYTE-----------PIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETK------NFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGL-LYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFY 1931
            N  YP  R   L+E I+ +L + +   L         +   +  + Q  E+ S W D  DKL       +K+   ++L   W              Q R+  +   R  HEQ+  ++     P +            +Q + ++ A    +  + LAY    E             W+ AVK++   I+  ET I   L+    +  +A+   ++ R+F R+N L  RP I   + + +  L+ ++    + L E F     +S+  ++   ++       I+W++Q++ +L   L    +VL    G+E  ++  K      +F  ++S    + F +W +++  R  +  + G    ++     + + + L L VN+   ++ L +EVR +  LG+ +  +++  A    + Y  A+ L +  + Y
Sbjct:  369 NTKYPIQRCLKLIEAISRDLSQQLLKVLGTRRLMHIPFDEFERVMNQCFEIFSCWDDEYDKLQGLLRDIVKKKRDEHLKMVWRVS-----PAHKKLQTRMEHMRKFRRQHEQLRTVILRVLRPTKPAVGDDGNVVETKQPYSLDAADANAIEEVNLAYENVKEVDCLDITKEGSEAWEAAVKRYEEKIDRVETRITAHLR---DQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIEALHEKFKVQYPQSKSCRLSSVRDLPPVAGSIIWARQIDNQLTMYLKRVEDVLGK--GWETHIEGQKLKADGDSFRAKLSI--SDVFHEWARKVQER--NFGSTGRIFTIESTRSRIGRGNVLRLRVNFLPEIITLAKEVRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTY 782          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0073359)

HSP 1 Score: 1381.31 bits (3574), Expect = 0.000e+0
Identity = 1017/3531 (28.80%), Postives = 1776/3531 (50.30%), Query Frame = 3
Query: 3087 VSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQME--------PEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRL---------QKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITS--EVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINA-----DKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTF----IVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFY----QKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQE------ITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIE--NVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHK------KMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQ-EI--QSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATI-----------------------SRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHL-----LSTYLDDFFYKSLDWIAKRN-EFTISTSNVG--TVYNGLSNLKAIKNKAHFSV---------------------------CLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEK------QNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAV-SLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX-XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN---SAKP--KTQLTGSDNLNSYFLDLHDTCPVEFS------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRG-IQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENE----QNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMR------KFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTS---EISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFT--GTFISDKSD--RNITVPKWIDADRTVAISNLASAMP----ELWSVLNIKDDDLWHQFAKSSECEREIPQ------SLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHL--SPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFND----------SVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRF----------------SVHGTKFD-KDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPE--EPFDYMRILILKAKAVEKWAEL---SEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRD----SNSIVLLPPVSV-GWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQD-KWIQSGVALF 12983
            V  ++ +W  F  +++     +Q Q+  ++  I++  K  +   + F + W+  KP      +G      DA+Q+++  + +   L   + N+ K  E  +++         E   +  E  +D+   + +WS+  +  T +    ++ WLS + R       L Q  E +  A++  +  RL         +K I  Y  +  ++  ++ + L + HW ++ + L +     L  L+L  + D    + ++   +K++   AQGE+ + E ++++          L+ Y     N   +I+ W D+ ++V ++   + ++K SPYY+ F+++A  WE KL  ++        +QR+WVYLE IF  +A     LP E SRF+ +  +F  +M  V ++ +V+ + ++  ++  L  + D L + QKAL EYLE +R+ FPRFYF+GD+DLLEI+G S N   ++ H KK+F G+  +  N++   I+ + S +GE V   N V      ++  WL  +  +M+ TL+  L+ A+QD++          A     DKY +QI+ L+  I ++   E  L + +     K + + L     + +++ ADS       +   KL+ LI + VH   +  +LL+    S   ++WL ++RFY    Q    Q   I M +A F Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVKALG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSA S QIQ IQ+ +K ++        + L+ ++V V  + AIFIT+NP   GY GR  LPDNLK+LFR +AM+ PD  LIAEV+L S GF++A++L  K+V  F L  E L+ Q HYD+GLRALK+VL  A N+    +   K +MK +G++ I+  +V ++  E ++++Q++    + KL   D     SL+ DVFPN+     E   L   I +V +E  +V  +G  +      K+L++Y+      G+++VGPSGSGKST WK L  AL +  G     +V++PKAI +  L G +D +TREW+DG+ T+  R+++   + EI  + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+                       SR+  I L     D   ++     K++E    L     ++  L  FF  S D I  R  E+ +   ++   T    LS+L ++ N+A  +V                            ++    G+     R     +V  +T    P      +++Y  N         N++     E  +  S D       I+ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +  C    +  G V  P +  + L+L+  +INLP +D +GT ++ISFL+Q++ +KGFY  S+  +V L+ +Q V + N  +  GR  LS RF   V +  + YP +  L  IY  + + +L RL+P     +     + L N M+E Y   + +FT D   HY+++P ++T+WV  +     P+  D+  V  L+ + ++E++R+FQDRLV    R+             W+ E  D +    F      E             K    +  E L++ +   L  +  E  D+ ++LF EV D+V ++DR+  +P G +LL G SG G+ T S  V+ M+ + +   K+H  Y  + F  DL+  L+ +G + E I  +L++   L+  +LE +N+LLA+GEVPGL+  +E   ++   K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS  ++ ++      ++  E+ +    +   S  P      T  D + +  + +H T     +            T RHY++FI  ++++Y +K++++E +Q H+ VG+ KI+E  E V E++   A + + L  K   A+  LK++    Q A ++K + +++ ++  ++ V + +++  +  +LA +EP V  A+ AV  I+   L E+R +  PP V++  LE + L++G   T W S+R  + +   I   +  F    IT + R +++       D ++ +   RAS+A  P+  W  A ++Y+  L+++ PL  E    + Q   NL +A K+ KDL   V  +++++A Y++++ +  + A  ++ +L+N    +  +  L+  L  E ERW        +++S +    LL+AA + Y     +  R      W +         R      ++L+   E+L W+   L +D+L  ENA+++ +    P +IDPS  AT +L N +  +K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  +L   G R ++ LGD+ ID +P F +FL+TR+P  + PPD  + V+ VNFT T++ L+ Q L   ++  +P ++E++++LL+ + + ++ L ++E+SLLQ L +A G IL++  ++ +L   K+ +  I+Q ++E+ K+   ++     +LPL+   S+++F +  L++++ +Y++SL  FL +F   L  +   E  TD + R   +   L ++ YE V R +   DRL FAL M   C+  L    E  L      F+  +     N T  + + A++  +++ LA  +P     L  V +I +   W Q    S  E+ +PQ      +L    S   ++L+IQA RPDR+ +A       VL    +  +   ++   + + +   N P L+   PG D S  + +L+ +   +++ + +A+G      QA+  +N+     + G W+ LKN+HL   WL  LEK+++SL+PH  FRL++T E +      LL++     +E PPG++ NLLR++       + KT S  RA   F LAWFHAI+QER  ++P GW K YEF+ +DLR   + LD  I  +           + W  +  L   +I+GG++DN FD R+L+S++K+ F            + V+G+      I +P    +  +L  I  L+D  +PS+  LP+N ++       + ++ +L  +Q+                 S  G   D +  W + L+     W ++L + L ++K ++       +   P+  + + E  +  +L++ V   L  +  + +G +  T   +++   L+ G  P  W +++  P       ++     + + ++K ++L   +   EL    + LG L +P+ ++ A RQ  A+    S++EL     +   G  N        +  L ++G         +C  +    +++I++  PV++  W+  +     S+   ++LP+Y +  R +++  +D+   +GQ+   + + GVA+ 
Sbjct: 1201 VDNIEGEWSAFNEIIKRKDTAIQTQVASLQAKIVAEDKAVETRTVDFLNDWEKTKP------TGGKIRPDDALQQLQIFESKYSRLKEERDNVVKAKEALELQESAVPNNSAERMNVALEELQDL---RGVWSELSKVWTQIDETREKPWLSVQPRK------LRQQLEAMM-AQLKELPARLRMYESYEYVKKLIQSYIKVNMLIVELKSDALKERHWKQLTKQLRV--NWVLSDLSLGQVWDV--NLQKNEGIVKDIILVAQGEMALEEFLKQVRESWQNYELDLINY----QNKCRIIRGWDDLFNKVKEHINSVAAMKLSPYYKVFEEEALTWEEKLNRINALFDVWIDVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAVQRSLERLADLLGKIQKALGEYLERERTSFPRFYFVGDEDLLEIIGNSKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVEKQMRFTLASLLAQAVQDIKQFRDGKIDPQAYMEWCDKYQAQIVVLAAQILWSEDVESALQQASENNQSKPMQRVLG-NVESTLNVLADSVLQEQPPLRRRKLEHLINEFVHKRTVTRRLLNNGVTSPKSFQWLCEMRFYFDPRQTEVLQQLTIHMANARFFYGFEYLGVQDRLVQTPLTDRCYLTMTQALESRLGGSPFGPAGTGKTESVKALGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQIQTIQEALKYEMDSNKESITVELVGKQVRVSPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTTPDRQLIAEVMLFSQGFRSAEKLACKIVPFFKLCDEQLSNQSHYDFGLRALKSVLISAGNVKRDRIMKIKEQMKQRGDENIDEASVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPNVGYTRAEMKGLKEEIRKVCQEDYLVCGEGDEQGAAWMEKVLQLYQISNLNHGLMMVGPSGSGKSTAWKTLLKALERFEGVEGVAHVIDPKAISKEALYGVLDPNTREWTDGLFTHILRKIIDNVRGEINKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRVMFEVQDLKFATLATVSRCGMVWFSEDVLSTEMIFENYLSRLRSIPLEDGDEDFVGVIKPAKDKEEEVSPSLQVQRDIALLLLPFF--SADGIVVRTLEYAMDQEHIMDFTRLRALSSLFSMLNQAARNVLTFNAQHPDFPCSADQLEHYIPKALVYSVLWSFAGDAKLKVRIDLGDFVRSVTTVPLPGAAGAPIIDYEVNMSGDWVPWSNKVPVIEVETHKVASPD-------IVVP---TLDTVRHESLLYTWLAE--HKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRKTPNGVVLSPVQIGKWLVLFCDEINLPDMDSYGTQRVISFLRQLVEHKGFYRASDQAWVSLERIQFVGACNPPTDPGRKPLSHRFLRHVPIIYVDYPGETSLKQIYGTFSRAML-RLMP-----ALRGYAEPLTNAMVEFYLASQDRFTQDMQPHYVYSPREMTRWVRGICEAIRPL--DSLPVEGLVRLWAHEALRLFQDRLVDDSERR-------------WTNENIDLVGQKHFPGINQEEALQRPILYSNWLSKDYMPVNREELREYVHARLKVFYEEELDVPLVLFDEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSIFQIKVHNKYTSEDFDEDLRCVLRRSGCKDEKIAFILDESNVLDSGFLERMNTLLANGEVPGLFEGDEYTTLMTQCKEGAQREGLMLDSSDELYKWFTQQVMRNLHVVFTMNPSTDGLKDRAATSPALFNRCVLNWFGDWSDSALFQVGKEFTTRVDLEKPNWHAPDFFPSVCPLVPANPTHRDAVINSCVYVHQTLHQANARLAKRGGRTMAVTPRHYLDFIHHFVKLYNEKRSDLEEQQLHLNVGLNKIAETVEQVEEMQKSLAVKKQELQAKNEAANAKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVKSIRKQQLVEVRTMANPPSVVKLALESICLLLGENATDWKSIRAVIMRENFINSIVSNFGTENITDDVREKMKSKYLSNPD-YNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADVNLASA-KETKDL---VEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETFKSQMSTIIGDVLLSAAFIAYGGYFDQHYRLNLFTTWSQHLQAASIQYRADIARTEYLSNPDERLRWQANALPTDDLCTENAIMLKRFNRYPLIIDPSGQATTFLLNEYAGKKITKTSFLDDSFRKNLESALRFGNPLLVQDVENYDPILNPVLNRELRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDICSRVTFVNFTVTRSSLQSQCLNQVLKAERPDIDEKRSDLLKLQGEFRLRLRQLEKSLLQALNDAKGKILDDDSVITTLETLKKEAYDINQKVDETDKVIAEIETVSQQYLPLSVACSNIYFTMDSLNQVHFLYQYSLKMFLDIFSTVLYNNPKLEGRTDHSERLGIVTRDLFQVCYERVARGMIHIDRLTFALLM---CKIHLKGTSESNLDAEFNFFLRSREGLLANPTPVEGLSAEQIESVNRLALRLPIFRKLLEKVRSIPELGAWLQ---QSSPEQVVPQLWDESKALSPIASSVHQLLLIQAFRPDRVIAAAHNVVNTVLGEDFMPNAEQELDFTSVVDKQLNCNTPALLCSVPGFDASGRVDDLAAE--QNKQISSIAIGSAEGFNQAERAINM---ACKTGRWVLLKNVHLAPQWLVQLEKKMHSLQPHSGFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGIRANLLRTFSTVPAARMMKTPS-ERARLYFLLAWFHAIVQERLRYVPLGWAKKYEFNESDLRVACDTLDTWIDTTAMGRTNLPPEKVPWDALVTLLSQSIYGGKIDNDFDQRLLTSFLKKLFTARSFEADFALVANVDGASGGLRHITMPDGTRRDHFLKWIENLTDRQTPSWLGLPNNAEKVLLTTRGTDLVSKLLKMQQLEDDDELAYSVEDQSEQSAVGRGEDGRPSWMKTLHNSATAWLELLPKNLQVLKRTV------ENIKDPLYRYFEREVTSGSRLLQTVILDLQDVVLICQGEKKQTNHHRSMLSELVRGIIPKGW-KRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGFPVWLGGLLNPEAYITATRQCVAQANSWSLEELALDVTITDAGLKNDQKDCCFGVTGLKLQGA--------QCKNNELLLASTIMMDLPVTILKWIKISSEPRISK---LTLPVYLNSTRTELLFTVDLAVAAGQESHSFYERGVAVL 4633          

HSP 2 Score: 76.6406 bits (187), Expect = 7.878e-13
Identity = 87/428 (20.33%), Postives = 176/428 (41.12%), Query Frame = 3
Query:  780 NPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKL-------IKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQIL-----PHRE-----------RQEFKIEEAFKYFLNILPLAYNPYTE-----------PIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETK------NFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGL-LYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFY 1931
            N  YP  R   L+E I+ +L + +   L         +   +  + Q  E+ S W D  DKL       +K+   ++L   W              Q R+  +   R  HEQ+  ++     P +            +Q + ++ A    +  + LAY    E             W+ AVK++   I+  ET I   L+    +  +A+   ++ R+F R+N L  RP I   + + +  L+ ++    + L E F     +S+  ++   ++       I+W++Q++ +L   L    +VL    G+E  ++  K      +F  ++S    + F +W +++  R  +  + G    ++     + + + L L VN+   ++ L +EVR +  LG+ +  +++  A    + Y  A+ L +  + Y
Sbjct:  369 NTKYPIQRCLKLIEAISRDLSQQLLKVLGTRRLMHIPFDEFERVMNQCFEIFSCWDDEYDKLQGLLRDIVKKKRDEHLKMVWRVS-----PAHKKLQTRMEHMRKFRRQHEQLRTVILRVLRPTKPAVGDDGNVVETKQPYSLDAADANAIEEVNLAYENVKEVDCLDITKEGSEAWEAAVKRYEEKIDRVETRITAHLR---DQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIEALHEKFKVQYPQSKSCRLSSVRDLPPVAGSIIWARQIDNQLTMYLKRVEDVLGK--GWETHIEGQKLKADGDSFRAKLSI--SDVFHEWARKVQER--NFGSTGRIFTIESTRSRIGRGNVLRLRVNFLPEIITLAKEVRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTY 782          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Match: Dhc64C (gene:FBgn0261797 transcript:FBtr0332747)

HSP 1 Score: 1380.93 bits (3573), Expect = 0.000e+0
Identity = 1016/3530 (28.78%), Postives = 1774/3530 (50.25%), Query Frame = 3
Query: 3087 VSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQME--------PEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRL---------QKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITS--EVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINA-----DKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTF----IVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFY----QKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQE------ITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIE--NVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHK------KMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQ-EI--QSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATI-----------------------SRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHL-----LSTYLDDFFYKSLDWIAKRN-EFTISTSNVG--TVYNGLSNLKAIKNKAHFSV---------------------------CLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEK------QNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY-DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX-XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN---SAKP--KTQLTGSDNLNSYFLDLHDTCPVEFS------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRG-IQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENE----QNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMR------KFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTS---EISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFT--GTFISDKSD--RNITVPKWIDADRTVAISNLASAMP----ELWSVLNIKDDDLWHQFAKSSECEREIPQ------SLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHL--SPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQG----QADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFND----------SVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRF----------------SVHGTKFD-KDIWSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPE--EPFDYMRILILKAKAVEKWAEL---SEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRD----SNSIVLLPPVSV-GWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQD-KWIQSGVALF 12983
            V  ++ +W  F  +++     +Q Q+  ++  I++  K  +   + F + W+  KP      +G      DA+Q+++  + +   L   + N+ K  E  +++         E   +  E  +D+   + +WS+  +  T +    ++ WLS + R       L Q  E +  A++  +  RL         +K I  Y  +  ++  ++ + L + HW ++ + L +     L  L+L  + D    + ++   +K++   AQGE+ + E ++++          L+ Y     N   +I+ W D+ ++V ++   + ++K SPYY+ F+++A  WE KL  ++        +QR+WVYLE IF  +A     LP E SRF+ +  +F  +M  V ++ +V+ + ++  ++  L  + D L + QKAL EYLE +R+ FPRFYF+GD+DLLEI+G S N   ++ H KK+F G+  +  N++   I+ + S +GE V   N V      ++  WL  +  +M+ TL+  L+ A+QD++          A     DKY +QI+ L+  I ++   E  L + +     K + + L     + +++ ADS       +   KL+ LI + VH   +  +LL+    S   ++WL ++RFY    Q    Q   I M +A F Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVKALG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSA S QIQ IQ+ +K ++        + L+ ++V V  + AIFIT+NP   GY GR  LPDNLK+LFR +AM+ PD  LIAEV+L S GF++A++L  K+V  F L  E L+ Q HYD+GLRALK+VL  A N+    +   K +MK +G++ I+  +V ++  E ++++Q++    + KL   D     SL+ DVFPN+     E   L   I +V +E  +V  +G  +      K+L++Y+      G+++VGPSGSGKST WK L  AL +  G     +V++PKAI +  L G +D +TREW+DG+ T+  R+++   + EI  + WII DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+                       SR+  I L     D   ++     K++E    L     ++  L  FF  S D I  R  E+ +   ++   T    LS+L ++ N+A  +V                            ++    G+     R     +V  +T    P      +++Y  N         N++     E  +  S D       I+ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +  C    +  G V  P +  + L+L+  +INLP +D +GT ++ISFL+Q++ +KGFY  S+  +V L+ +Q V + N  +  GR  LS RF   V +  + YP +  L  IY  + + +L RL+P     +     + L N M+E Y   + +FT D   HY+++P ++T+WV  +     P+ S      L+ + ++E++R+FQDRLV    R+             W+ E  D +    F      E             K    +  E L++ +   L  +  E  D+ ++LF EV D+V ++DR+  +P G +LL G SG G+ T S  V+ M+ + +   K+H  Y  + F  DL+  L+ +G + E I  +L++   L+  +LE +N+LLA+GEVPGL+  +E   ++   K+ A   G        L  +F  ++   LH++  M+ S         ++PA F  C + W   WS  ++ ++      ++  E+ +    +   S  P      T  D + +  + +H T     +            T RHY++FI  ++++Y +K++++E +Q H+ VG+ KI+E  E V E++   A + + L  K   A+  LK++    Q A ++K + +++ ++  ++ V + +++  +  +LA +EP V  A+ AV  I+   L E+R +  PP V++  LE + L++G   T W S+R  + +   I   +  F    IT + R +++       D ++ +   RAS+A  P+  W  A ++Y+  L+++ PL  E    + Q   NL +A K+ KDL   V  +++++A Y++++ +  + A  ++ +L+N    +  +  L+  L  E ERW        +++S +    LL+AA + Y     +  R      W +         R      ++L+   E+L W+   L +D+L  ENA+++ +    P +IDPS  AT +L N +  +K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  +L   G R ++ LGD+ ID +P F +FL+TR+P  + PPD  + V+ VNFT T++ L+ Q L   ++  +P ++E++++LL+ + + ++ L ++E+SLLQ L +A G IL++  ++ +L   K+ +  I+Q ++E+ K+   ++     +LPL+   S+++F +  L++++ +Y++SL  FL +F   L  +   E  TD + R   +   L ++ YE V R +   DRL FAL M   C+  L    E  L      F+  +     N T  + + A++  +++ LA  +P     L  V +I +   W Q    S  E+ +PQ      +L    S   ++L+IQA RPDR+ +A       VL    +  +   ++   + + +   N P L+   PG D S  + +L+ +   +++ + +A+G      QA+  +N+     + G W+ LKN+HL   WL  LEK+++SL+PH  FRL++T E +      LL++     +E PPG++ NLLR++       + KT S  RA   F LAWFHAI+QER  ++P GW K YEF+ +DLR   + LD  I  +           + W  +  L   +I+GG++DN FD R+L+S++K+ F            + V+G+      I +P    +  +L  I  L+D  +PS+  LP+N ++       + ++ +L  +Q+                 S  G   D +  W + L+     W ++L + L ++K ++       +   P+  + + E  +  +L++ V   L  +  + +G +  T   +++   L+ G  P  W +++  P       ++     + + ++K ++L   +   EL    + LG L +P+ ++ A RQ  A+    S++EL     +   G  N        +  L ++G         +C  +    +++I++  PV++  W+  +     S+   ++LP+Y +  R +++  +D+   +GQ+   + + GVA+ 
Sbjct: 1214 VDNIEGEWSAFNEIIKRKDTAIQTQVASLQAKIVAEDKAVETRTVDFLNDWEKTKP------TGGKIRPDDALQQLQIFESKYSRLKEERDNVVKAKEALELQESAVPNNSAERMNVALEELQDL---RGVWSELSKVWTQIDETREKPWLSVQPRK------LRQQLEAMM-AQLKELPARLRMYESYEYVKKLIQSYIKVNMLIVELKSDALKERHWKQLTKQLRV--NWVLSDLSLGQVWDV--NLQKNEGIVKDIILVAQGEMALEEFLKQVRESWQNYELDLINY----QNKCRIIRGWDDLFNKVKEHINSVAAMKLSPYYKVFEEEALTWEEKLNRINALFDVWIDVQRRWVYLEGIFSGSADIKTLLPVETSRFQSISSEFLGLMKKVTKSPKVMDVLNIPAVQRSLERLADLLGKIQKALGEYLERERTSFPRFYFVGDEDLLEIIGNSKNIARLQKHFKKMFAGVAAILLNEENNVILGISSREGEEVHFMNPVSTVEHPKINEWLSLVEKQMRFTLASLLAQAVQDIKQFRDGKIDPQAYMEWCDKYQAQIVVLAAQILWSEDVESALQQASENNQSKPMQRVLG-NVESTLNVLADSVLQEQPPLRRRKLEHLINEFVHKRTVTRRLLNNGVTSPKSFQWLCEMRFYFDPRQTEVLQQLTIHMANARFFYGFEYLGVQDRLVQTPLTDRCYLTMTQALESRLGGSPFGPAGTGKTESVKALGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSACSQQIQTIQEALKYEMDSNKESITVELVGKQVRVSPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTTPDRQLIAEVMLFSQGFRSAEKLACKIVPFFKLCDEQLSNQSHYDFGLRALKSVLISAGNVKRDRIMKIKEQMKQRGDENIDEASVAENLPEQEILIQSVCETMVPKLVAEDIPLLFSLLSDVFPNVGYTRAEMKGLKEEIRKVCQEDYLVCGEGDEQGAAWMEKVLQLYQISNLNHGLMMVGPSGSGKSTAWKTLLKALERFEGVEGVAHVIDPKAISKEALYGVLDPNTREWTDGLFTHILRKIIDNVRGEINKRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSLPPNVRVMFEVQDLKFATLATVSRCGMVWFSEDVLSTEMIFENYLSRLRSIPLEDGDEDFVGVIKPAKDKEEEVSPSLQVQRDIALLLLPFF--SADGIVVRTLEYAMDQEHIMDFTRLRALSSLFSMLNQAARNVLTFNAQHPDFPCSADQLEHYIPKALVYSVLWSFAGDAKLKVRIDLGDFVRSVTTVPLPGAAGAPIIDYEVNMSGDWVPWSNKVPVIEVETHKVASPD-------IVVP---TLDTVRHESLLYTWLAE--HKPLVLCGPPGSGKTMTLFSALRALPDMEVVGLNFSSATTPELLLKTFDHYCEYRKTPNGVVLSPVQIGKWLVLFCDEINLPDMDSYGTQRVISFLRQLVEHKGFYRASDQAWVSLERIQFVGACNPPTDPGRKPLSHRFLRHVPIIYVDYPGETSLKQIYGTFSRAML-RLMP-----ALRGYAEPLTNAMVEFYLASQDRFTQDMQPHYVYSPREMTRWVRGICEAIRPLDSLPVE-GLVRLWAHEALRLFQDRLVDDSERR-------------WTNENIDLVGQKHFPGINQEEALQRPILYSNWLSKDYMPVNREELREYVHARLKVFYEEELDVPLVLFDEVLDHVLRIDRIFRQPQGHLLLIGVSGAGKTTLSRFVAWMNGLSIFQIKVHNKYTSEDFDEDLRCVLRRSGCKDEKIAFILDESNVLDSGFLERMNTLLANGEVPGLFEGDEYTTLMTQCKEGAQREGLMLDSSDELYKWFTQQVMRNLHVVFTMNPSTDGLKDRAATSPALFNRCVLNWFGDWSDSALFQVGKEFTTRVDLEKPNWHAPDFFPSVCPLVPANPTHRDAVINSCVYVHQTLHQANARLAKRGGRTMAVTPRHYLDFIHHFVKLYNEKRSDLEEQQLHLNVGLNKIAETVEQVEEMQKSLAVKKQELQAKNEAANAKLKQMFQDQQEAEKKKIQSQEIQIRLADQTVKIEEKRKYVMADLAQVEPAVIDAQAAVKSIRKQQLVEVRTMANPPSVVKLALESICLLLGENATDWKSIRAVIMRENFINSIVSNFGTENITDDVREKMKSKYLSNPD-YNFEKVNRASMACGPMVKWAIAQIEYADMLKRVEPLREELRSLEEQADVNLASA-KETKDL---VEQLERSIAAYKEEYAQLISQAQAIKTDLENVQAKVDRSIALLKSLNIERERWESTSETFKSQMSTIIGDVLLSAAFIAYGGYFDQHYRLNLFTTWSQHLQAASIQYRADIARTEYLSNPDERLRWQANALPTDDLCTENAIMLKRFNRYPLIIDPSGQATTFLLNEYAGKKITKTSFLDDSFRKNLESALRFGNPLLVQDVENYDPILNPVLNRELRRTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDICSRVTFVNFTVTRSSLQSQCLNQVLKAERPDIDEKRSDLLKLQGEFRLRLRQLEKSLLQALNDAKGKILDDDSVITTLETLKKEAYDINQKVDETDKVIAEIETVSQQYLPLSVACSNIYFTMDSLNQVHFLYQYSLKMFLDIFSTVLYNNPKLEGRTDHSERLGIVTRDLFQVCYERVARGMIHIDRLTFALLM---CKIHLKGTSESNLDAEFNFFLRSREGLLANPTPVEGLSAEQIESVNRLALRLPIFRKLLEKVRSIPELGAWLQ---QSSPEQVVPQLWDESKALSPIASSVHQLLLIQAFRPDRVIAAAHNVVNTVLGEDFMPNAEQELDFTSVVDKQLNCNTPALLCSVPGFDASGRVDDLAAE--QNKQISSIAIGSAEGFNQAERAINM---ACKTGRWVLLKNVHLAPQWLVQLEKKMHSLQPHSGFRLFLTMEINPKVPVNLLRAGRIFVFEPPPGIRANLLRTFSTVPAARMMKTPS-ERARLYFLLAWFHAIVQERLRYVPLGWAKKYEFNESDLRVACDTLDTWIDTTAMGRTNLPPEKVPWDALVTLLSQSIYGGKIDNDFDQRLLTSFLKKLFTARSFEADFALVANVDGASGGLRHITMPDGTRRDHFLKWIENLTDRQTPSWLGLPNNAEKVLLTTRGTDLVSKLLKMQQLEDDDELAYSVEDQSEQSAVGRGEDGRPSWMKTLHNSATAWLELLPKNLQVLKRTV------ENIKDPLYRYFEREVTSGSRLLQTVILDLQDVVLICQGEKKQTNHHRSMLSELVRGIIPKGW-KRYTVPAGCTVIQWITDFSNRVQQLQKVSQLVSQAGAKELQGFPVWLGGLLNPEAYITATRQCVAQANSWSLEELALDVTITDAGLKNDQKDCCFGVTGLKLQGA--------QCKNNELLLASTIMMDLPVTILKWIKISSEPRISK---LTLPVYLNSTRTELLFTVDLAVAAGQESHSFYERGVAVL 4646          

HSP 2 Score: 76.6406 bits (187), Expect = 7.620e-13
Identity = 87/428 (20.33%), Postives = 176/428 (41.12%), Query Frame = 3
Query:  780 NPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKL-------IKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQIL-----PHRE-----------RQEFKIEEAFKYFLNILPLAYNPYTE-----------PIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETK------NFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGL-LYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFY 1931
            N  YP  R   L+E I+ +L + +   L         +   +  + Q  E+ S W D  DKL       +K+   ++L   W              Q R+  +   R  HEQ+  ++     P +            +Q + ++ A    +  + LAY    E             W+ AVK++   I+  ET I   L+    +  +A+   ++ R+F R+N L  RP I   + + +  L+ ++    + L E F     +S+  ++   ++       I+W++Q++ +L   L    +VL    G+E  ++  K      +F  ++S    + F +W +++  R  +  + G    ++     + + + L L VN+   ++ L +EVR +  LG+ +  +++  A    + Y  A+ L +  + Y
Sbjct:  369 NTKYPIQRCLKLIEAISRDLSQQLLKVLGTRRLMHIPFDEFERVMNQCFEIFSCWDDEYDKLQGLLRDIVKKKRDEHLKMVWRVS-----PAHKKLQTRMEHMRKFRRQHEQLRTVILRVLRPTKPAVGDDGNVVETKQPYSLDAADANAIEEVNLAYENVKEVDCLDITKEGSEAWEAAVKRYEEKIDRVETRITAHLR---DQLGTAKNANEMFRIFSRFNALFVRPHIRGAIREYQTQLIQRVKDDIEALHEKFKVQYPQSKSCRLSSVRDLPPVAGSIIWARQIDNQLTMYLKRVEDVLGK--GWETHIEGQKLKADGDSFRAKLSI--SDVFHEWARKVQER--NFGSTGRIFTIESTRSRIGRGNVLRLRVNFLPEIITLAKEVRNIKNLGFRVPLTIVNKAHQANQIYPYAISLIESVRTY 782          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:NCBI gene;Acc:100332402])

HSP 1 Score: 4329.63 bits (11228), Expect = 0.000e+0
Identity = 2234/4333 (51.56%), Postives = 3016/4333 (69.61%), Query Frame = 3
Query:   96 MSKIEDQRKDTIFLITKSHFPNQNSKFVNEEC--LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYE-----CEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEV--QDSLNDVWFVTWG-SREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGN----FYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            M+   D  +    L T  ++ + ++      C  LD F D+ +  +L V     +  FSN+L   D     LVF K  P +++ +N+   I+V+++ E+PIS+LY  ++ +Y P+LL D       D K+Q L+S+LE GLGS++R   +K S  +        I +  DE  FW D   +      + R          + ++   + S SL E    +EN    ++D+W+     P YP++RM  LM++I   L R +Q +L+ L  WED Y  V+E L   + VC  W+  C+ L  + WK+Y PH+W  + +      S  Q RL E+  +R+V E++ ++L    +Q+      ++ F  + P+ YNPYTEP+W+ AV +F R I PAE     +LK    +  + + PQQLL++FQ++ DLI R  IS  L  ERETLL +L+ + K LR DF    H +   K  P   +N  + ++ IVW +QL  K+ + L +   +L DL GF+  L+ + +  E++ ++ QEQFE W +++   L D  +      +  R+MEL   DG L + YSDRLV+L+REVR LS LG+ I   +  AA+  +KFY +A+ILKQVA FYNTI+ QMIP Q+ MML  A+ FE+++KS     K +  + W NP+EL Q+I KLQ A+  + ++NR LRK H    +K+V LMG+DLLRQQQ+WKD L ++R     +E+Q     +   W++H +HQLYKALE+QY +GLEALN+NLPEI +DLV++QGRLQF P FEE+++KY++EMK+FI++PNQFKG++++  G + IF  +IERNA+GF+  + KAE LF RLS  L+KFK+W+++G +D+E  V++H   + D+E+NFKA+K KGKEAE+LP+  K+DCITVNC P+++SVD LIQ +FDALL SLR++I+G I  +D+++  +++ LS RP++IDEI EA   H++    +  +  Q  ++E+ N LLR+VAGGG+DT+S L+ KWDKFELMMES Q+M++EQ+EVMK N+ SR + +QQD+ KF  RW  LKPG DI++SG  +A    VQ I++++ E  EL   +T L +DCEHF +   + TL  +  +D+     MW  +EE+ +GL+ +A+ DW+SFRS+ ++FEEFL  W ++LR   E ++M+++LQKE+D YK ++P+LK++RGE LSQ+HWL++FRL+++PRG TLE L  R +L  A  II     +K+LN +AQ EV+IREA+RELELWGAGA F L +Y D+Q  S+ +IK+WRD+++QVGDN+CLLQSLKDSPYY  FQDK ++WE +LADLDEYL NLN IQRKWVYL+PIFG+ ALP+E++RF+RVD+DF          +R L + S S +   L +   QL                                                   GI  V+F++  Q I  MKSL+GE V L N + I+++VE WL  L  EMK TL   L   +   +  N     ++  ++PSQ+LCL+E I FTA  E  + + ++  L+++L  KL  YT+   S    +   V  +KLK+LILD +HNI ++  L +    S  +W W KQLRFY  + DQ C IQMVDA+F YTYEYQGNA KLVHTPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQ+ +KN      LL + V++D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAM+ PDN+LIAEVIL S+GFK  K LGRKLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  +LL++ +       N+ ++       E+ L+VQALR+NT+SKLT+AD   F++L++DVFP +D K++EY+ L SA+  V +E ++  +  Q KK +E+YEQLRQRMGVV+VGPSG+GKST+W++LR AL K G+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQE+ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TDV SLV SWLK++DE  +  L  +L+D+F+++L+W+ K+++F + TS VGTV NGLS+L  ++ +  F + LI+GLGGNL    R+ FA  V     E  P+  K   L+ Y+++   RL  Y  +     CEEELS      D   L P+I T D QR+L  F  WL+++ +QPF+L GPEGCGK ++L   F +L+S QV+ +HCSAQT+  HVLQKL   C++I+SNTGRVYRPK+ ERL+LYLKDINLPK DKWGTS LI+FLQQV+TY+GFYD NLE+VGL+ +QIV SM++  ++GR +L++RFTSIVR+C+I YP ++QL  +Y+AYLKPVL+R +   P WS + K+  LA ++++VY Q+K+KF+VDD+SHYLFTP  LT+WVL+LLRYDL     NT  + L       M ++ D++            + N +H+ +S       S +DV+FVTW  S E ++ G P P  G+ L +L +  L + I +G++ Y R+ R+LDI+LF EV D ++++DRVLT PGGS+LLAG+SGVGRRT + +VSHMH   L +PK+ R Y LK FK+DLK+ + +A V+G+ +VLLLEDHQF+ P +LE++NSLL+SGEVPGLY+TEELEP+L SLKD A++ G  G + NYF+ R++  LH++LIMDC+N +F INC+SNPA ++ CSVQW+E WS  SM KIP ML+++I  +E ++  Q   K K   +    L   FL +H++C    +T   Y+NF+++Y  IY  K+ E+  +Q H+Q G+ K++EAK +V ELK +AAEQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  +   E   + +RK  ID+EL  ++P V +A+ AV +IKS  LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++EEI TFDAR IT E R  VEELL R K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LEKI PL+ E   L  NL   E +   LEK ++ V + V   ++ F+  T +AAKLE E+  A ETISAAE L+ +L+ E  RW  Q+ E++ EL  L  ++ L+AA + Y+P++PEDQR+  +  WM  +GL+KFD+R FL +E EQL WK EGL SD+LSMENALVILQ    PFLIDPSS AT WL+ H K  +LE++NQQD+NF TVLEL+VRFGKTLIIQE+DG+EPVLYPLLR DLI+QGPR VVQ+GDK++DYN DF+LFLATRNP P +PPDA ++++ VNFTTT+AGL+GQLLALT+Q  KP+LE +KT LLQ+EE+ KI+L+++EESLL+ LA A GNIL NK+L+ SLN+TK SS  I QSL +S +LQ SLD+ERDA+LPLAE  S ++FVI+DLSKINNMYRFSL SFLRLF RAL T + S  + +R ++L + L+ +VYEY+CRS+FK+D+LMFALH      P+LF+  EW++FTG  + D   K+D   ++    P WID +R +A++ + S  P L+  L + D DLW  F +SS CE+EIP  +  K+SLFQ++L++QALRPDRLQSA++ F    L +K LSP  +NL  +YE ET+  EP+L+IIS GADPSQ+LQEL+  ++G E Y++VAMGQGQAD+ L  L +C ++GDWLCLKNLHLVT+WLP+LEKELNS+KP   FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NL R+Y++WS + ISK G   RA +LF LAWFHA+ QERRN+IPQGWTKFYEFS++DLRAG EI+D++  +  +  QW F+ GL EN I+GGR+DN  D+ VL SY++++FN  +++ S      F  +I LP++ S  DY  +++ L + + PSFF LP NI+RSSQRIISSQVI QLRIL R    G+KFD++IWS  L+PVLN WK LNQG ++I  K +LP      S  SP+ +F+QLE++N+++LV+ +H SL SLSKV++G+ LLT +V  L+  LL  + P  W  +WEGPE+P  Y+R ++ +A A++ W E +E+  LLS +LDL ELFHPDTFLNALRQ TAR +  SMD LKFV  W G    AK  VK+G L +EGC FDG  ++E + DS S+  +PP  + W+  +    YS D+ ISLP+Y    R  +VT + +PC +G  D WIQSG ALFLK
Sbjct:    1 MAPGTDDPRKLFILTTAGNYFSLDTAASLSSCRPLDNFLDDGNEFLLSVTRQSEELQFSNKLENMDGDGRVLVFFKPHPCVVSEENLQRCILVSSMLESPISTLYQALRQVYSPVLLQDDKWSQSFDSKLQSLLSDLEIGLGSVLRHSDTKGSGKRN-------IMTPLDEFSFWADVSRSGQKSSERDRATHFCELFTTIEKDYSNLDSFSLVEVLDLIENTREAVDDVWKQNEHTP-YPETRMIRLMDVIGGALGRFVQRKLSDLRLWEDPYFTVREGLKGGVAVCEQWVAACEHLTGQVWKRYAPHQWTGEKHRPQGLHSLAQ-RLEEVVQVRSVCEKLQRLLSG-GKQQISAARVYQPFTGLNPIHYNPYTEPLWRAAVSQFDRLIAPAEQEAAGKLKTFIID--AQDSPQQLLQVFQKHRDLIKRATISKELQPERETLLTRLLDYNKGLRADFESRCHGTPGEKTGPLAGRNLPEVVNNIVWVRQLLLKVEDSLKMADALLSDLSGFQPLLRFSDDLQEQLRSYEQEQFEDWTRDLLSGLSDPKSG-----ISNRVMELDHMDGKLKIQYSDRLVSLLREVRQLSALGFTIPAKIQQAANTAEKFYRQAIILKQVAHFYNTIDQQMIPSQRPMMLGCALAFEQVIKSRDEGGKLQ--MTWENPKELEQYISKLQSAAERLSTENRKLRKWHTDFTDKVVGLMGVDLLRQQQRWKDGLQDLRAGFATLESQGFGAGDMRAWRQHWNHQLYKALEHQYQVGLEALNKNLPEINIDLVFKQGRLQFRPAFEEVRAKYYREMKRFISIPNQFKGVSET--GEEPIFTRMIERNASGFLTIFSKAEHLFSRLSHLLDKFKDWVVVGQVDVEVLVEKHLHSVQDWERNFKALKAKGKEAERLPSSEKVDCITVNCEPVRVSVDDLIQRLFDALLASLRRSIQGHIQVIDSFVNGAMETLSLRPESIDEIGEANAKHSQLQTQKPEVLPQFQQAEEKNRLLRSVAGGGLDTISSLRAKWDKFELMMESHQLMIREQVEVMKGNVESRVQVYQQDLQKFRARWDQLKPGNDIIESGDHEALQRCVQIIRERQAEFSELENTRTKLMEDCEHFNLSSPDGTLASDTLRDLQDCSQMWELYEEFHSGLEEIAQHDWISFRSKTHVFEEFLFAWHDRLRKLEEHSSMSVKLQKEVDRYKAVVPVLKYVRGEHLSQEHWLDLFRLISLPRGSTLETLQFRDLLRVADNIIDKTLELKDLNSRAQAEVSIREALRELELWGAGASFTLTDYTDTQGCSLPVIKDWRDVVNQVGDNRCLLQSLKDSPYYLRFQDKVSLWETRLADLDEYLHNLNTIQRKWVYLQPIFGRGALPREQARFQRVDQDF----------SRFLKIASDSAVLMQLGSSFHQL---------------------------------------------------GISSVEFDQSFQSITAMKSLEGETVPLINTICISNDVEVWLSALAAEMKNTLKHLLCECVNAGKKGN-----VDPTRFPSQVLCLAEQIEFTAAVEISIRQQSLHQLEQQLTAKLENYTSVDTSTDNTTESRVLQMKLKALILDVIHNISLVQSLREAQINSTDDWVWKKQLRFYLNA-DQSCSIQMVDADFRYTYEYQGNAAKLVHTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQDIQNSLKNHRSTCQLLNKEVDLDPNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMTSPDNELIAEVILYSEGFKEGKALGRKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGSLLQLQR-----LNNNPLK-------ESGLVVQALRLNTMSKLTFADSSRFDALVRDVFPGVDFKDVEYETLKSALLAVYEEAHLEIIPSQLKKAVELYEQLRQRMGVVVVGPSGAGKSTLWRMLRAALGKTGRLVKQYTMNPKAMPRQQLLGHIDMDTREWSDGVLTSSARQVVREPQEVNSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDTDVGSLVKSWLKREDEDCRMNLENWLNDYFHRALEWVLKQSDFVVDTSLVGTVLNGLSHLSGVRERGEFIMGLIRGLGGNLTLKCRQDFAKEVLSWARESPPDPRKP--LDTYYDQASGRLCVYELQRGEGVCEEELS------DPHNL-PVIHTPDTQRSLHSFSPWLSANHRQPFLLVGPEGCGKGMLLRCAFSQLRSTQVSVVHCSAQTSSRHVLQKLQHTCLLISSNTGRVYRPKDCERLLLYLKDINLPKPDKWGTSNLIAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGAVGRHTLTSRFTSIVRICTIDYPDREQLQTVYSAYLKPVLQRTLGNDPTWSSSGKIHQLAGSLVQVYEQVKAKFSVDDHSHYLFTPCLLTEWVLNLLRYDLSAGELNTLNNSLTSPKTLYMSLYIDQIP-----------IQNILHTGFSCCCICVFSASDVYFVTWAASHEGRSPGQPLPPHGRKLARLNASDLSEIIHKGIVLYGRDNRELDILLFPEVLDYMSRVDRVLTSPGGSLLLAGRSGVGRRTATCVVSHMHGATLFTPKISRSYSLKHFKSDLKTVMHSAAVDGQQVVLLLEDHQFVHPSFLEMVNSLLSSGEVPGLYSTEELEPLLASLKDQASQDGFTGPVLNYFSHRVQQNLHVVLIMDCTNEHFTINCESNPALYRKCSVQWMESWSDSSMKKIPEMLLSRIEEDEKTEDKQR--KKKKSASVHTELYRSFLAIHESCREFGATPSQYLNFLQVYQSIYSSKRKELTHKQQHLQAGVAKLNEAKALVDELKRRAAEQSSLLKTKQAEADAALQEITTSMQNASDQKTEMEKIKERMAHEVSKIEERKKKIDEELREVQPLVDEAKQAVGNIKSESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREEIATFDARSITHEIRQSVEELLHRNKASFDPKNAKRASAAAAPLAAWVKANVQYSHVLEKIEPLQTEHAGLMENLRKTENRKNRLEKELNSVGEKVLELKEKFQCRTTEAAKLESEVSRAQETISAAEKLLQQLDGEHTRWTAQVDEISEELDTLPKRAQLSAAFITYLPAAPEDQRRSSLDHWMSSSGLQKFDLRHFLCSESEQLIWKSEGLPSDDLSMENALVILQSASCPFLIDPSSRATEWLQTHLKAHRLEVINQQDANFMTVLELAVRFGKTLIIQEMDGVEPVLYPLLRRDLIAQGPRYVVQIGDKVMDYNEDFRLFLATRNPSPFIPPDAASVITEVNFTTTRAGLRGQLLALTIQQEKPELESQKTKLLQQEEEKKIQLAQLEESLLETLATAQGNILENKELIESLNQTKASSALIQQSLSQSHRLQTSLDQERDAYLPLAETASKMYFVITDLSKINNMYRFSLASFLRLFHRALQTKQESESTDVRISTLESSLKNMVYEYICRSLFKADQLMFALHFVKGMSPELFQENEWDVFTGLVVGDMVRKTDSQKSLREQFPSWIDQERLMAVALIKSTFPVLYQSLCLSDADLWLTFLRSSCCEQEIPLPVAKKISLFQQMLVVQALRPDRLQSAMAVFASQALGMKQLSPPPLNLKHLYE-ETLETEPVLLIISAGADPSQELQELAGNIVGRENYHEVAMGQGQADVALQALRECVRSGDWLCLKNLHLVTAWLPLLEKELNSMKPKAGFRLWLTAEVHPKFTPILLQSSLKITYEAPPGLKKNLKRTYESWSAEQISKGGLLARAQSLFCLAWFHAVCQERRNYIPQGWTKFYEFSLSDLRAGFEIIDRLF-EGGKAFQWDFVDGLLEN-IYGGRIDNVCDLLVLRSYLQQFFNAQLLSQSRKKTHAFPAQIHLPNSCSIADYRVVVDALPEDDRPSFFGLPANIERSSQRIISSQVISQLRILSRPVAAGSKFDREIWSSALSPVLNLWKRLNQGSSLIHQKVTLPS----ESVGSPIFSFIQLEQFNAVRLVQSIHQSLASLSKVIRGTSLLTADVHKLATALLNQECPLSWQNKWEGPEDPMQYLRAVVSRALAIQGWVERAERGGLLSEMLDLSELFHPDTFLNALRQETARLMSCSMDSLKFVTTWRGQITEAKLQVKVGGLQLEGCSFDGNRLSESHHDSPSVSSVPPCHMAWIPVSAMGCYSPDECISLPVYSSAERVCVVTNVQLPC-AGDHDTWIQSGAALFLK 4203          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:NCBI gene;Acc:100332402])

HSP 1 Score: 4316.15 bits (11193), Expect = 0.000e+0
Identity = 2231/4333 (51.49%), Postives = 3019/4333 (69.67%), Query Frame = 3
Query:   96 MSKIEDQRKDTIFLITKSHFPNQNSKFVNEEC--LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYE-----CEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEV--QDSLNDVWFVTWG-SREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGN----FYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            M+   D  +    L T  ++ + ++      C  LD F D+ +  +L V     +  FSN+L   D     LVF K  P +++ +N+   I+V+++ E+PIS+LY  ++ +Y P+LL D       D K+Q L+S+LE GLGS++R   +K S  +        I +  DE  FW D   +      + R          + ++   + S SL E    +EN    ++D+W+     P YP++RM  LM++I   L R +Q +L+ L  WED Y  V+E L   + VC  W+  C+ L  + WK+Y PH+W  + +      S  Q RL E+  +R+V E++ ++L    +Q+      ++ F  + P+ YNPYTEP+W+ AV +F R I PAE     +LK    +  + + PQQLL++FQ++ DLI R  IS  L  ERETLL +L+ + K LR DF    H +   K  P   +N  + ++ IVW +QL  K+ + L +   +L DL GF+  L+ + +  E++ ++ QEQFE W +++   L D  +      +  R+MEL   DG L + YSDRLV+L+REVR LS LG+ I   +  AA+  +KFY +A+ILKQVA FYNTI+ QMIP Q+ MML  A+ FE+++KS     K +  + W NP+EL Q+I KLQ A+  + ++NR LRK H    +K+V LMG+DLLRQQQ+WKD L ++R     +E+Q     +   W++H +HQLYKALE+QY +GLEALN+NLPEI +DLV++QGRLQF P FEE+++KY++EMK+FI++PNQFKG++++  G + IF  +IERNA+GF+  + KAE LF RLS  L+KFK+W+++G +D+E  V++H   + D+E+NFKA+K KGKEAE+LP+  K+DCITVNC P+++SVD LIQ +FDALL SLR++I+G I  +D+++  +++ LS RP++IDEI EA   H++    +  +  Q  ++E+ N LLR+VAGGG+DT+S L+ KWDKFELMMES Q+M++EQ+EVMK N+ SR + +QQD+ KF  RW  LKPG DI++SG  +A    VQ I++++ E  EL   +T L +DCEHF +   + TL  +  +D+     MW  +EE+ +GL+ +A+ DW+SFRS+ ++FEEFL  W ++LR   E ++M+++LQKE+D YK ++P+LK++RGE LSQ+HWL++FRL+++PRG TLE L  R +L  A  II     +K+LN +AQ EV+IREA+RELELWGAGA F L +Y D+Q  S+ +IK+WRD+++QVGDN+CLLQSLKDSPYY  FQDK ++WE +LADLDEYL NLN IQRKWVYL+PIFG+ ALP+E++RF+RV         D + +N ++     +G+  L+ T +     C      +                     ++ Q  +   +        +GI  V+F++  Q I  MKSL+GE V L N + I+++VE WL  L  EMK TL   L   +   +  N     ++  ++PSQ+LCL+E I FTA  E  + + ++  L+++L  KL  YT+   S    +   V  +KLK+LILD +HNI ++  L +    S  +W W KQLRFY  + DQ C IQMVDA+F YTYEYQGNA KLVHTPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQ+ +KN      LL + V++D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAM+ PDN+LIAEVIL S+GFK  K LGRKLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  +LL++ +       N+ ++       E+ L+VQALR+NT+SKLT+AD   F++L++DVFP +D K++EY+ L SA+  V +E ++  +  Q KK +E+YEQLRQRMGVV+VGPSG+GKST+W++LR AL K G+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQE+ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TDV SLV SWLK++DE  +  L  +L+D+F+++L+W+ K+++F + TS VGTV NGLS+L  ++ +  F + LI+GLGGNL    R+ FA  V     E  P+  K   L+ Y+++   RL  Y  +     CEEELS      D   L P+I T D QR+L  F  WL+++ +QPF+L GPEGCGK ++L   F +L+S QV+ +HCSAQT+  HVLQKL   C++I+SNTGRVYRPK+ ERL+LYLKDINLPK DKWGTS LI+FLQQV+TY+GFYD NLE+VGL+ +QIV SM++  ++GR +L++RFTSIVR+C+I YP ++QL  +Y+AYLKPVL+R +   P WS + K+  LA ++++VY Q+K+KF+VDD+SHYLFTP  LT+WVL+LLRYDL             I+ Y++  +F  R V+          L   IH+ +S       S +DV+FVTW  S E ++ G P P  G+ L +L +  L + I +G++ Y R+ R+LDI+LF EV D ++++DRVLT PGGS+LLAG+SGVGRRT + +VSHMH   L +PK+ R Y LK FK+DLK+ + +A V+G+ +VLLLEDHQF+ P +LE++NSLL+SGEVPGLY+TEELEP+L SLKD A++ G  G + NYF+ R++  LH++LIMDC+N +F INC+SNPA ++ CSVQW+E WS  SM KIP ML+++I  +E ++  Q   K          L   FL +H++C    +T   Y+NF+++Y  IY  K+ E+  +Q H+Q G+ K++EAK +V ELK +AAEQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  +   E   + +RK  ID+EL  ++P V +A+ AV +IKS  LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++EEI TFDAR IT E R  VEELL R K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LEKI PL+ E   L  NL   E +   LEK ++ V + V   ++ F+  T +AAKLE E+  A ETISAAE L+ +L+ E  RW  Q+ E++ EL  L  ++ L+AA + Y+P++PEDQR+  +  WM  +GL+KFD+R FL +E EQL WK EGL SD+LSMENALVILQ    PFLIDPSS AT WL+ H K  +LE++NQQD+NF TVLEL+VRFGKTLIIQE+DG+EPVLYPLLR DLI+QGPR VVQ+GDK++DYN DF+LFLATRNP P +PPDA ++++ VNFTTT+AGL+GQLLALT+Q  KP+LE +KT LLQ+EE+ KI+L+++EESLL+ LA A GNIL NK+L+ SLN+TK SS  I QSL +S +LQ SLD+ERDA+LPLAE  S ++FVI+DLSKINNMYRFSL SFLRLF RAL T + S  + +R ++L + L+ +VYEY+CRS+FK+D+LMFALH      P+LF+  EW++FTG  + D   K+D   ++    P WID +R +A++ + S  P L+  L + D DLW  F +SS CE+EIP  +  K+SLFQ++L++QALRPDRLQSA++ F    L +K LSP  +NL  +YE ET+  EP+L+IIS GADPSQ+LQEL+  ++G E Y++VAMGQGQAD+ L  L +C ++GDWLCLKNLHLVT+WLP+LEKELNS+KP   FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NL R+Y++WS + ISK G   RA +LF LAWFHA+ QERRN+IPQGWTKFYEFS++DLRAG EI+D++  +  +  QW F+ GL EN I+GGR+DN  D+ VL SY++++FN  +++ S      F  +I LP++ S  DY  +++ L + + PSFF LP NI+RSSQRIISSQVI QLRIL R    G+KFD++IWS  L+PVLN WK LNQG ++I  K +LP      S  SP+ +F+QLE++N+++LV+ +H SL SLSKV++G+ LLT +V  L+  LL  + P  W  +WEGPE+P  Y+R ++ +A A++ W E +E+  LLS +LDL ELFHPDTFLNALRQ TAR +  SMD LKFV  W G    AK  VK+G L +EGC FDG  ++E + DS S+  +PP  + W+  +    YS D+ ISLP+Y    R  +VT + +PC +G  D WIQSG ALFLK
Sbjct:    1 MAPGTDDPRKLFILTTAGNYFSLDTAASLSSCRPLDNFLDDGNEFLLSVTRQSEELQFSNKLENMDGDGRVLVFFKPHPCVVSEENLQRCILVSSMLESPISTLYQALRQVYSPVLLQDDKWSQSFDSKLQSLLSDLEIGLGSVLRHSDTKGSGKRN-------IMTPLDEFSFWADVSRSGQKSSERDRATHFCELFTTIEKDYSNLDSFSLVEVLDLIENTREAVDDVWKQNEHTP-YPETRMIRLMDVIGGALGRFVQRKLSDLRLWEDPYFTVREGLKGGVAVCEQWVAACEHLTGQVWKRYAPHQWTGEKHRPQGLHSLAQ-RLEEVVQVRSVCEKLQRLLSG-GKQQISAARVYQPFTGLNPIHYNPYTEPLWRAAVSQFDRLIAPAEQEAAGKLKTFIID--AQDSPQQLLQVFQKHRDLIKRATISKELQPERETLLTRLLDYNKGLRADFESRCHGTPGEKTGPLAGRNLPEVVNNIVWVRQLLLKVEDSLKMADALLSDLSGFQPLLRFSDDLQEQLRSYEQEQFEDWTRDLLSGLSDPKSG-----ISNRVMELDHMDGKLKIQYSDRLVSLLREVRQLSALGFTIPAKIQQAANTAEKFYRQAIILKQVAHFYNTIDQQMIPSQRPMMLGCALAFEQVIKSRDEGGKLQ--MTWENPKELEQYISKLQSAAERLSTENRKLRKWHTDFTDKVVGLMGVDLLRQQQRWKDGLQDLRAGFATLESQGFGAGDMRAWRQHWNHQLYKALEHQYQVGLEALNKNLPEINIDLVFKQGRLQFRPAFEEVRAKYYREMKRFISIPNQFKGVSET--GEEPIFTRMIERNASGFLTIFSKAEHLFSRLSHLLDKFKDWVVVGQVDVEVLVEKHLHSVQDWERNFKALKAKGKEAERLPSSEKVDCITVNCEPVRVSVDDLIQRLFDALLASLRRSIQGHIQVIDSFVNGAMETLSLRPESIDEIGEANAKHSQLQTQKPEVLPQFQQAEEKNRLLRSVAGGGLDTISSLRAKWDKFELMMESHQLMIREQVEVMKGNVESRVQVYQQDLQKFRARWDQLKPGNDIIESGDHEALQRCVQIIRERQAEFSELENTRTKLMEDCEHFNLSSPDGTLASDTLRDLQDCSQMWELYEEFHSGLEEIAQHDWISFRSKTHVFEEFLFAWHDRLRKLEEHSSMSVKLQKEVDRYKAVVPVLKYVRGEHLSQEHWLDLFRLISLPRGSTLETLQFRDLLRVADNIIDKTLELKDLNSRAQAEVSIREALRELELWGAGASFTLTDYTDTQGCSLPVIKDWRDVVNQVGDNRCLLQSLKDSPYYLRFQDKVSLWETRLADLDEYLHNLNTIQRKWVYLQPIFGRGALPREQARFQRV---------DQDFSNMLIH----TGVMVLIFTFVI----CNACFTHH---------------------VITQICHVWCL------CVKGISSVEFDQSFQSITAMKSLEGETVPLINTICISNDVEVWLSALAAEMKNTLKHLLCECVNAGKKGN-----VDPTRFPSQVLCLAEQIEFTAAVEISIRQQSLHQLEQQLTAKLENYTSVDTSTDNTTESRVLQMKLKALILDVIHNISLVQSLREAQINSTDDWVWKKQLRFYLNA-DQSCSIQMVDADFRYTYEYQGNAAKLVHTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQDIQNSLKNHRSTCQLLNKEVDLDPNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMTSPDNELIAEVILYSEGFKEGKALGRKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGSLLQLQR-----LNNNPLK-------ESGLVVQALRLNTMSKLTFADSSRFDALVRDVFPGVDFKDVEYETLKSALLAVYEEAHLEIIPSQLKKAVELYEQLRQRMGVVVVGPSGAGKSTLWRMLRAALGKTGRLVKQYTMNPKAMPRQQLLGHIDMDTREWSDGVLTSSARQVVREPQEVNSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDTDVGSLVKSWLKREDEDCRMNLENWLNDYFHRALEWVLKQSDFVVDTSLVGTVLNGLSHLSGVRERGEFIMGLIRGLGGNLTLKCRQDFAKEVLSWARESPPDPRKP--LDTYYDQASGRLCVYELQRGEGVCEEELS------DPHNL-PVIHTPDTQRSLHSFSPWLSANHRQPFLLVGPEGCGKGMLLRCAFSQLRSTQVSVVHCSAQTSSRHVLQKLQHTCLLISSNTGRVYRPKDCERLLLYLKDINLPKPDKWGTSNLIAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGAVGRHTLTSRFTSIVRICTIDYPDREQLQTVYSAYLKPVLQRTLGNDPTWSSSGKIHQLAGSLVQVYEQVKAKFSVDDHSHYLFTPCLLTEWVLNLLRYDLS-----------NILQYKASHVF--RCVN----------LLLVIHTGFSCCCICVFSASDVYFVTWAASHEGRSPGQPLPPHGRKLARLNASDLSEIIHKGIVLYGRDNRELDILLFPEVLDYMSRVDRVLTSPGGSLLLAGRSGVGRRTATCVVSHMHGATLFTPKISRSYSLKHFKSDLKTVMHSAAVDGQQVVLLLEDHQFVHPSFLEMVNSLLSSGEVPGLYSTEELEPLLASLKDQASQDGFTGPVLNYFSHRVQQNLHVVLIMDCTNEHFTINCESNPALYRKCSVQWMESWSDSSMKKIPEMLLSRIEEDEKTEDKQRKKKKSVH----TELYRSFLAIHESCREFGATPSQYLNFLQVYQSIYSSKRKELTHKQQHLQAGVAKLNEAKALVDELKRRAAEQSSLLKTKQAEADAALQEITTSMQNASDQKTEMEKIKERMAHEVSKIEERKKKIDEELREVQPLVDEAKQAVGNIKSESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREEIATFDARSITHEIRQSVEELLHRNKASFDPKNAKRASAAAAPLAAWVKANVQYSHVLEKIEPLQTEHAGLMENLRKTENRKNRLEKELNSVGEKVLELKEKFQCRTTEAAKLESEVSRAQETISAAEKLLQQLDGEHTRWTAQVDEISEELDTLPKRAQLSAAFITYLPAAPEDQRRSSLDHWMSSSGLQKFDLRHFLCSESEQLIWKSEGLPSDDLSMENALVILQSASCPFLIDPSSRATEWLQTHLKAHRLEVINQQDANFMTVLELAVRFGKTLIIQEMDGVEPVLYPLLRRDLIAQGPRYVVQIGDKVMDYNEDFRLFLATRNPSPFIPPDAASVITEVNFTTTRAGLRGQLLALTIQQEKPELESQKTKLLQQEEEKKIQLAQLEESLLETLATAQGNILENKELIESLNQTKASSALIQQSLSQSHRLQTSLDQERDAYLPLAETASKMYFVITDLSKINNMYRFSLASFLRLFHRALQTKQESESTDVRISTLESSLKNMVYEYICRSLFKADQLMFALHFVKGMSPELFQENEWDVFTGLVVGDMVRKTDSQKSLREQFPSWIDQERLMAVALIKSTFPVLYQSLCLSDADLWLTFLRSSCCEQEIPLPVAKKISLFQQMLVVQALRPDRLQSAMAVFASQALGMKQLSPPPLNLKHLYE-ETLETEPVLLIISAGADPSQELQELAGNIVGRENYHEVAMGQGQADVALQALRECVRSGDWLCLKNLHLVTAWLPLLEKELNSMKPKAGFRLWLTAEVHPKFTPILLQSSLKITYEAPPGLKKNLKRTYESWSAEQISKGGLLARAQSLFCLAWFHAVCQERRNYIPQGWTKFYEFSLSDLRAGFEIIDRLF-EGGKAFQWDFVDGLLEN-IYGGRIDNVCDLLVLRSYLQQFFNAQLLSQSRKKTHAFPAQIHLPNSCSIADYRVVVDALPEDDRPSFFGLPANIERSSQRIISSQVISQLRILSRPVAAGSKFDREIWSSALSPVLNLWKRLNQGSSLIHQKVTLPS----ESVGSPIFSFIQLEQFNAVRLVQSIHQSLASLSKVIRGTSLLTADVHKLATALLNQECPLSWQNKWEGPEDPMQYLRAVVSRALAIQGWVERAERGGLLSEMLDLSELFHPDTFLNALRQETARLMSCSMDSLKFVTTWRGQITEAKLQVKVGGLQLEGCSFDGNRLSESHHDSPSVSSVPPCHMAWIPVSAMGCYSPDECISLPVYSSAERVCVVTNVQLPC-AGDHDTWIQSGAALFLK 4206          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1251.88 bits (3238), Expect = 0.000e+0
Identity = 1146/4583 (25.01%), Postives = 2094/4583 (45.69%), Query Frame = 3
Query:  180 NEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGP-ILLSDTDPK---------IQKLISELENG----LGSIIRKPLSKKSKYQTDETI----------------------VLGIFSIDD---------EIMFWN------DSLSASSHDQNQSRINEL-----------------------------ISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNY--PQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQ-------ILP--------HRERQEFKIEEAFKYFLNILPLAYN--PYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSI--TSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSI------ISQNRLLRKQHFLICEKI-----VNLMGIDLLR--------------QQQKWKDTLNEIRQILFQIENQKHL--PENTLPWKRHL---DHQLYKALEYQYHIGLEALNENL---------PEIRVDLVY------RQGRLQFNPTFEE-------IKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERN----------AAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCL---DLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR----TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWS---QFE----EYQTG-LQNLAKE-----DWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQL---SYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTA-------RCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTV------YNGLSNLKAIKNKAH-----------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTL--HCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKD-TIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDN-----LNSYFLDLHDTCPVEFS-------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKI--------------SEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEKTG-LE-----KFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWIDADRTVAISNL--ASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEK---ELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSE-DFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQL-----PSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD-------SP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRD------KIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            NE+ LDKF  +    +LVV       ++ +       V     FI+   S+IT ++  S +   ++    I  L  ++  ++ P + LS T P+         + + +++L +     LGS +     +  +++ +E +                      VL   S+ D         EI FW       DS+S          I E+                             ++FL  + E  + +A     E    L ++  L+  IW    +N +Y   + R+  L+  I+NE++R+   +++    ++      K+ L   I+ C  W ++     + + K +    W+ D     + + +F  R  ++  +    +Q  +        LP           ++   IE  F   L +L    +      P W     +F   ++  E  +   +   F+     E   QLL +FQ    L  R  I   +  +R+T+    + H  +L E  +   R   + P +       +I W+K L +++   + +   ++ L  +   ++         + +    +  F  W+Q +++    S +  + +  +G       K GLL +N++  L+ L  E+     L ++I   V       ++ ++    +  V + YN I   +   +  +  +     +K ++   S+      + W+     + FI+  +  ++ +           L   +H   CE+I     V+L G  + R              Q  + ++   +I +I+ ++    HL  PE    W  ++   D  L +A        L+ L++ +         P  RV++V          ++ F+P+ ++       I S+  K +  F  LP+    L       +    S+IE++          AAG V     A +L Q      +K +E   +  ++ + F+ ++      +T ++ +           +K    + +  + ++C+P+K S+       Q+ F  LL+ +  +    +  + ++L  +   LS+ PQ + ++ E+         D ++I SQI    +   +L      V    ++ +  L  +W  F+ ++    +M+++  + MK+ ++   ++FQ+    F   +    P       GS+     A+Q++ + + +LE L   + N+      F +E      +  + KD+D  Q +W    Q+E    E++ G L +L  E         F++ + L   F  + +E + ++         +  I+ +K IIP++  +R   L + HW ++ + +      +    TL  I+  A  +  HAE+I +++  A  E++I + +  +          +  + D  ++ +    E   +   + DNQ  L  +K S + + F+ +   WE  L+ + E ++ +  +QR+W+YLE IF     +  L +E + F  V   ++ IM  ++++   L      G+   LS M  +L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I  +  NK    +      M S DGE V+  + VL+   VE WL ++   M+ TL D L   S AL+ +        G     +P Q+L  +  I +T          +E  +++ + +LKK+ V  LN Y+ A   +  + T I+  LK+ +L+   VH  D+I +L    C  V  ++WL QLR Y +     C+I+  +  F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +   +   R++N+  +  IFIT+NP   GY GR +LPDNLK +FRP++M  PD+ LIAE+ L ++GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K +    D ++         ++++ +++   ++KL+  D   F  +I+D+FP ++   I+Y  L  A+E  +++  +  +     K++++YE    R   +IVG +GSGK+  W+ L+  L+ + +        ++   +NPKA+   +L G  ++ T EW+DGVL+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  DLS ASPAT+SR GM++        K  V SW++K+ + +  LL    + +  K+L +     +  ++ + +  V      Y  L+  +     A            F   LI  +  +++E  R+    ++ E+ +   P  NK  +  YY + K     ++  +  +           KI+ P   T D  R     K  ++  TQ P +L+GP G GK+ +     Q L ++   TL  + S+QT+  +V + +      +      VY P   ++++++L D+N+P +D +G+   +  L+  I Y  +YD   + +       +         GR+ +S R  S   L ++++P++ Q+  IY   +   L+    +  PI        +L    +E+Y  + S+F       HYLF   D+++    LLR          +++ L I  +E  R+F DRLV     +   G+L   + S + V       +     +G    ++      +  K+L       L+D  +  G++  S       ++LF++  D+V +L RV+++  G++LL G  G GR++ + L +++    +   ++ + Y  ++F+ D+K   +  GVE +  V L  D Q ++  +LE IN++L+SGEVP LY  +EL+ I  +L D A +        ++ NY  +R+++ LHI+L M      F    +  PA     ++ W  +W RD++L++    ++ +                    GSD+     + S F+ +H +   +FS             T  +Y+  +  Y ++  +K++E+  + + ++ G+ KI               EAK+ VAE + +  E   ++ +++ EAD+  K +     GA   K E E++  K   EN   A+R   +D+ L    P +++A  A+  +   D++EI++   PP ++  +++ V+++ G  + +W   +  LG+    +++  FD   I+      + +  T  +  F P+   R S+AA  L  WV+A   Y      + P     +     L   +  + + +  + +V + +   ++ +++  A   +L  + ++    +  A  LV  L  E  RW + +  L   +S L    LLAAA + YM     + R E +  +WM++   LE      F    FL+      EW  +GL SD  S EN +++ +G   P ++DP   A  W+KN    + L++++ Q  +F  +LE +V+FG  +++Q V + L+P L P+L   L   G R +++LGDK I+Y+P+F+ ++ T+   P   P+  +  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L  +K ++  +++ LE S   +  +D  R+A+ P A+  S LFFV++DL  I+ MY+FSL +++ LF  ++ +S  S     R  +L       VY Y CR +F+  +L+F+ HM  C +           E+  F   G  +  K   +     W+       I+ L   +   EL +       D WH +  + E E+  +P   +N  +  QK+LI+++LR DR+   ++ F  + L  + + P  +++  +  +++ +  P++ ++SPG DP+  L +L+      +R+  +++GQGQA I   L+ +   NG W+ L N HL  SW+  L+K   EL   + H DFRLW+++ PH  F   +LQ+ +KIT E P GVK N+ R Y   SE  F+  +        LFSL +FH++I ERR F+  GW   Y F+ +D      +L   + +    I W  +  L     +GG V + +D R+L++YI +YF  +V++    F+    L     P   S+  Y+  I+QL     P  F    N D +SQ   +  +   L  LQ   V  T       SRE        K+L    ++++  +P  +    T        SP  VV   +++RYN+  L+  +  SL+ L K +KG  +++  ++    C+   + P +W + +   +    + R L  + +   +WAE +    L      L     P  FL A+ Q +AR   +S+D L +   V     +N+    K  V I  L +EG  +D      C  ++  + L+ P+        +       +M S P YY  +R         V  +D+   +   D WI+ G AL +
Sbjct:   95 NEQALDKFISDSSVRLLVVYHDPFTGLYVDYAMPAQVVEQMSYFIRAPDSMITEESFRSSVQFGSVRGGAIEGLLRMMNGVHTPQVTLSTTWPETSKNNYSAELHRFLTKLTDSRFKLLGSTVLYIPLEALQHRPEEAVKNKNLVQRLEMVVIHWTRQIKAVLSAQSVSDIGDTLGPLEEISFWKSRCADLDSISTQLQKPGVRHIQEILQLYTSTYIPPFCKLAKQIQESSLQAQSNVTFLSLLKEPCEELAQLKPCEIAPKLAHILNLIRVIW----VNSSYFNTRDRITALLRKISNEIIRLCCREISLNRIFQGYAVSSKQILNDCIQCCLAWKELYLHTSQLHHK-HSSQGWSLDQISIFALVDSFMQRCKDLIEICECQQQFARWEDGERVPLPCFAGRLGSEVTQKLLYIEATFDKSLQVLQSVQDILDVRNPSWHEDYSRFRAKLKDLEVMMQNLITSTFEMVNCVEEGVQLLDVFQH---LSGREAIKRTI--DRKTVDVYNLFH-SELVEINLVMCRTSSLIPVQ-MPRYAGQIHWTKALHSRVERSMEVLRRAHFLPHVRSADEMHVIYVKLCQTLDEKVRRIFTDWSQSLSKECHSSLDQPLMIRCKG-------KTGLLDINFNKNLLKLFNEIHYWDRLQFEIPHFVTEVYQRREELHNLRENVLLVVRDYNRIIKDLNADELGLFSERIRFLDKKIQPGLSK------LHWSTKGTPSAFINDCRVHANKVQLMVDEYKAANLATSKH---CEQISELLLVHLDGKTVYRDHEFQEDQQTHQHSQMLRLQNAHQDIIKIMARVYGTFHLDGPEVQQHWTSYMEKIDQMLEEAFRVNIKRSLQELSKAINGDGKISPNPLFRVEVVLTPETARSTAQVDFSPSPQKLAHIVNSISSQLIKTISGFKRLPD----LLTRQQSQRKPIHSIIEQDEEICKIQGAIAAGMVT---NASYL-QTYLKTWDKHRE---IWEIEKDSFIQRYQRLNPTVTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASS---KLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPAVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGP------FGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSS---------KSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIV--ALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRGTDE---VFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKM----PGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEA---IRGNLTKILR-LKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNP---GYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAG--------KKRRARPDIVDE--------EILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREI-EGSFP--NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVP---TVDTVRYHYLVKALVS--TQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESR---VEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGG------ILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWI--HECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMS-------LVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLS------------------LGSDDGIQTKVASIFVTVHQSV-AQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAV-----GAHSEKIEAEEIKCKAMAEN---AQRD--LDEAL----PALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCT--QPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHM--CAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRD-WHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVV-ADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE-EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTP--FFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQP-QVTSTDTTSAGASRED-------KVLELSADVLQ-KIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNT--LLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFW----LSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKK--ASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLM 4502          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1234.55 bits (3193), Expect = 0.000e+0
Identity = 970/3576 (27.13%), Postives = 1729/3576 (48.35%), Query Frame = 3
Query: 2700 LTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLL---RTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWS---QFE----EYQTG-LQNLAKE-----DWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQL---SYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTA-------RCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTV------YNGLSNLKAIKNKAH-----------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTL--HCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKD-TIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDN-----LNSYFLDLHDTCPVEFS-------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKI--------------SEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEKTG-LE-----KFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWIDADRTVAISNL--ASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEK---ELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSE-DFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQL-----PSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD-------SP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRD------KIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            +T ++ +           +K    + +  + ++C+P+K S+       Q+ F  LL+ +  +    +  + ++L  +   LS+ PQ + ++ E+         D ++I SQI    +   +L          ++ +  L  +W  F+ ++    +M+++  + MK+ ++   ++FQ+    F   +    P       GS+     A+Q++ + + +LE L   + N+      F +E      +  + KD+D  Q +W    Q+E    E++ G L +L  E         F++ + L   F  + +E + ++         +  I+ +K IIP++  +R   L + HW ++ + +      +    TL  I+  A  +  HAE+I +++  A  E++I + +  +          +  + D  ++ +    E   +   + DNQ  L  +K S + + F+ +   WE  L+ + E ++ +  +QR+W+YLE IF     +  L +E + F  V   ++ IM  ++++   L      G+   LS M  +L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I  +  NK    +      M S DGE V+  + VL+   VE WL ++   M+ TL D L   S AL+ +        G     +P Q+L  +  I +T          +E  +++ + +LKK+ V  LN Y+ A   +  + T I+  LK+ +L+   VH  D+I +L    C  V  ++WL QLR Y +     C+I+  +  F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +   +   R++N+  +  IFIT+NP   GY GR +LPDNLK +FRP++M  PD+ LIAE+ L ++GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K +    D ++         ++++ +++   ++KL+  D   F  +I+D+FP ++   I+Y  L  A+E  +++  +  +     K++++YE    R   +IVG +GSGK+  W+ L+  L+ + +        ++   +NPKA+   +L G  ++ T EW+DGVL+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  DLS ASPAT+SR GM++        K  V SW++K+ + +  LL    + +  K+L +     +  ++ + +  V      Y  L+  +     A            F   LI  +  +++E  R+    ++ E+ +   P  NK  +  YY + K     ++  +  +           KI+ P   T D  R     K  ++  TQ P +L+GP G GK+ +     Q L ++   TL  + S+QT+  +V + +      +      VY P   ++++++L D+N+P +D +G+   +  L+  I Y  +YD   + +       +         GR+ +S R  S   L ++++P++ Q+  IY   +   L+    +  PI        +L    +E+Y  + S+F       HYLF   D+++    LLR          +++ L I  +E  R+F DRLV     +   G+L   + S + V       +     +G    ++      +  K+L       L+D  +  G++  S       ++LF++  D+V +L RV+++  G++LL G  G GR++ + L +++    +   ++ + Y  ++F+ D+K   +  GVE +  V L  D Q ++  +LE IN++L+SGEVP LY  +EL+ I  +L D A +        ++ NY  +R+++ LHI+L M      F    +  PA     ++ W  +W RD++L++    ++ +                    GSD+     + S F+ +H +   +FS             T  +Y+  +  Y ++  +K++E+  + + ++ G+ KI               EAK+ VAE + +  E   ++ +++ EAD+  K +     GA   K E E++  K   EN   A+R   +D+ L    P +++A  A+  +   D++EI++   PP ++  +++ V+++ G  + +W   +  LG+    +++  FD   I+      + +  T  +  F P+   R S+AA  L  WV+A   Y      + P     +     L   +  + + +  + +V + +   ++ +++  A   +L  + ++    +  A  LV  L  E  RW + +  L   +S L    LLAAA + YM     + R E +  +WM++   LE      F    FL+      EW  +GL SD  S EN +++ +G   P ++DP   A  W+KN    + L++++ Q  +F  +LE +V+FG  +++Q V + L+P L P+L   L   G R +++LGDK I+Y+P+F+ ++ T+   P   P+  +  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L  +K ++  +++ LE S   +  +D  R+A+ P A+  S LFFV++DL  I+ MY+FSL +++ LF  ++ +S  S     R  +L       VY Y CR +F+  +L+F+ HM  C +           E+  F   G  +  K   +     W+       I+ L   +   EL +       D WH +  + E E+  +P   +N  +  QK+LI+++LR DR+   ++ F  + L  + + P  +++  +  +++ +  P++ ++SPG DP+  L +L+      +R+  +++GQGQA I   L+ +   NG W+ L N HL  SW+  L+K   EL   + H DFRLW+++ PH  F   +LQ+ +KIT E P GVK N+ R Y   SE  F+  +        LFSL +FH++I ERR F+  GW   Y F+ +D      +L   + +    I W  +  L     +GG V + +D R+L++YI +YF  +V++    F+    L     P   S+  Y+  I+QL     P  F    N D +SQ   +  +   L  LQ   V  T       SRE        K+L    ++++  +P  +    T        SP  VV   +++RYN+  L+  +  SL+ L K +KG  +++  ++    C+   + P +W + +   +    + R L  + +   +WAE +    L      L     P  FL A+ Q +AR   +S+D L +   V     +N+    K  V I  L +EG  +D      C  ++  + L+ P+        +       +M S P YY  +R         V  +D+   +   D WI+ G AL +
Sbjct:  943 VTSFDADIARYTEVANNVQKEETLLSVQFVLLDCSPLKFSLLQHCNEWQSKFTQLLSLMASS---KLKELHSFLQENAVRLSQPPQTLTDLGESLKLLETLQADLNKIESQIPPIHEQYAILTKYEVAVDPVLELLEALNAEWVWFQQVVIDSDIMLKKHKDTMKSGLILSSEEFQKKTQTFLQSFSSNGP------FGSSVTPHSALQQVSELRAQLEALKEEEQNICSGLNIFTIEQPASKDILALEKDVDYLQQVWEIARQWEDLWAEWKGGHLASLQTEVMDNTAQTMFKTLHKLSRAFKDKHWEIVDSS---------KSRIEQFKKIIPLITDLRNSALRERHWNQIRQEVQQTFDPSSADFTLEKIV--ALGLDHHAESISDISGAASKELSIEQTLEGIMKTWKEMSLDITPHKDKGHHKLRGTDE---VFQALEDNQVTLSVIKASRFVKAFEKEVDHWERCLSLVLEVIEMILTVQRQWMYLENIFLADDIRKQLVRETAEFDAVTSSWKIIMERLDKDKNALRGTHHPGLLEKLSEMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKSLRINKVGTGNKSEASGMFSADGEFVDFTHPVLLEGPVEAWLCDVERTMRWTLKDSLRNCSMALKKM----PGKRGKWVRDWPGQMLITASQIQWTTDVTRALMTSKERADKSALKSLKKKQVSMLNQYSEA---IRGNLTKILR-LKIVALVTVEVHARDVISKLAKGGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFRYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGMYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLNNFSFEGRQINLIWSCGIFITMNP---GYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFAEGFNNCKVLAKKVFTLYSLAVQQLSKQDHYDFGLRALTSLLRYAG--------KKRRARPDIVDE--------EILLMSMKDMNIAKLSSIDLPLFNGIIQDLFPAVETPTIDYGKLKEAVEAELRQSGLQVIPFTVTKVIQLYETKNSRHSTMIVGKTGSGKTVTWRTLQNTLSTLHRNGEPGFNLIRECPLNPKAVSLGELYGEYNLSTNEWTDGVLSSLMRMACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERISMPEQVSLLFEVEDLSVASPATVSRCGMVYSDYSDLGWKPYVQSWMEKRQKVETDLLWQLFERYIDKTLAFKKTHCKELVAITELNGVASLCRLYQSLATAENGVKPADSENYGRMVELWFIFSLIWSVCASVDEEGRKKIDTFLREI-EGSFP--NKDTIYEYYVDTKNKTWASFEDKLPKGWRYASNAPFYKIMVP---TVDTVRYHYLVKALVS--TQHPVLLTGPVGTGKTSVAQSVLQSLDNITWATLTVNMSSQTSSNNVQEIIESR---VEKRIKGVYVPVGGKKMVVFLDDLNMPAVDNFGSQPPLELLRLWIDYGFWYDRQKQTLKYIKDLFLLGSMGPPGGGRTHISGRLQSRFNLINMTFPTESQIKRIYGTMISQKLQEFEEEVKPIGG------ILTQATLELYHAITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWI--HECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRESQIYEDLLDFKALKVHMENQLEDYNLTPGVVPMS-------LVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLS------------------LGSDDGIQTKVASIFVTVHQSV-AQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAV-----GAHSEKIEAEEIKCKAMAEN---AQRD--LDEAL----PALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCT--QPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFKQGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHM--CAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELDKLTNFHELMASFEQYPRD-WHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVV-ADSTTRTPLIFVLSPGVDPTAALLQLAETSGMGQRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYE-EIPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTP--FFKVSSLVSYYVPRDGSQSSYVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQP-QVTSTDTTSAGASRED-------KVLELSADVLQ-KIPAEIDYEGTRKLLKDDLSPLNVVLLQEIQRYNT--LLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFARWAETARPPVLFW----LSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVEDNNLLFPPKDGVLIQGLFLEGAGWDKK--ASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLM 4382          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1163.67 bits (3009), Expect = 0.000e+0
Identity = 868/3140 (27.64%), Postives = 1526/3140 (48.60%), Query Frame = 3
Query: 3576 RNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSL---DGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEEL---LNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEP-QEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWI------AKRNEFTISTSNVGTVYNGLSNLKAIKNK---------AHFSVCLIKG----LGGNLNENSRETFALWVYELT------DEKTPEMNKQ------NVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSD---TQQPFILSGPEGCGKSLMLNHCFQKLK--SVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD----------SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKL----LANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDN---TAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQ-----YSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINK---IPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK-------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDG-LEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS-HCCRPDLFKPQ-EWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNI---KDDDLWHQFAKSSECER-EIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKV-IGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSL-KPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRN----IQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYG------KIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSR--ELNPV-------LNRWKILNQGLNIIKASLPD---------SLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTAR 12638
            ++A    ++  L+  +  +++ +P+L  ++ + L + HW  +         +     TL ++   A E+ ++   I E+   A  E+ I + ++E+E       F +  Y         ++    DI+  + D+   LQS+  S +   F      WE  L+ + E ++    +Q+KW+YLE IF     ++ LP+E  +F  +D+ F+ IM+D  ++  +   C +      L  + D L+RCQK+LN+YL+ KR+ FPRF+FI DD+LL ILG S+ P  ++ H+ K++  I  + F+  +   +   +L   +GEV+EL+  V     VE+W+  +  EM+ T  ++L         S+Q +       Y   ++  +  + +T   E++   +NE     LK +  KK++   N  +    +        K+ ++++  VH  DI+D  +  +     E+EW  QLRFY   +     ++   A+F Y YEY G   +LV TPLTD+ YLTLTQ + M LGG P GPAGTGKTES K L    G   +V NC EG+D  ++G+I  GL +CG+WGCFDEFNR++ +VLS +S QIQ I++ +   +Q      + +++D    IFIT+NP   GY GR +LP+++K LFRPV +  PD   I E++L S+GF  AK L +K+  ++ L+RE L+ Q HYD+GLRALK+VL  A  L          +G+  +        E  ++++ALR   L K  + D   F  LI D+FP +D   + Y +   A+E +++E   + +  Q  K++++YE +  R   ++VGP+G GKS +   L  +  ++G   K Y +NPKA+   +L G +D  TR+W+DG+L+   R + K   ++ + +I+ DGD+D  W+E++NSV+DDN+LLT+ +GERI+   +   +FE  DL  ASPAT+SR GM+F+  +          W+  +   ++  L    + +   ++D I       K+ E  + T  + T  N +  L  + +               C ++     LG +L +  R+ F  ++ +L+      DEK      +       + +++F+  Q + V +S    + +   ++    K +  L+ T D  R       WL       ++P +L G  G  K+  + +    L   +  + T++ S++TT + + + L      +   T   + P   +RL++++ D+N+P++D++GT Q I+ L+ ++   G YD           +L F+   G          +  GR+ +  RF S+  + +I +P ++ L+ IY++ L+   K    +  I +   K+      L  T+I+      SKF      HY+F   DL++     + + L +T+     T    + +   E +R+F DRL++   +    G + N +   +  ++  ++ D   + +G               KS  ++  + L     + L Q     Y+     ++++LF +  +++  + R++    G  LL G  G G+++ + L +     ++    + RGY    F++DLK+     G+E + +V L  D    E  +LELIN++L SG VP L+  +E E +L  L+D A +SG    + S+  YF ++  + LHI+L M          C++ P      S+ W   W   ++  +    + +   IP+     +  +     + +     L  +   L  +    + T ++Y++FI  Y  +   K   I  +   ++ G+ K+ EA   +AEL  K  EQ  +L EK    +  L++I +    A E+K   E+   +  E+N ++   K   +  LA   P ++ AR A+ D+  SD++EIR+   PP  ++ + E +L+I G  + +W + +  + +      +   D   I       V+  L     S +    +  S A + +  +V+A + Y      I P   +  +L+RN   ++++++ ++  +  + K +      +E    +   L+ E +     + AA+ L+  L +E +RW K + EL      L    L+ AA + Y  +   D R E +    +   LE+       F +   LT E E   W  EGL  DELS++N ++  +    P  IDP   A  W+K   +   L+I +  D +F   LEL++++G   + Q+VD  ++PV+  +L  ++     RQVV LGDK +DY+P+FKL+L T+   P+  P        +N+T T  GL+ QLL++ +   + +LEE++  L+ E  + K  L  +E+SLL+ELA +TGN+L+N +L+ +L++TK  +  + + L+ + K  + +D  RD + P A+ G+ LFFV+++++ +++MY++SL SFL +F  +L+ S  +     R  ++I  L + VY Y C  +F+  +L+F+ +M+    + +   PQ E E F    +S +  +   +  W+       I  L    P  +  L     K+ + W  +      E+   P   K  LS FQK+L+I+  R DR+  A+S +    +  K++ P  ++   I++  +  N PI+ I+SPG++P+ DL +L+     G  R   +AMGQGQ  +   LL      G WL L+N HL+  WL  LEK L  + KPH DFRLW+T EP   F   +LQ SLK+  E P G+K N+  +Y   S D +         + ++ LA+FHA++QERR +   GW   Y+F+ +D     EILD  + K+       I W  +  L    ++GGRV + FD R+L+ Y   Y  D + +    F+         ++P+   K+ Y+  I  L   N+   F L  N +                       + T+  +D+W+   EL P        ++R + ++Q    I++ LP+          L    + + VV   +LER+N  KL   +  SL  L + L G   ++ E+  ++  L  GQ P +W +    P+        +I   +  E+++    + E    ++ L  L  P+++L AL Q T R
Sbjct: 1466 KDARALPVSFFLEGRMKEFRESLPLLLDLKNKALRERHWKSLMERTGTNFEMNPNTFTLENMF--AMELHKYGNVISEIVTSAVKELGIEKGVKEVEETWDSMKFTVHRYFKGTQEHGFILGAVDDILQHLDDDAMNLQSMAGSHFVGPFLATVQQWEKNLSLISETIEVWMLVQQKWMYLESIFIGGDIRSQLPEEAKKFDNIDKTFKKIMTDTVKDPGIKRCCLVPNRLADLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPTCVQEHMIKMYDNIAALRFDTGMNGEMVANALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRT--NRLITKEAIYFYSHQKSRVDWMLDYQGMVVLATNQVWWTYEVEDVFRRMNEGEKQALK-QYAKKMHQQINDLVKRITEPLKKNDRRKINTVLIIDVHARDIVDSFVRDSITDAREFEWESQLRFYWVKEPDELFVRQCSAQFCYGYEYMGLNGRLVITPLTDRIYLTLTQALSMFLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKILSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALMLHLQRFHFEGQEISLDNRIGIFITMNP---GYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLVAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGEL---------KRGSPNLS-------EDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPSFNDAVEAILEENRYIMMPSQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQSQTRLGLLTKLYSLNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINKPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQSHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWEKWVNSRAPKEKADLCKLFEKYVPSAIDMIVDGVVDGKQTE-KLKTVILQTDLNMVMQLTVMVDSLLENEDFLFEELECCFLEALYCSLGASLLDKGRQKFDAFIKKLSSLNSVHDEKVLAGPGEIPVYLPTLYDFHFDGTQKKWVPWSSMVSKYIHNPEM----KFIDILVPTVDTTR-----ANWLLEQMVKVKRPVVLVGESGTSKTATIQNFLSNLNTDTTIMMTINFSSRTTSMDLQRTLEAN---VEKRTKDTFGPPMGKRLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNYKLIKDLGFIAAMG---------KAGGGRNEVDPRFISLFSVFNIPFPEEESLHLIYSSILRGHTKPF--EECIRNICDKLTFCTLELYKTIIKDLPPTPSKF------HYIFNLRDLSR-----VYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDP--ILFGD---------YRTALKSEPRVYEDILDYDASKALFQEILEEYNENKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLGESPMIPKSHSEAVIDHVCMVHSSVGDYSKL--FLQTLRRS---NYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLE--EMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKEEKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSS-PNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIPALGPKQVYVDEIESLPLANTAEVFGLHPNAEIG---------------------YYTQAARDMWTHLIELQPQTGDSGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKLGLEISPTSVVLLQELERFN--KLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKL--APDTLKSLGNWMIHFKRRHEQYSSWVNEGE--PYVMWLSGLHIPESYLTALVQATCR 4499          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Match: DYNC2H1 (dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI gene;Acc:100380107])

HSP 1 Score: 4472.54 bits (11599), Expect = 0.000e+0
Identity = 2301/4304 (53.46%), Postives = 3048/4304 (70.82%), Query Frame = 3
Query:  192 LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQ-TDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSV---GSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLP-VTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHY----LHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNIT----VPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG-----NFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            L++F D+ +  +L       +  FSN+L+  D   N LVF K  P +IT DN+   I+++++ E+PI++LY  ++ +Y PILL D       DPK+Q ++S+LE GLG+I+RK +S   K     E  + GI + +DE  FW +  ++ S    + R +   S  Q +      + +  L+E    +E     ++D+W+    +P YP+ RMK L++II + L R +Q  L  +  W+  +  VKE+L   I VC  W   C+ L  + W+++ PH W  D   +   I     RL E+ S+R VHE++   LP  E    +  + F+ F+ + P+ YNPYTEP+W+ AV ++ R IEPAE  I  +LK  F E   +  PQQLL+ FQ++ +L+ RP +   L  ERETLL +L  + K +  DF    H S      P   +N  + ++ IVW +QL+ K+ + +     +L DL GF  F K  K+ L+++  + QEQFE W +E+   L D  + G  L    ++MEL   +G L ++YSDRLV L+REVR LS LG  I   +  AA   QKFY +A+ILKQVA FYNTI+ QMI  Q+ MML++A+ FE+++K+      +S  K  + WNNP++L  +I+KLQ  +  + ++NR LRK+H    EK+V LM IDLLR QQKWKD L EIR  L           +  PW++H +HQLYKALE+QY IGLEALNENLPEI +DL ++QGRLQF P FEEI+SKY++EMK+FI++PNQFKGL+++  G + IF  + ERNA GF+  + KAE LF+RL+A L++FKEW+++G +D++  ++++  D+ D+EKNFKA+K +GKEAE+LP+ IKIDCIT+NC P+K  VD LIQ +FD+LL SL+K+I+  +  +D ++T  +++LS RPQ ++EI EA + HA+    +  I     ++E  N LLR+VAGGG+DT+  L+ KWDKFELMMES Q+M++EQIEVMK  + SR + + Q+I KF  RW  LKP  D++++G   A + + Q IK+KK+E +EL   K  L +DC HF +E  +F L +EI  DI+     WS +EE+  G    AKEDW+S+RS+ Y FEEF+  W E+LR  E  TTM+++LQKEID YK ++P+LK++RGE LSQDHWL++FRLL +P+G TLE L    +L  A  I+  A  +KELN +AQGE+TIREA+REL+LWGAGA+F L +Y DS + +I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK  VWE KLA+LDEYLQ LNQIQRKWVYLEPIFG+ ALP+E++RF RVDEDFRSIMSD+ R+NRV  L S +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF G+  VDF+++ +HIITMKSLDGE V L+N++L+TS+VE WL +L +EMK+TL   L   ++ +    +S+ GI+  ++PSQILCL+E I FT   E  + E  +  +  EL+ KL+ YT+   S+   +   + +LKLK+LILD +HNID++ QL      S  +W W KQLRFY K  D+ C ++MVDAE  YTYEYQGNAPKLV+TPLTDKCYLTLTQ + MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V +D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDN+LIAEVIL S+GFK+AK LGRKLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  NLL     ++K  G +T  N      E+ ++VQALR+NT+SKLT+AD    ++LIKDVFP ID K++EY  L++A+++  +E N+  +  Q KK LE+YEQLRQRMGVVIVGPSG+GKST+W++LR ALNKIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+E Q+I SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLS ASPATISRMGMIFLS E TD++SL+ SWL+ Q  + +H L  ++ D+F K+L+W+ K+N+F + TS +GTV NGLS+L    ++  F V LI GLGGNLN  SR  FA  V+    E  P+  K   L+ +++ K  RL+TYS E    L+ +   + + +  P+I T DIQR LDYFK WL  DT+QPFIL GPEGCGK ++L + F +L+S  + T+HCSAQT+  HVLQKL Q C++I++NTGRVYRPK+ ERL+LYLKDINLPK DKWGTS L++FLQQV+TY GFYD NLE+VGL+ +QIV SM++  S+GR  L+TRFTS+VR+C++ YP +DQL  I ++YL+PV+ + +  HP W   SK+  LA +M++VY Q+++KF+VDDYSHYLFTP  LTQW++ L RYDL   +S  +   +LEIV+YE+ R+F+DR+V++      D IL + +  +W  +V D++ D ++VTWG+     A   P       G+ LG+L S  L+D I +G +QYS   R+L+I+ F EV D ++++DRVL+ P GS+LLAG+SGVGRRT + LVSHMH   L +PK+ RGYELKQFKNDLK  +Q AG+EG+ ++ LLEDHQF+ P +LE+INSLL+SGE+PGLYT EELEP+L  LK+ A+E G  G +  YF +   ++    LH++LIMDC+N NF INC+SNPAF+K CSVQW+E WS  SM KIP M+I     +E  Q+     K  +    S+  NS FL +H++C    +T   Y+ F+++Y  +Y  K  E+  RQ H+Q G+ K++EAK +V ELK KA EQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  K  EE V +A+RK  I+DEL  ++P V +A++AV +IK   LSEIR+LRAPPD+IRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFD R IT E RI VEELL   + SF+ KNA+RAS AAAPLAAWV ANV+YS+ LEKI PLE EQ+++     NA  +                         TA+AAKLE EL  A E I AAE L+ +L+ E +RWN Q+VE+  +LSAL  ++ LAAA + Y+ ++PEDQRK  ++ WM+  GLE FD+R+FL+TE EQL WK EGL SDELS+ENALVILQ  + PFLIDPSS AT WLK H K+ ++E++NQQ           VR    + I+E  GL    +          GPR VVQ+GDK IDYN DF+LFLATRNP P +PPDA + V+ VNFTTT+AGL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL+NKDL+ SLN+TK SS  I +SL ES KLQ+SLD+ER+A+LPLAE  S ++F+I DLSKINNMYRFSL +FLRLFQR L   + S  + +R  SLI  L+ +VYEYVCRS+FK+D+LMFALH       +LF+  EW++FTG  I D   KSD   T    VP WI+ +R  A++ L +++P L+  L+++D +LW  F+KSS CE+E PQ++  KLSLFQ++L++QA+RPDRLQSA+  F C  LELK LSP  +NL ++   ET++ EPILIIISPGADPSQ+LQEL+   +G + +++VAMGQGQADI +  L +C+++G+WLCLKNLHLV SWLPVLEKELNSL+P  +FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NL+R+Y++W+ + ISK G   RA ALFSLAWFHA+ QERRN+IPQGWTKFYEFS+ADLRA  +I+D++  +  R+ +W F+HGL ENAI+GGRVDN FD+RVL SY++++F+      SG      F     LP++ S  DY A+I  + + + P+FF LP NI RSSQR+ISSQVI QLR L R    G+KFD+++WS EL+PVLN WK LNQ  N+I   +    +R    SP+ +F+ LE++N+I+LV+ +H SL +LSKV++G+ LLT +VQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W E +E   LLS  LDL ELFHPDTFLNALRQ TAR +  SMD L+FV  W G    AK  VKI  L +EGC FDG  ++E   DS S+ ++PP  + W+ +    +YS ++ ISLP+Y    RD++VT ID+PC  G Q+KWIQSG ALFLK+
Sbjct:   35 LERFLDDGNEFILSGSKAGARVRFSNKLDPGDTKENVLVFFKIRPDVITEDNLYGNILISSMLESPINTLYQAVRQVYAPILLKDEKWSKDFDPKLQSMLSDLEAGLGTILRKSVSSHGKPTFGGEDDLQGILTPNDEFQFWTEVSASKSKSSARERASHFTSLFQSIANYYSTLDNLPLSEVVQLVETTQETVDDVWRQTDYDP-YPEHRMKHLLDIIGSALGRSVQRNLGDMDHWKGPFPTVKENLRAGITVCEQWAAACEHLTGQLWRRFTPHPWKIDT-FSSDSIKKLGGRLAEVLSIRMVHEKLLHFLPSGEDNALRSVKVFEPFIGLNPVHYNPYTEPLWRAAVSQYERIIEPAEQKIAVKLKTYFSEFHDS--PQQLLQAFQKHKELVKRPSLKKVLNLERETLLTRLQDYNKDILSDFESRCHGSPGDSSGPLTGRNLPEVVNNIVWVRQLQMKVEDTVKTADALLSDLSGFPSFRKSAKDLLDQLKVYEQEQFEDWLREINAGLSDPKS-GFSLQPNSQVMELDHSNGTLKIHYSDRLVTLLREVRQLSALGLVIPPKIQQAAKTAQKFYKQAIILKQVAHFYNTIDQQMIQSQRPMMLNSALAFEQIIKNTRTSSGESSQKMHITWNNPKDLQDYIEKLQGVAQQLATENRKLRKKHKDFSEKVVALMNIDLLRHQQKWKDGLLEIRSGLRS--------SDMRPWRQHWNHQLYKALEHQYQIGLEALNENLPEINIDLTFKQGRLQFKPPFEEIRSKYYREMKRFISIPNQFKGLSEA--GEEPIFSVMSERNANGFITVFSKAEDLFRRLAATLDRFKEWVVIGQVDIDVLMNKNLHDVHDWEKNFKALKVRGKEAERLPSSIKIDCITINCNPVKSVVDDLIQTLFDSLLISLKKSIQAHLHEIDIFVTEGMEMLSSRPQTVEEIGEANMKHAQLKLRKPEILPLFKEAEDKNRLLRSVAGGGLDTIGNLRAKWDKFELMMESHQLMVKEQIEVMKEKVKSRVQIYTQEIEKFKARWDQLKPSNDLIETGEEDALVKSAQSIKEKKVEFDELEETKRKLIEDCLHFGLEAPDFFLADEIRIDIEDCTKTWSLYEEFYQGFNEKAKEDWISYRSKCYSFEEFILSWHERLRKMEEHTTMSVKLQKEIDRYKTVVPVLKYVRGEHLSQDHWLDLFRLLGLPKGTTLEKLLFGDLLRVADVIVSKASELKELNSRAQGEITIREALRELDLWGAGAIFTLTDYEDSHSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVFVWEQKLAELDEYLQYLNQIQRKWVYLEPIFGRGALPREEARFNRVDEDFRSIMSDIKRDNRVTLLTSRAGIRNSLITILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPAVIQSHLKKLFAGVNSVDFDENFKHIITMKSLDGETVPLKNKILVTSDVEVWLSHLASEMKSTLEKLL---VECITAGKKSHSGIDPLQFPSQILCLAEQIQFTEEVEAAIREQRLHQVDIELMAKLDHYTSIDTSMGDTAGAGILELKLKALILDVIHNIDVVKQLNQAQVYSTEDWAWKKQLRFYLKP-DKKCYVKMVDAEMEYTYEYQGNAPKLVYTPLTDKCYLTLTQALKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRSSCDLLGKEVALDPNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKNLGRKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGNLLH----QLKKNGKETAIN------ESHMVVQALRLNTMSKLTFADCSRCDALIKDVFPGIDFKDVEYMELSAALQQAFEEANLEIIPSQIKKALELYEQLRQRMGVVIVGPSGAGKSTLWRMLRAALNKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVRESQDINSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSSASPATISRMGMIFLSDENTDLQSLIQSWLRGQPANVRHNLENWIGDYFEKALNWVLKQNDFVVETSLIGTVMNGLSHLHGCTDRGQFIVSLIHGLGGNLNMKSRNEFAKEVFSWARESPPDPRKP--LDTFYDAKTGRLMTYSLEKPHNLTTEDFCNPQTL--PVIRTPDIQRGLDYFKPWLGCDTKQPFILVGPEGCGKGMLLRYAFSQLRSTHIATVHCSAQTSSRHVLQKLTQTCLVISTNTGRVYRPKDCERLVLYLKDINLPKPDKWGTSTLVAFLQQVLTYHGFYDDNLEWVGLENIQIVASMSAGGSIGRHKLTTRFTSVVRICAVDYPERDQLQTICSSYLEPVIHKNLKNHPTWGSLSKIHHLAGSMVQVYEQVRAKFSVDDYSHYLFTPCILTQWIIGLFRYDLTGGSSKQSQDCVLEIVAYEARRLFRDRIVTAKELHVFDNILMSVLQGDWGSDVLDNMTDAFYVTWGALHGAGAVIAPGQPLPPHGRPLGRLNSNDLQDVIKKGAIQYSHMNRELEILFFHEVLDYMSRVDRVLSCPSGSLLLAGRSGVGRRTVTSLVSHMHGAVLFTPKVSRGYELKQFKNDLKQVIQMAGIEGQQVLFLLEDHQFVHPDFLEMINSLLSSGEIPGLYTVEELEPLLSPLKNQASEDGFTGPVLGYFTNSKHNFFLQNLHVVLIMDCTNTNFTINCESNPAFYKKCSVQWMEGWSDKSMKKIPEMVILDPNSKEKMQMDPGYKKVSSD---SEFFNS-FLMIHESCKSYGATPSRYMTFLRVYGSLYSSKIAELTKRQRHLQAGVSKLNEAKALVDELKGKAGEQSLLLKTKQAEADSALQEITTSMQNASDQKAEMEKIQQKIAEEAVKIAERKGKIEDELKEVQPLVNEAKEAVGNIKPESLSEIRSLRAPPDIIRDILEGVLRMMGIFDTSWVSMKSFLAKRGVREDIVTFDVRNITSEIRISVEELLKMKRTSFEEKNARRASAAAAPLAAWVIANVQYSHVLEKIQPLEKEQSKIL----NASTR-------------------------TAEAAKLEAELSKAQEVIQAAELLINQLDGENKRWNSQVVEITEQLSALPKRAQLAAAFITYISAAPEDQRKGSIEQWMKCVGLETFDLRRFLSTESEQLIWKSEGLPSDELSIENALVILQSKICPFLIDPSSQATEWLKTHLKESRMEVINQQ-----------VRL--YIYIKEHIGLSCSFFI---------GPRYVVQIGDKTIDYNEDFRLFLATRNPNPFIPPDAASCVTEVNFTTTRAGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILDNKDLIESLNQTKASSALIQESLSESHKLQLSLDQERNAYLPLAESASKMYFIICDLSKINNMYRFSLAAFLRLFQRILIGKQESKSTDVRIKSLIDALKHMVYEYVCRSLFKADQLMFALHFVRGMHSELFQENEWDVFTGVIIGDMFKKSDSQRTLREQVPSWIEQERAWAVALLKTSLPALYQSLSLEDSNLWSHFSKSSACEQEFPQTVAKKLSLFQQLLVVQAIRPDRLQSAMGLFACKNLELKELSPPPLNLKRL-SKETLAIEPILIIISPGADPSQELQELACAEVGRDCFHEVAMGQGQADIAIQSLRECARDGEWLCLKNLHLVISWLPVLEKELNSLQPKGNFRLWLTAEVHPKFTPILLQSSLKITYEAPPGLKKNLMRTYESWTPEQISKNGQTPRAQALFSLAWFHAVCQERRNYIPQGWTKFYEFSLADLRAAYDIIDRLF-EGKRDFKWDFVHGLLENAIYGGRVDNFFDLRVLRSYLEQFFSSHTTGTSGMSKMAAFPLPFSLPNSCSIMDYRAVIESIPEDDQPAFFGLPANIARSSQRMISSQVISQLRTLSRSVTAGSKFDREVWSNELSPVLNLWKKLNQNSNLIHQKVSPPTERHG--SPISSFIILEQFNAIRLVQSIHQSLAALSKVIRGTSLLTSDVQRLASALLEQKCPLAWQNKWEGPEDPLQYLRGLVARAVAIQNWVEKAENQTLLSDTLDLSELFHPDTFLNALRQETARAMNCSMDNLRFVASWRGKIADAKLQVKISGLQLEGCSFDGNRLSENRHDSPSVSVVPPCYMAWIPQQSLGTYSPEECISLPMYTSAERDRLVTNIDLPC-GGNQNKWIQSGAALFLKN 4245          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Match: DYNC2H1 (dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI gene;Acc:100380107])

HSP 1 Score: 4199.82 bits (10891), Expect = 0.000e+0
Identity = 2205/4293 (51.36%), Postives = 2935/4293 (68.37%), Query Frame = 3
Query:  192 LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTS-DNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFK----PQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG-----NFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            L++F D+ +  +L       +  FSN+L+  D   N LVF K  P +IT DN+   I+++++ E+PI++LY  ++ +Y PILL D       DPK+Q ++S+LE GLG+I+RK +S+             I + +DE  FW +  ++ S    + R +   S  Q +      + +  L+E    +E     ++D+W+    +P YP+ RMK L++II + L R +Q  L  +  W+  +  VKE+L   I VC  W   C+ L  + W+++ PH W  D   +   I     RL E+ S+R VHE++   LP  E    +  + F+ F+ + P+ YNPYTEP+W+ AV ++ R IEPAE  I  +LK  F E   +  PQQLL+ FQ++ +L+ RP +   L  ERETLL +L  + K +  DF    H S      P   +N  + ++ IVW +QL+ K+ + +     +L DL GF  F K  K+ L+++  + QEQFE W +E+   L D  +         ++MEL   +G L ++YSDRLV L+REVR LS LG  I   +  AA   QKFY +A+ILKQVA FYNTI+ QMI  Q+ MML++A+ FE+++K V +    K  + WNNP++L  +I+KLQ  +  + ++NR LRK+H    EK+V LM IDLLR QQKWKD L EIR +   +E Q     +  PW++H +HQLYKALE+QY IGLEALNENLPEI +DL ++QGRLQF P FEEI+SKY++EMK+FI++PNQFKGL+++  G + IF  + ERNA GF+  + KAE LF+RL+A L++FKEW+++G +D++  ++++  D+ D+EKNFKA+K +GKEAE+LP+ IKIDCIT+NC P+K  VD LIQ +FD+LL SL+K+I+  +  +D ++T  +++LS RPQ ++EI EA + HA+    +  I     ++E  N LLR+VAGGG+DT+  L+ KWDKFELMMES Q+M++EQIEVMK  + SR + + Q+I KF  RW  LKP  D++++G   A + + Q IK+KK+E +EL   K  L +DC HF +E  +F L +EI  DI+     WS +EE+  G    AKEDW+S+RS+ Y FEEF+  W E+LR  E  TTM+++LQKEID YK ++P+LK++RGE LSQDHWL++FRLL +P+G TLE L    +L  A  I+  A  +KELN +AQGE+TIREA+REL+LWGAGA+F L +Y DS + +I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK  VWE KLA+LDEYLQ LNQIQRKWVYLEPIFG+ ALP+E++RF                 NRV                 D+  R Q A            P    I    L+ IL    N   I       + G+  VDF+++ +HIITMKSLDGE V L+N++L+TS+VE WL +L +EMK+TL   L   ++ +    +S+ GI+  ++PSQILCL+E I FT   E  + E  +  +  EL+ KL+ YT+   S+   +   + +LKLK+LILD +HNID++ QL      S  +W W KQLRFY K  D+ C ++MVDAE  YTYEYQGNAPKLV+TPLTDKCYLTLTQ + MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V +D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDN+LIAEVIL S+GFK+AK LGRKLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  NLL     ++K  G +T  N         ++VQALR+NT+SKLT+AD    ++LIKDVFP ID K++EY  L++A+++  +E N+  +  Q KK LE+YEQLRQRMGVVIVGPSG+GKST+W++LR ALNKIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+E Q+I SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLS ASPATISRMGMIFLS E TD++SL+ SWL+ Q  + +H L  ++ D+F K+L+W+ K+N+F + TS +GTV NGLS+L    ++  F V LI GLGGNLN  SR  FA  V+    E  P+  K   L+ +++ K  RL+TYS E    L+ +   + + +  P+I T DIQR LDYFK WL  DT+QPFIL GPEGCGK ++L + F +L+S  + T+HCSAQT+  HVLQKL Q C++I++NTGRVYRPK+ ERL+LYLKDINLPK DKWGTS L++FLQQV+TY GFYD NLE+VGL+ +QIV SM++  S+GR  L+TRFTS+VR+C++ YP +DQL  I ++YL+PV+ + +  HP W   SK+  LA +M++VY Q+++KF+VDDYSHYLFTP  LTQW++ L RYDL       ++VS L ++   S   F                 F  I           L D ++VTWG+     A   P       G+ LG+L S  L+D I +G +QYS   R+L+I+ F EV D ++++DRVL+ P GS+LLAG+SGVGRRT + LVSHMH   L +PK+ RGYELKQFKNDLK  +Q AG+EG+ ++ LLEDHQF+ P +LE+INSLL+SGE+PGLYT EELEP+L  LK+ A+E G  G +  YF +R+   LH++LIMDC+N NF INC+SNPAF+K CSVQW+E WS  SM KIP M+I     +E  Q+     K  +    S+  NS FL +H++C    +T   Y+ F+++Y  +Y  K  E+  RQ H+Q G+ K++EAK +V ELK KA EQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  K  EE V +A+RK  I+DEL  ++P V +A++AV +IK   LSEIR+LRAPPD+IRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFD R IT E RI VEELL   + SF+ K           +   + A V ++  +  + P       LK            L+  VS     V     +    TA+AAKLE EL  A E I AAE L+ +L+ E +RWN Q+VE+  +LSAL  ++ LAAA + Y+ ++PEDQRK  ++ WM+  GLE FD+R+FL+TE EQL WK EGL SDELS+ENALVILQ  + PFLIDPSS AT WLK H K+ ++E++NQQ           VR    + I+E  GL    +          GPR VVQ+GDK IDYN DF+LFLATRNP P +PPDA + V+ VNFTTT+AGL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL+NKDL+ SLN+TK SS  I +SL ES KLQ+SLD+ER+A+LPLAE  S ++F+I DLSKINNMYRFSL +FLRLFQR L   + S  + +R  SLI  L+ +VYEYVCRS+FK+D+LMFALH       +LF+     Q+  L  G F S ++ R   VP WI+ +R  A++ L +++P L+  L+++D +LW  F+KSS CE+E PQ++  KLSLFQ++L++QA+RPDRLQSA+  F C  LELK LSP  +NL ++   ET++ EPILIIISPGADPSQ+LQEL+   +G + +++VAMGQGQADI +  L +C+++G+WLCLKNLHLV SWLPVLEKELNSL+P  +FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NL+R+Y++W+ + ISK G   RA ALFSLAWFHA+ QERRN+IPQGWTKFYEFS+ADLRA  +I+D++  +  R+ +W F+HGL ENAI+GGRVDN FD+RVL SY++++F+      SG      F     LP++ S  DY A+I  + + + P+FF LP NI RSSQR+ISSQVI QLR L R    G+KFD+++WS EL+PVLN WK LNQ  N+I   +    +R    SP+ +F+ LE++N+I+LV+ +H SL +LSKV++G+ LLT +VQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W E +E   LLS  LDL ELFHPDTFLNALRQ TAR +  SMD L+FV  W G    AK  VKI  L +EGC FDG  ++E   DS S+ ++PP  + W+ ++   +YS ++ ISLP+Y    RD++VT ID+PC  G Q+KWIQSG ALFLK+
Sbjct:   35 LERFLDDGNEFILSGSKAGARVRFSNKLDPGDTKENVLVFFKIRPDVITEDNLYGNILISSMLESPINTLYQAVRQVYAPILLKDEKWSKDFDPKLQSMLSDLEAGLGTILRKSVSR-------------ILTPNDEFQFWTEVSASKSKSSARERASHFTSLFQSIANYYSTLDNLPLSEVVQLVETTQETVDDVWRQTDYDP-YPEHRMKHLLDIIGSALGRSVQRNLGDMDHWKGPFPTVKENLRAGITVCEQWAAACEHLTGQLWRRFTPHPWKIDT-FSSDSIKKLGGRLAEVLSIRMVHEKLLHFLPSGEDNALRSVKVFEPFIGLNPVHYNPYTEPLWRAAVSQYERIIEPAEQKIAVKLKTYFSEFHDS--PQQLLQAFQKHKELVKRPSLKKVLNLERETLLTRLQDYNKDILSDFESRCHGSPGDSSGPLTGRNLPEVVNNIVWVRQLQMKVEDTVKTADALLSDLSGFPSFRKSAKDLLDQLKVYEQEQFEDWLREINAGLSDPKSGF------SQVMELDHSNGTLKIHYSDRLVTLLREVRQLSALGLVIPPKIQQAAKTAQKFYKQAIILKQVAHFYNTIDQQMIQSQRPMMLNSALAFEQIIK-VRTSFIQKMHITWNNPKDLQDYIEKLQGVAQQLATENRKLRKKHKDFSEKVVALMNIDLLRHQQKWKDGLLEIRSVFSNLEYQGLRSSDMRPWRQHWNHQLYKALEHQYQIGLEALNENLPEINIDLTFKQGRLQFKPPFEEIRSKYYREMKRFISIPNQFKGLSEA--GEEPIFSVMSERNANGFITVFSKAEDLFRRLAATLDRFKEWVVIGQVDIDVLMNKNLHDVHDWEKNFKALKVRGKEAERLPSSIKIDCITINCNPVKSVVDDLIQTLFDSLLISLKKSIQAHLHEIDIFVTEGMEMLSSRPQTVEEIGEANMKHAQLKLRKPEILPLFKEAEDKNRLLRSVAGGGLDTIGNLRAKWDKFELMMESHQLMVKEQIEVMKEKVKSRVQIYTQEIEKFKARWDQLKPSNDLIETGEEDALVKSAQSIKEKKVEFDELEETKRKLIEDCLHFGLEAPDFFLADEIRIDIEDCTKTWSLYEEFYQGFNEKAKEDWISYRSKCYSFEEFILSWHERLRKMEEHTTMSVKLQKEIDRYKTVVPVLKYVRGEHLSQDHWLDLFRLLGLPKGTTLEKLLFGDLLRVADVIVSKASELKELNSRAQGEITIREALRELDLWGAGAIFTLTDYEDSHSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVFVWEQKLAELDEYLQYLNQIQRKWVYLEPIFGRGALPREEARF-----------------NRV-----------------DEDFRSQGA------------PHLNMI----LMVILLALENYAFI------CYIGVNSVDFDENFKHIITMKSLDGETVPLKNKILVTSDVEVWLSHLASEMKSTLEKLL---VECITAGKKSHSGIDPLQFPSQILCLAEQIQFTEEVEAAIREQRLHQVDIELMAKLDHYTSIDTSMGDTAGAGILELKLKALILDVIHNIDVVKQLNQAQVYSTEDWAWKKQLRFYLKP-DKKCYVKMVDAEMEYTYEYQGNAPKLVYTPLTDKCYLTLTQALKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRSSCDLLGKEVALDPNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKNLGRKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGNLLH----QLKKNGKETASN--------HMVVQALRLNTMSKLTFADCSRCDALIKDVFPGIDFKDVEYMELSAALQQAFEEANLEIIPSQIKKALELYEQLRQRMGVVIVGPSGAGKSTLWRMLRAALNKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVRESQDINSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSSASPATISRMGMIFLSDENTDLQSLIQSWLRGQPANVRHNLENWIGDYFEKALNWVLKQNDFVVETSLIGTVMNGLSHLHGCTDRGQFIVSLIHGLGGNLNMKSRNEFAKEVFSWARESPPDPRKP--LDTFYDAKTGRLMTYSLEKPHNLTTEDFCNPQTL--PVIRTPDIQRGLDYFKPWLGCDTKQPFILVGPEGCGKGMLLRYAFSQLRSTHIATVHCSAQTSSRHVLQKLTQTCLVISTNTGRVYRPKDCERLVLYLKDINLPKPDKWGTSTLVAFLQQVLTYHGFYDDNLEWVGLENIQIVASMSAGGSIGRHKLTTRFTSVVRICAVDYPERDQLQTICSSYLEPVIHKNLKNHPTWGSLSKIHHLAGSMVQVYEQVRAKFSVDDYSHYLFTPCILTQWIIGLFRYDLTGGRWYRSSVSCLLLLITSSCTFF-----------------FICI-----------LTDAFYVTWGALHGAGAVIAPGQPLPPHGRPLGRLNSNDLQDVIKKGAIQYSHMNRELEILFFHEVLDYMSRVDRVLSCPSGSLLLAGRSGVGRRTVTSLVSHMHGAVLFTPKVSRGYELKQFKNDLKQVIQMAGIEGQQVLFLLEDHQFVHPDFLEMINSLLSSGEIPGLYTVEELEPLLSPLKNQASEDGFTGPVLGYFTNRVLQNLHVVLIMDCTNTNFTINCESNPAFYKKCSVQWMEGWSDKSMKKIPEMVILDPNSKEKMQMDPGYKKVSSD---SEFFNS-FLMIHESCKSYGATPSRYMTFLRVYGSLYSSKIAELTKRQRHLQAGVSKLNEAKALVDELKGKAGEQSLLLKTKQAEADSALQEITTSMQNASDQKAEMEKIQQKIAEEAVKIAERKGKIEDELKEVQPLVNEAKEAVGNIKPESLSEIRSLRAPPDIIRDILEGVLRMMGIFDTSWVSMKSFLAKRGVREDIVTFDVRNITSEIRISVEELLKMKRTSFEEKVPIILIYRLIFIVLALCATVDFTSLVLCMIPF---SVSLK------------LKFSVSVCSVLVPEKILNASTRTAEAAKLEAELSKAQEVIQAAELLINQLDGENKRWNSQVVEITEQLSALPKRAQLAAAFITYISAAPEDQRKGSIEQWMKCVGLETFDLRRFLSTESEQLIWKSEGLPSDELSIENALVILQSKICPFLIDPSSQATEWLKTHLKESRMEVINQQ-----------VRL--YIYIKEHIGLSCSFFI---------GPRYVVQIGDKTIDYNEDFRLFLATRNPNPFIPPDAASCVTEVNFTTTRAGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILDNKDLIESLNQTKASSALIQESLSESHKLQLSLDQERNAYLPLAESASKMYFIICDLSKINNMYRFSLAAFLRLFQRILIGKQESKSTDVRIKSLIDALKHMVYEYVCRSLFKADQLMFALHFVRGMHSELFQENVSTQQNFLLVGYFDSQRTLRE-QVPSWIEQERAWAVALLKTSLPALYQSLSLEDSNLWSHFSKSSACEQEFPQTVAKKLSLFQQLLVVQAIRPDRLQSAMGLFACKNLELKELSPPPLNLKRL-SKETLAIEPILIIISPGADPSQELQELACAEVGRDCFHEVAMGQGQADIAIQSLRECARDGEWLCLKNLHLVISWLPVLEKELNSLQPKGNFRLWLTAEVHPKFTPILLQSSLKITYEAPPGLKKNLMRTYESWTPEQISKNGQTPRAQALFSLAWFHAVCQERRNYIPQGWTKFYEFSLADLRAAYDIIDRLF-EGKRDFKWDFVHGLLENAIYGGRVDNFFDLRVLRSYLEQFFSSHTTGTSGMSKMAAFPLPFSLPNSCSIMDYRAVIESIPEDDQPAFFGLPANIARSSQRMISSQVISQLRTLSRSVTAGSKFDREVWSNELSPVLNLWKKLNQNSNLIHQKVSPPTERHG--SPISSFIILEQFNAIRLVQSIHQSLAALSKVIRGTSLLTSDVQRLASALLEQKCPLAWQNKWEGPEDPLQYLRGLVARAVAIQNWVEKAENQTLLSDTLDLSELFHPDTFLNALRQETARAMNCSMDNLRFVASWRGKIADAKLQVKISGLQLEGCSFDGNRLSENRHDSPSVSVVPPCYMAWIPQSL-GTYSPEECISLPMYTSAERDRLVTNIDLPC-GGNQNKWIQSGAALFLKN 4149          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Match: DYNC2H1 (dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI gene;Acc:100380107])

HSP 1 Score: 3048.07 bits (7901), Expect = 0.000e+0
Identity = 1579/2867 (55.07%), Postives = 2046/2867 (71.36%), Query Frame = 3
Query: 4434 FQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTS-DNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFK----PQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG-----NFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            + G+  VDF+++ +HIITMKSLDGE V L+N++L+TS+VE WL +L +EMK+TL   L   ++ +    +S+ GI+  ++PSQILCL+E I FT   E  + E  +  +  EL+ KL+ YT+   S+   +   + +LKLK+LILD +HNID++ QL      S  +W W KQLRFY K  D+ C ++MVDAE  YTYEYQGNAPKLV+TPLTDKCYLTLTQ + MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V +D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDN+LIAEVIL S+GFK+AK LGRKLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  NLL     ++K  G +T  N         ++VQALR+NT+SKLT+AD    ++LIKDVFP ID K++EY  L++A+++  +E N+  +  Q KK LE+YEQLRQRMGVVIVGPSG+GKST+W++LR ALNKIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+E Q+I SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLS ASPATISRMGMIFLS E TD++SL+ SWL+ Q  + +H L  ++ D+F K+L+W+ K+N+F + TS +GTV NGLS+L    ++  F V LI GLGGNLN  SR  FA  V+    E  P+  K   L+ +++ K  RL+TYS E    L+ +   + + +  P+I T DIQR LDYFK WL  DT+QPFIL GPEGCGK ++L + F +L+S  + T+HCSAQT+  HVLQKL Q C++I++NTGRVYRPK+ ERL+LYLKDINLPK DKWGTS L++FLQQV+TY GFYD NLE+VGL+ +QIV SM++  S+GR  L+TRFTS+VR+C++ YP +DQL  I ++YL+PV+ + +  HP W   SK+  LA +M++VY Q+++KF+VDDYSHYLFTP  LTQW++ L RYDL       ++VS L   S + + +    L++S          F  I           L D ++VTWG+     A   P       G+ LG+L S  L+D I +G +QYS   R+L+I+ F EV D ++++DRVL+ P GS+LLAG+SGVGRRT + LVSHMH   L +PK+ RGYELKQFKNDLK  +Q AG+EG+ ++ LLEDHQF+ P +LE+INSLL+SGE+PGLYT EELEP+L  LK+ A+E G  G +  YF +R+   LH++LIMDC+N NF INC+SNPAF+K CSVQW+E WS  SM KIP M+I     +E  Q+     K     +G     + FL +H++C    +T   Y+ F+++Y  +Y  K  E+  RQ H+Q G+ K++EAK +V ELK KA EQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  K  EE V +A+RK  I+DEL  ++P V +A++AV +IK   LSEIR+LRAPPD+IRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFD R IT E RI VEELL   + SF+ K           +   + A V ++  +  + P       LK            L+  VS     V     +    TA+AAKLE EL  A E I AAE L+ +L+ E +RWN Q+VE+  +LSAL  ++ LAAA + Y+ ++PEDQRK  ++ WM+  GLE FD+R+FL+TE EQL WK EGL SDELS+ENALVILQ  + PFLIDPSS AT WLK H K+ ++E++NQQ           VR    + I+E  GL    +          GPR VVQ+GDK IDYN DF+LFLATRNP P +PPDA + V+ VNFTTT+AGL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL+NKDL+ SLN+TK SS  I +SL ES KLQ+SLD+ER+A+LPLAE  S ++F+I DLSKINNMYRFSL +FLRLFQR L   + S  + +R  SLI  L+ +VYEYVCRS+FK+D+LMFALH       +LF+     Q+  L  G F S ++ R   VP WI+ +R  A++ L +++P L+  L+++D +LW  F+KSS CE+E PQ++  KLSLFQ++L++QA+RPDRLQSA+  F C  LELK LSP  +NL ++   ET++ EPILIIISPGADPSQ+LQEL+   +G + +++VAMGQGQADI +  L +C+++G+WLCLKNLHLV SWLPVLEKELNSL+P  +FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NL+R+Y++W+ + ISK G   RA ALFSLAWFHA+ QERRN+IPQGWTKFYEFS+ADLRA  +I+D++  +  R+ +W F+HGL ENAI+GGRVDN FD+RVL SY++++F+      SG      F     LP++ S  DY A+I  + + + P+FF LP NI RSSQR+ISSQVI QLR L R    G+KFD+++WS EL+PVLN WK LNQ  N+I   +    +R    SP+ +F+ LE++N+I+LV+ +H SL +LSKV++G+ LLT +VQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W E +E   LLS  LDL ELFHPDTFLNALRQ TAR +  SMD L+FV  W G    AK  VKI  L +EGC FDG  ++E   DS S+ ++PP  + W+ ++   +YS ++ ISLP+Y    RD++VT ID+PC  G Q+KWIQSG ALFLK+
Sbjct: 1368 YIGVNSVDFDENFKHIITMKSLDGETVPLKNKILVTSDVEVWLSHLASEMKSTLEKLL---VECITAGKKSHSGIDPLQFPSQILCLAEQIQFTEEVEAAIREQRLHQVDIELMAKLDHYTSIDTSMGDTAGAGILELKLKALILDVIHNIDVVKQLNQAQVYSTEDWAWKKQLRFYLKP-DKKCYVKMVDAEMEYTYEYQGNAPKLVYTPLTDKCYLTLTQALKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRSSCDLLGKEVALDPNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNELIAEVILYSEGFKDAKNLGRKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGNLLH----QLKKNGKETASN--------HMVVQALRLNTMSKLTFADCSRCDALIKDVFPGIDFKDVEYMELSAALQQAFEEANLEIIPSQIKKALELYEQLRQRMGVVIVGPSGAGKSTLWRMLRAALNKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVRESQDINSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSSASPATISRMGMIFLSDENTDLQSLIQSWLRGQPANVRHNLENWIGDYFEKALNWVLKQNDFVVETSLIGTVMNGLSHLHGCTDRGQFIVSLIHGLGGNLNMKSRNEFAKEVFSWARESPPDPRKP--LDTFYDAKTGRLMTYSLEKPHNLTTEDFCNPQTL--PVIRTPDIQRGLDYFKPWLGCDTKQPFILVGPEGCGKGMLLRYAFSQLRSTHIATVHCSAQTSSRHVLQKLTQTCLVISTNTGRVYRPKDCERLVLYLKDINLPKPDKWGTSTLVAFLQQVLTYHGFYDDNLEWVGLENIQIVASMSAGGSIGRHKLTTRFTSVVRICAVDYPERDQLQTICSSYLEPVIHKNLKNHPTWGSLSKIHHLAGSMVQVYEQVRAKFSVDDYSHYLFTPCILTQWIIGLFRYDLTGGRWYRSSVSCLVCYSIQYINLL--LLITSSCT-----FFFICI-----------LTDAFYVTWGALHGAGAVIAPGQPLPPHGRPLGRLNSNDLQDVIKKGAIQYSHMNRELEILFFHEVLDYMSRVDRVLSCPSGSLLLAGRSGVGRRTVTSLVSHMHGAVLFTPKVSRGYELKQFKNDLKQVIQMAGIEGQQVLFLLEDHQFVHPDFLEMINSLLSSGEIPGLYTVEELEPLLSPLKNQASEDGFTGPVLGYFTNRVLQNLHVVLIMDCTNTNFTINCESNPAFYKKCSVQWMEGWSDKSMKKIPEMVILDPNSKEKMQMDPGYKKVS---SGDSEFFNSFLMIHESCKSYGATPSRYMTFLRVYGSLYSSKIAELTKRQRHLQAGVSKLNEAKALVDELKGKAGEQSLLLKTKQAEADSALQEITTSMQNASDQKAEMEKIQQKIAEEAVKIAERKGKIEDELKEVQPLVNEAKEAVGNIKPESLSEIRSLRAPPDIIRDILEGVLRMMGIFDTSWVSMKSFLAKRGVREDIVTFDVRNITSEIRISVEELLKMKRTSFEEKVPIILIYRLIFIVLALCATVDFTSLVLCMIPF---SVSLK------------LKFSVSVCSVLVPEKILNASTRTAEAAKLEAELSKAQEVIQAAELLINQLDGENKRWNSQVVEITEQLSALPKRAQLAAAFITYISAAPEDQRKGSIEQWMKCVGLETFDLRRFLSTESEQLIWKSEGLPSDELSIENALVILQSKICPFLIDPSSQATEWLKTHLKESRMEVINQQ-----------VRL--YIYIKEHIGLSCSFFI---------GPRYVVQIGDKTIDYNEDFRLFLATRNPNPFIPPDAASCVTEVNFTTTRAGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILDNKDLIESLNQTKASSALIQESLSESHKLQLSLDQERNAYLPLAESASKMYFIICDLSKINNMYRFSLAAFLRLFQRILIGKQESKSTDVRIKSLIDALKHMVYEYVCRSLFKADQLMFALHFVRGMHSELFQENVSTQQNFLLVGYFDSQRTLRE-QVPSWIEQERAWAVALLKTSLPALYQSLSLEDSNLWSHFSKSSACEQEFPQTVAKKLSLFQQLLVVQAIRPDRLQSAMGLFACKNLELKELSPPPLNLKRL-SKETLAIEPILIIISPGADPSQELQELACAEVGRDCFHEVAMGQGQADIAIQSLRECARDGEWLCLKNLHLVISWLPVLEKELNSLQPKGNFRLWLTAEVHPKFTPILLQSSLKITYEAPPGLKKNLMRTYESWTPEQISKNGQTPRAQALFSLAWFHAVCQERRNYIPQGWTKFYEFSLADLRAAYDIIDRLF-EGKRDFKWDFVHGLLENAIYGGRVDNFFDLRVLRSYLEQFFSSHTTGTSGMSKMAAFPLPFSLPNSCSIMDYRAVIESIPEDDQPAFFGLPANIARSSQRMISSQVISQLRTLSRSVTAGSKFDREVWSNELSPVLNLWKKLNQNSNLIHQKVSPPTERHG--SPISSFIILEQFNAIRLVQSIHQSLAALSKVIRGTSLLTSDVQRLASALLEQKCPLAWQNKWEGPEDPLQYLRGLVARAVAIQNWVEKAENQTLLSDTLDLSELFHPDTFLNALRQETARAMNCSMDNLRFVASWRGKIADAKLQVKISGLQLEGCSFDGNRLSENRHDSPSVSVVPPCYMAWIPQSL-GTYSPEECISLPMYTSAERDRLVTNIDLPC-GGNQNKWIQSGAALFLKN 4149          

HSP 2 Score: 1196.03 bits (3093), Expect = 0.000e+0
Identity = 618/1348 (45.85%), Postives = 884/1348 (65.58%), Query Frame = 3
Query:  192 LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIM 4199
            L++F D+ +  +L       +  FSN+L+  D   N LVF K  P +IT DN+   I+++++ E+PI++LY  ++ +Y PILL D       DPK+Q ++S+LE GLG+I+RK +S+             I + +DE  FW +  ++ S    + R +   S  Q +      + +  L+E    +E     ++D+W+    +P YP+ RMK L++II + L R +Q  L  +  W+  +  VKE+L   I VC  W   C+ L  + W+++ PH W  D   +   I     RL E+ S+R VHE++   LP  E    +  + F+ F+ + P+ YNPYTEP+W+ AV ++ R IEPAE  I  +LK  F E   +  PQQLL+ FQ++ +L+ RP +   L  ERETLL +L  + K +  DF    H S      P   +N  + ++ IVW +QL+ K+ + +     +L DL GF  F K  K+ L+++  + QEQFE W +E+   L D  +         ++MEL   +G L ++YSDRLV L+REVR LS LG  I   +  AA   QKFY +A+ILKQVA FYNTI+ QMI  Q+ MML++A+ FE+++K V +    K  + WNNP++L  +I+KLQ  +  + ++NR LRK+H    EK+V LM IDLLR QQKWKD L EIR +   +E Q     +  PW++H +HQLYKALE+QY IGLEALNENLPEI +DL ++QGRLQF P FEEI+SKY++EMK+FI++PNQFKGL+++  G + IF  + ERNA GF+  + KAE LF+RL+A L++FKEW+++G +D++  ++++  D+ D+EKNFKA+K +GKEAE+LP+ IKIDCIT+NC P+K  VD LIQ +FD+LL SL+K+I+  +  +D ++T  +++LS RPQ ++EI EA + HA+    +  I     ++E  N LLR+VAGGG+DT+  L+ KWDKFELMMES Q+M++EQIEVMK  + SR + + Q+I KF  RW  LKP  D++++G   A + + Q IK+KK+E +EL   K  L +DC HF +E  +F L +EI  DI+     WS +EE+  G    AKEDW+S+RS+ Y FEEF+  W E+LR  E  TTM+++LQKEID YK ++P+LK++RGE LSQDHWL++FRLL +P+G TLE L    +L  A  I+  A  +KELN +AQGE+TIREA+REL+LWGAGA+F L +Y DS + +I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK  VWE KLA+LDEYLQ LNQIQRKWVYLEPIFG+ ALP+E++RF RVDEDFR ++
Sbjct:   35 LERFLDDGNEFILSGSKAGARVRFSNKLDPGDTKENVLVFFKIRPDVITEDNLYGNILISSMLESPINTLYQAVRQVYAPILLKDEKWSKDFDPKLQSMLSDLEAGLGTILRKSVSR-------------ILTPNDEFQFWTEVSASKSKSSARERASHFTSLFQSIANYYSTLDNLPLSEVVQLVETTQETVDDVWRQTDYDP-YPEHRMKHLLDIIGSALGRSVQRNLGDMDHWKGPFPTVKENLRAGITVCEQWAAACEHLTGQLWRRFTPHPWKIDT-FSSDSIKKLGGRLAEVLSIRMVHEKLLHFLPSGEDNALRSVKVFEPFIGLNPVHYNPYTEPLWRAAVSQYERIIEPAEQKIAVKLKTYFSEFHDS--PQQLLQAFQKHKELVKRPSLKKVLNLERETLLTRLQDYNKDILSDFESRCHGSPGDSSGPLTGRNLPEVVNNIVWVRQLQMKVEDTVKTADALLSDLSGFPSFRKSAKDLLDQLKVYEQEQFEDWLREINAGLSDPKSGF------SQVMELDHSNGTLKIHYSDRLVTLLREVRQLSALGLVIPPKIQQAAKTAQKFYKQAIILKQVAHFYNTIDQQMIQSQRPMMLNSALAFEQIIK-VRTSFIQKMHITWNNPKDLQDYIEKLQGVAQQLATENRKLRKKHKDFSEKVVALMNIDLLRHQQKWKDGLLEIRSVFSNLEYQGLRSSDMRPWRQHWNHQLYKALEHQYQIGLEALNENLPEINIDLTFKQGRLQFKPPFEEIRSKYYREMKRFISIPNQFKGLSEA--GEEPIFSVMSERNANGFITVFSKAEDLFRRLAATLDRFKEWVVIGQVDIDVLMNKNLHDVHDWEKNFKALKVRGKEAERLPSSIKIDCITINCNPVKSVVDDLIQTLFDSLLISLKKSIQAHLHEIDIFVTEGMEMLSSRPQTVEEIGEANMKHAQLKLRKPEILPLFKEAEDKNRLLRSVAGGGLDTIGNLRAKWDKFELMMESHQLMVKEQIEVMKEKVKSRVQIYTQEIEKFKARWDQLKPSNDLIETGEEDALVKSAQSIKEKKVEFDELEETKRKLIEDCLHFGLEAPDFFLADEIRIDIEDCTKTWSLYEEFYQGFNEKAKEDWISYRSKCYSFEEFILSWHERLRKMEEHTTMSVKLQKEIDRYKTVVPVLKYVRGEHLSQDHWLDLFRLLGLPKGTTLEKLLFGDLLRVADVIVSKASELKELNSRAQGEITIREALRELDLWGAGAIFTLTDYEDSHSRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVFVWEQKLAELDEYLQYLNQIQRKWVYLEPIFGRGALPREEARFNRVDEDFRMVI 1356          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 1251.5 bits (3237), Expect = 0.000e+0
Identity = 941/3399 (27.68%), Postives = 1667/3399 (49.04%), Query Frame = 3
Query: 2778 IDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR---TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKL---------RNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTA-------RCEELLNENNIITLKKELVKKLNIYTNA-KMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLR---LALNKIG----QTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ--VTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVK----LLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRE--CRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFS-------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT------GLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF-TGTFISDKSDR-NITVPKWI---DADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTG-SGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRD-----YLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQ---RFSVHG---TKFDK--DIWS--RELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF 12671
            I  + ++C+ +K ++       QN F  LL+ +       +  +  YL ++   + + PQ ++E+A++   +     + ++++SQI    +   +L     V    + T++ L   W  F+  +   + M+++  E  KT+++   ++F++      + +    P        S+  C  A+++I   +  +E L   +  +      F++E      L  + KD+D  QL+W   +E++   +      +L+ ++   L E      + +L         +N EI   +   ++ ID +K  +P++  +R   L + HW ++ + +  P   T E  TL  I++    + +H E I E++  A  E+ I + +  +       +  ++ Y D  ++ +   +   D+   + DNQ  L ++K SP+ + F+     WE  L+ + E ++ +  +QR+W+YLE IF     +  LP+E + F  ++  ++ IM  + ++N  L      G+   L  M   L+  QK+L+ YLE KR +FPRFYFI +DDLLEILGQS NP  ++ HLKK F  I  +   K           M S +GE V+  + VL+   VE WL ++   M+ TL + L      L+ MS++ +  +   ++  Q+L  S  I +TA         +E   +  +  +KK+ V  LN Y++A + +L+ +       LKL +L+   VH  D+ID++L   C  V  +EWL QLR Y       C+I+  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +       R +N+  +  IFIT+NP   GY GR +LPDNLK +FRP++M  PD+ LIAE+IL  +GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ +         K + Q N + E V         ++ A++   ++KLT  D   F  +++D+FP I+   ++Y  L   IE+ +K   +        K++++YE    R   ++VG + SGK+TIW+ L+    ALNK G      V+ + +NPKA+   +L G  D+ T EW+DG+L+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  DL+ ASPAT+SR GM++    +   +  V SWL+K  + +     +YL                       +  ++              F  CL+  +  +++E  R     ++ E+ +   P  +K  V  YY + K    V++  +  +   I       KI+ P + T   Q     F +      Q P +L GP G GK+ +     Q L S +  V T++ SAQTT  +V   +      +   T  VY P   +RLI +L D+N+P  D +G+   +  L+  I Y  +YD   + +       + +       GR+++S+R  S   L ++++PS+ Q+  I+   +   L+           + +VK    L+    +E+Y+ +  +F       HYLF   D+++    +LR    +   +T  S+  +  +E  R+F DRLV S     +D   F  I SE   ++    N  +     S++P   G               + LK  ++R L + S+        ++LF +   +V ++ RV+ +P G++LL G  G GR++ + L S++ + K+   ++ RGY  ++F+ D+K   + AGV+    V LL D Q  +  +LE +N++L+SGEVP LY  +E E I  +L + A E        SL N+  +R+++ LHI+L M      F    +  PA     ++ W  +W ++++L++    +      EG QL          + G   +   F+ +H +   EFS             T   Y+  +  Y  +  +K+ E+  +   ++ G+ KI E +E V ++  + A     + E Q + ++ L  I    + A E++  +   + K   E +           +L    P +++A  A+  +   D++EI++   PP ++  +++ V+++ G  + +W   +  LG+    +++  FD   I+   R+ ++++   C    F P    + S+AA  L  WV+A   Y      + P     N     L   +  + + +  + +V + +   +  +++  A    L  E +     +  A  LV  L  E  RW + +  L+ +L  L    LLA+A + YM       R+  + +W+++           F +  FL++     EW  +GL SD  S +N +++ +G   P ++DP   AT W+K+    + L++++ Q ++F   LE +V+FG  +++Q V + L+P L P+L   +   G +  ++LGDK I YNP+F+ ++ T+   P   P+  +  + VNF   + GL+ QLL   ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  LL +L  +K ++  +S+ LE S + +  +D  R+A+ P A+  S LFFV++DL +I+ MY+FSL S+  LF  +++ S+ S +   R  +L       VY Y CR++F+  +L+F+  M  C +           E+  F  G  + D+ ++ +     W+   + D    +  LA+    + S      D  WHQ+  S E E   +P   +N  S  Q++LI+++LR DR+   ++ F  + L  K   P  +++  + E +++   P++ ++SPG DP+  L +L+ +   ++ ++ +++GQGQA I   ++ +  ++G W+ L N HL  SW+P L+K +  L+   PH +FRLW+++ PH  F   +LQ+S+K+T E P G++ N+ R Y   +E   S    S +    LFSL +FH+++ ERR F+  GW   Y F+ +D      +L   + +      W+ +  L     +GG V + +D R+LS+YI  YF++  +  +  FY    L +    RD     Y   I+ L   + P  F    N D +SQ   +  +   L  LQ     S  G   T+ +K  D+ S  RE  P     +I  +G   + +  P+ L        VV   +++RYN+  L+  + +SL  L + ++G  +++ E++ +  C+   + P +W + +   +    + R L+L+ +   +WA+ +    L      L     P  FL A+ Q  AR   +S+D L +
Sbjct:  974 IQFVLLDCSHLKFALVQHCNEWQNKFTGLLSHM---ASAKLMELHGYLRDNADRVLQPPQTLEELAQSLQLYETLQSELAKVQSQIPPIHEQFAILEKYEVVVDEVLQTLASLNGAWISFQQSLIDSESMLKKSKEKFKTSLIHTAEEFKKKTHSLLEEFTAKGPFL------SSLGCEPALEQISMTREMMETLKAEENTIHLGLSMFKIEQPSSKDLRALEKDLDSLQLVWEATQEWEQRWEEWKSGSFLTLQTD--LMESTAQGLYRRLSKLSRELKEKNWEIVETS---RQRIDQFKRTMPLIADLRNPALRERHWSQVKQEVQGPFDETAEDFTLEKIVELG--LDQHVEKISEISTSATKELFIEQGLENISKTWEATLLDIMPYKDKGHHRL---RGTDDVFQALEDNQVALSTMKASPFVKAFEQDVDRWERCLSHILEVIEMILTVQRQWLYLENIFTGEDIRKQLPQESAEFDDINVSWKVIMGRLTKDNNALRGTHHPGLLEKLGEMNGVLEGIQKSLDMYLETKRHIFPRFYFISNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLKIQKAGIGSKYEAAGMFSAEGEYVDFTHPVLLEGPVEAWLCDIERTMRWTLKELLRNCRLALKKMSSKRDKWVK--EWAGQMLITSSQIQWTADVTKSLMAAKERGEKKILKIMKKKQVSMLNKYSDAIRGNLTKNLR-----LKLVALVTVEVHARDVIDKMLKSGCMDVASFEWLSQLRLYWDKDVDDCLIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGMYVIVVNCSEGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILTALSANLTRFVFEGREINLVWSCGIFITMNP---GYAGRTELPDNLKSMFRPISMVVPDSTLIAEIILFGEGFNNCKVLAKKVYTLYSLAVQQLSKQDHYDFGLRALTSLLRYSGR-------KRRLQPNLSDEEV---------LIMAMKDMNVAKLTSVDLPLFSGIMQDLFPGIETPTVDYGKLREQIEQELKLSGLQVTPFTVSKVIQLYETKTSRHSTMLVGRTCSGKTTIWRCLQGALSALNKAGDGNYNQVRDFPLNPKALSLGELYGEYDLTTNEWTDGILSSLMRTACADDRPEEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVSDLAVASPATVSRCGMVYTDHTSLGWRPYVQSWLEKHPKVNPSDPESYL----------------------RMAELW--------------FLFCLVWSVCASVDEEGRRKIDNYLREM-EGSFP--SKDTVYEYYVDPKTKNWVSFEDKLPKGWRIPTNAPFYKIVVPTVDTVRYQ-----FIVNALVSHQSPVLLVGPVGTGKTSIAQSVLQSLDSSKWAVLTVNMSAQTTTNNVQDIIESR---VEKRTKGVYVPSGGKRLITFLDDLNMPAKDTFGSQPPLELLRLWIDYGFWYDRQNQSIKYIKDMFIMAAMGPPGGGRTAISSRLQSRFNLINMTFPSESQIRRIFGTMMSQKLQDF---------DEEVKPVGDLITQATVELYNAITQRFLPTPAKIHYLFNLRDISKVFQGMLRAQRDL--HDTKQSITRLWVHECFRVFSDRLVDS-----SDADAFVAILSE---KLGSLFNLTYHNLCPSKQPPVFGDFLREPPVYEDITDFQALKTFMNRQLQEQSQRPGAGAKSLVLFTDAIQHVTRIVRVIGQPRGNMLLVGIGGSGRQSLARLASYICDYKVFQLEVTRGYRKQEFREDIKRLYRLAGVDDRPSVFLLTDTQITDESFLEDVNNILSSGEVPNLYKADEFEEIKSALSEKAREQNIPDTPESLFNFLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPQEALLEVAERYL------EGVQLGAIDG-----IQG--KVARIFVTMHRSV-AEFSHRMKLELRRHNYITPTSYLEVVSRYKSLLAEKRKELGDKATKLRNGLFKIDETREKVEKMSEQLAVARSKVAEFQKQCEEYLVIIVQQRREADEQQKTVAAHSEKIAAEEIKCKALAENAQKDLEEALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGN-EPTWAEAKRQLGESNFIKQLIHFDKDNIS--DRV-LKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRVVEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQRAGTLVTGLAGEKSRWEETVKGLDEDLGFLVGDCLLASAYLSYMGPFLSSYREGILSIWIKEVREMLVPCSAVFSLTNFLSSPTMVREWNLQGLPSDSFSSDNGVIVTRGNRWPLMVDPQGQATKWIKSMESAKGLKVIDLQMTDFMRTLEQAVQFGFPVLLQNVQEELDPSLAPILNKSVTKVGGQLQIRLGDKDIVYNPEFRFYITTKLSNPHYTPEISSQATIVNFAVKEQGLEAQLLGSVVRKERPELEEQKQSLVLNIAAGKRKLQELEDEILRLLNEATGSLLDDVQLLNTLQTSKVTATEVSEQLESSEETEEKIDTAREAYRPCAQRASLLFFVLNDLGRIDPMYQFSLDSYTDLFHLSIDKSKRSANVEERIANLNDWHTYAVYRYTCRALFERHKLLFSFQM--CAKILEVAGKLNMDEYNFFLRGGVVLDREEQMDNPCSAWLSDTNWDNITELDKLANFHGIMNSFEQYPRD--WHQWYTSPEPESACLPGEWENSCSEIQRMLIVRSLRQDRVAFCVTSFIINNLGSKFTEPPVLDMRAVVE-DSLPRSPLVFVLSPGVDPTGALLQLAEQCGMAQNFHALSLGQGQAPIATRMIKEGVKDGHWVFLANCHLSLSWMPQLDKLVEQLQIEDPHPNFRLWLSSSPHPDFPISILQASIKMTTEPPKGLRANMTRLYQLITEQQFSHCAKSSSYRRLLFSLCFFHSVLLERRKFLQLGWNIVYGFNDSDFEVSENLLSLYLDEYEET-PWEALKYLIAGVNYGGHVTDDWDRRLLSTYINDYFSEPAL--TNQFYRLSSLDTYYIPRDGPLASYKEFISLLPAADHPEAFGQHPNADIASQITEARTLFDTLLSLQPQITPSAQGGGQTREEKVLDLLSDVREKIPP----EIDYEGTCKVLSGDPNPLN-------VVLLQEIQRYNA--LLDTIRTSLNDLERGIQGLVVMSAELEEIFTCIYDARVPPLWEKAYPSLKPLAAWTRDLVLRVELFSRWAKTAHPPVLFW----LSAFTFPTGFLTAVLQSAARQNNVSVDSLSW 4218          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 1208.74 bits (3126), Expect = 0.000e+0
Identity = 920/3284 (28.01%), Postives = 1605/3284 (48.87%), Query Frame = 3
Query: 3609 LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRE-LELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDF----NKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADK--------YPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADS--TFIVHDL------KLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQS-WIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLK-KQDEHDQHLLSTYLDDFFYKSLDWI---------AKRNEFTISTSNVGTVYNGLSNLKAIKNK---------AHFSVCLIKGLGGNLNENSRETFALWVYELT------DEKT----PEMNKQ--NVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDT---QQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDS----------NLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTM----IEVYSQL-------KSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLND-VWFVTWGS--REXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQ-NHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK-------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDG-LEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS-HCCRPDLFKPQ-EWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNI---KDDDLWHQFAKSSECER-EIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKV-IGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSL-KPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKS----NRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG--NFYGK----IQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSR--ELNPV-------LNRWKILNQGLNIIKASLP-----DSLKRS----STDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIG------NLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDK-----IVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            L+ ++  +K+ IP+L  ++ E L   HW E+         +  E  TL ++   A E+ ++A+AI ++   A  E++I + ++E L+ W     F +  YI    +  S++    +I+  + DN   LQS+  S +   F +    WE  L+ + E ++    +QRKW+YLE IF     ++ LP E  +F  +D  F+ IMS+  ++  +   C  S   + L  + + L+RCQK+LN+YL+ KR+ FPRF+FI DD+LL ILG S++P  ++ H+ K++  I  + F    N +++    M S +GEV+  R  V     VE+W+  +  EM+ T          +  ++ ++ +    DK        Y   ++     + +T   E++  +     +KK   + L  Y   KM    D   T I   L      K  ++++  VH  DI+D  +  +     E+EW  QLRFY   +     ++     F Y YEY G   +LV TPLTD+ YLTLTQ + M LGG P GPAGTGKTE+ K L    G   +V NC EG+D K++G+IF GL +CG+WGCFDEFNR++ +VLS +S QIQ I++ + + ++      + + +D    IFIT+NP   GY GR +LP+++K LFRPV +  PD   I E++L S+GF  AK L +K+  ++ L+RE L+ Q HYD+GLRALK+VL  A  L        K    D  E+V        ++++ALR   L K  + D   F  LI D+FP +D   + Y +   A+EE ++E N + L  Q  K++++YE +  R   ++VGP+G GKS +   L LA  K+G   K Y +NPKA+   +L G +D  TR+W+DGVL+   R++ K  ++ +  +I+ DGD+D  W+E++NSV+DDN+LLT+ +GERI+  P+   +FE  DL  ASPAT+SR GM+F+  +          W+  +Q + +Q +LS   + +    ++ I          ++ +  +  +++  V    + L A+  K          +F   +   LG  L E  R  F  ++  L       DE       E+  Q   + +++F+ ++ + + +S    + +       ++K +  L+ T D  R       WL       ++P +L G  G  K+    +  + L +  + +++ S++TT + + + L      +   T   Y P   +RL++++ D+N+PK+D++GT Q I+ L+ ++   G YD           +L F+   G          +  GR+ + TRF S+  + ++ +PS++ L+ IY++ LK               N +V+ + + +    +E+Y  +        SKF      HY+F   DL++ V + L    P     T   ++ +   E++R+F DRLV+ +  K   G + + I   +   ++ +  D + F  + +   E +          ++   L  E L+        +Y+     ++++LF +  +++ ++ R++    G  LL G  G G+++ + L ++    ++    + RGY    F+ DL++     G+E + ++ L  D    E  +LELIN++L SG VP L+  +E E +L  ++D A + G    + S+  +F ++  + LHI+L M          C++ P       + W   W   ++    Y + N       S L  NS  P      S+ +  + + +HD+                + T ++Y++FI  Y R+ L++KN+    Q   ++ G+ K+ EA   +AEL  K AEQ  +L EK    +  L +I++    A E++   E+   +  E+N ++A  K   +  LA   P ++ A+  +  +  SD++EIR+   PP  ++ + E +L++ G  + SW S +  +      + +   D   IT+     V   L     +F+   A   S A   +  +V+A + Y    ++I P   +  +L+RN   +++ ++ ++  +S +   +    + +E    +  KL+ E +     + AA+ L+  L +E +RW   + EL      L    LL +A + Y  +   D RKE +    ++  L +       F +   LT + E   W  EGL  DELS++N ++  +    P  IDP   A  W+K   +   L+I +  D +F   LE+++++G   + Q+VD  ++PV+  +L  ++     RQ + LGDK +DY+P+FKL+L T+   P+  P        +N+T T  GL+ QLL++ +   + +LEE++ NL+QE  + K  L  +E+SLL+ELA +TGN+L+N +L+ +L +TK  +  +S+ L+ + K  + +D+ RD + P A+ G+ LFFV+S+++ +N+MY++SL+SFL +F  +L  S        R  +++  L   VY Y C  +F+  +L+F+ +M+    + D   PQ E + F    IS +  +      WI       I  L+   P ++  L     + +  W  +      E+   P    +KLS FQK+L+++  R DR+  A+S +    +  K++ P  ++   I+E +++   PI+ I+SPG+DP+ DL +L+ +   G  R   +AMGQGQ  + L LL      G WL L+N HL+  WL  LEK L  + KPH DFRLW+T +P   F   +LQ SLK+  E P G+K N+  +Y   S + +         + ++ LA+FHA++QERR F   GW   Y+F+ +D +   EIL+  + K+    +  I W  +  L    ++GGR  + FD R+L++Y+  Y  D + +     +FY       ++P   +K  ++  I  L   N+P  F L  N +                       + T+  +D+W+   EL P        ++R + + Q    I+  LP     D ++++     + + VV   +LER+N  KL+  +  SL+ L + L G   ++ E+  ++  L  GQ PN+W +      +   ++M     +      W   SE +     ++ L  L  P+++L AL Q T R     +D      +        + + + G       L++EG  +D  +   C   S   VL+  + V  V   + +     +    P+Y   +R       +V + D+   +     W+  GV L L S
Sbjct: 1262 LESKMKEFKESIPLLLDLKNEALRDRHWKELMTKTGTDFEMNPETFTLENMF--AMELHKYADAISDIVASAVKELSIEKGVKEILDTW-ENMKFTVQRYIKGTQDRGSILGTVDEILQILDDNAMNLQSISGSRFVGPFLNTVQQWEKTLSLIGEVIEVWMVVQRKWMYLESIFIGGDIRSQLPDEAKKFDNIDRIFKRIMSETVKDPVIKRCCQASNRLSDLQNLSEGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSDPTCVQEHIIKMYDNIASLKFQEGDNGEMK-ATAMVSAEGEVMPFRQVVAAEGRVEDWMTTVLQEMRRT----------NRLITKEAIFRYCEDKSRVDWMLLYQGMVVLAGNQVWWTWEVEDVFRK-----VKKGEKQALKNYAK-KMHQQIDELVTRITKPLSKNDRKKYNTVLIIDVHARDIVDIFVRDSIMDAREFEWESQLRFYWDREPDELNVRQCTGTFAYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDYKAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHHLKRFQFEGQEIALDARMGIFITMNP---GYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLQAKNLAKKMTVLYKLAREQLSKQHHYDFGLRALKSVLVMAGEL--------KRGSPDLNEDV--------VLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEEALQENNYILLPTQVDKVVQMYETMLTRHTTMVVGPTGGGKSVVINTLCLAQTKLGLVTKLYTLNPKAMSVIELYGILDPATRDWTDGVLSNIFREINKPTEKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQPHCALLFEVGDLQYASPATVSRCGMVFVDPKNLKYMPYWQKWVNNRQSKQEQSVLSKLFEKYVPHCIEMIVEGITDGKQGEKLKTIVPQTDLNMVTQLSTMLDALLEKEVDDADVLECYFIEAMYWSLGATLLETGRIKFDEYIKRLASMSAAYDESILAGPGELPYQQPTIYDFHFDGEKKKWIPWSKLVPKYIH----KPEEKFIDILVPTVDTTRT-----TWLLEQMVKIKRPVVLVGESGTSKTATTLNLLRNLNTDMLLSINFSSRTTSMDIQRNLEAN---VEKRTKDNYGPPMGKRLLVFMDDMNMPKVDEYGTQQPIALLKLLLEKGGMYDRGKELNCKYLRDLGFIAAMG---------KAGGGRNEVDTRFISLFSVFNVLFPSEESLSLIYSSILKGHTALF---------NEEVQAICDKLTFCTLELYKMIVRDLPPTPSKF------HYIFNLRDLSR-VYNGLVLTTP-ERFQTVAQMVRVWRNENLRVFHDRLVNEED-KLVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILE--------EYNESKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQAL----YAVAN-------SFLGDNSLIPSQH---SEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRL-LEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEA--ISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFE-QSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPEGTTKDAFVEAIESLPLANTPEVFGLHSNAEIG---------------------YYTQAARDMWTHLLELQPQTGESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNLGLEISPTTVVLLQELERFN--KLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPN-----VMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSFRTPEEVTERPGQGCFISGLYLEGADWD--IANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADL-YTTKHNSHWVLQGVCLTLNS 4409          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Match: Dync2h1 (dynein cytoplasmic 2 heavy chain 1 [Source:MGI Symbol;Acc:MGI:107736])

HSP 1 Score: 4514.52 bits (11708), Expect = 0.000e+0
Identity = 2339/4344 (53.84%), Postives = 3103/4344 (71.43%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF----------PNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPT-----KNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKI------PREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  +F  T+++F          P  N   VN      F D+ +  +L V+  +    FSN ++  D     LVF K  P +IT  N+++ I+V+++ E+PI+SLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++RK  +   K +  E    GI +  DE  FW +     S   ++ R +      + ++ E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L+++I     R +Q +L  L  WED Y LVKE+L   I +C  W+ +C  L  + W++Y+PH W +      + +     RL E+ ++RT+HE++   LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+L    K  R DF +R R     P+     KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  ++ L++   + QEQF+ W++E+   L DS + G+ ++   R+MEL   DG L V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +  Q     +   W++H +HQLYKALE+QY +GLEALNENLPEI VDL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  Y KAE LF+RLSA L++ KEW+++G +D+E  V+++   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC+P+K  +D LIQ +FD L+ SL+K+I+  I  +D ++T ++K+L+  PQ+++EI +  + ++     R  I     ++E  N LLRTVAGGG++TVS L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG DI+++G       + + IK+KK+E ++L +I+  L  DC HF +E   F+L   I KDI+    +W+ +EE+Q GLQ++AKEDW+++R++ YLFEEFL  W E+LR   E + MT++LQ E+D YK IIPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQN++I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF +VDEDFRSIM D+ +++RV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F+++ +HI  MKSL+GEVV  +++VL+++ VE WL +L  EMK TL   L   +   R S  +   I+   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YT+   S     +S   + +LKLK+LILD +HNIDI+ QL      +  +W W KQ+RFY KS D  C +QMVD+E  YTYEYQGNAPKLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V ++ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVIL S+GFK+AKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL   K       N T ++V     E  ++VQALR+NT+SK T+AD   F++LIKDVFP ID KE+EYD L+SA+++V +E N   +  Q KK LE+YEQLRQR GVVIVGPSG+GKST+W++LR AL KIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    +  L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   K    F + LI+GLGGNLN  SR  F   V+    E  P+ ++   ++ Y++  + +L +Y  +  E L+ D   S+  IL P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S ++ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLC+I YP ++QL  IY AYL+ VL + +  H IW  +SK+ LLA +M++VY Q+++KFTVD+YSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V        D IL + +  +W  ++ D++ D ++VTWG+         P       GK LGKLTS  LKD I +GL+ Y R+ ++LDI+LF+EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYE KQF+NDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLLASGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +NLNF++NC+SNPA  K C V W+E WS  SM KIP ML ++        ++   +  +NS  P       D + S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL++IT  MQ A+E+K E+E+L  +  EE V + +RK+ IDDEL  ++P V +A+ AV +I+   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I +E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ+ L+ NL+  E + + LE  ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E  RWN Q+ E+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD  LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN DF+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+++EESLL+ LA + GNIL NKDL+ SLN+TK SS  I  SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL SFLRLFQRAL   + S ++  R   L+  L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  ++P L+  L ++D   W  +   S CE+E P  L  K+SLFQ++L++QALRPDRLQSA++ F C  L LK LSP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL++    SE Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  ++D++     +++QW+F+HGL EN+I+GGRVDN FD+RVL SY+K++FN S++      N    F   I LP++ S  DY A+I +L + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G KFD++IWS EL+PVLN WK LNQ  N+I  K S P+  +     SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +  A++ W E +EK  LL+  LDL ELFHPDTFLNALRQ TAR    S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW  +     YS D+ ISLP+Y    R+++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVN-----NFLDDGNQMLLRVQRSEAGLAFSNTIDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSSMLESPINSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWIEQAHRGSKQISKERASYFKELFETISREFYNLDSLSLLEVVDLVETTRDVVDDVWR-QTEHDHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSHLTGQVWQRYVPHPWKSGKYFPET-LDKLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDPSGPLSGKNLSEVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRS-GLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHTTFCEKVVILMNIDLLRQQQRWKDGLQELRTGLATVAAQGFQASDMRAWRQHWNHQLYKALEHQYQVGLEALNENLPEINVDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIPQSVEEIGDTNVQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGLQDMAKEDWITYRAKIYLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYKMIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELKDLNSRAQGEVTIREALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVEAWLNDLALEMKQTLKQLLKECVTAGRSSQGA---IDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIEAQLVAKLERYTSVDTSSEDPGNSESGILELKLKALILDIIHNIDIVKQLNQVQVHTTDDWAWKKQVRFYMKS-DHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLKK------NSTKQDVN----ENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYDELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPLEYRSNLENWIGDYFSKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETPPDSHRP--MDTYYDCDRGQLASYMLKKPESLTADDF-SNGHIL-PVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAIDYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAHHVSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLASGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIVNCESNPALHKKCQVLWMEGWSDSSMKKIPEMLFSETDGEEKYEKKRKDEKKRNSVDP-------DFIKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQDASEQKTELERLKQRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRESVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLKKTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDREHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSENTEERIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYHVIDRLF-DGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQ----GSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERERVVTNIDVPC-GGNQDQWIQCGAALFLKN 4305          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Match: Dync2h1 (dynein cytoplasmic 2 heavy chain 1 [Source:MGI Symbol;Acc:MGI:107736])

HSP 1 Score: 4514.52 bits (11708), Expect = 0.000e+0
Identity = 2339/4344 (53.84%), Postives = 3103/4344 (71.43%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF----------PNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPT-----KNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKI------PREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  +F  T+++F          P  N   VN      F D+ +  +L V+  +    FSN ++  D     LVF K  P +IT  N+++ I+V+++ E+PI+SLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++RK  +   K +  E    GI +  DE  FW +     S   ++ R +      + ++ E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L+++I     R +Q +L  L  WED Y LVKE+L   I +C  W+ +C  L  + W++Y+PH W +      + +     RL E+ ++RT+HE++   LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+L    K  R DF +R R     P+     KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  ++ L++   + QEQF+ W++E+   L DS + G+ ++   R+MEL   DG L V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +  Q     +   W++H +HQLYKALE+QY +GLEALNENLPEI VDL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  Y KAE LF+RLSA L++ KEW+++G +D+E  V+++   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC+P+K  +D LIQ +FD L+ SL+K+I+  I  +D ++T ++K+L+  PQ+++EI +  + ++     R  I     ++E  N LLRTVAGGG++TVS L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG DI+++G       + + IK+KK+E ++L +I+  L  DC HF +E   F+L   I KDI+    +W+ +EE+Q GLQ++AKEDW+++R++ YLFEEFL  W E+LR   E + MT++LQ E+D YK IIPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQN++I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF +VDEDFRSIM D+ +++RV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F+++ +HI  MKSL+GEVV  +++VL+++ VE WL +L  EMK TL   L   +   R S  +   I+   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YT+   S     +S   + +LKLK+LILD +HNIDI+ QL      +  +W W KQ+RFY KS D  C +QMVD+E  YTYEYQGNAPKLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V ++ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVIL S+GFK+AKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL   K       N T ++V     E  ++VQALR+NT+SK T+AD   F++LIKDVFP ID KE+EYD L+SA+++V +E N   +  Q KK LE+YEQLRQR GVVIVGPSG+GKST+W++LR AL KIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    +  L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   K    F + LI+GLGGNLN  SR  F   V+    E  P+ ++   ++ Y++  + +L +Y  +  E L+ D   S+  IL P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S ++ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLC+I YP ++QL  IY AYL+ VL + +  H IW  +SK+ LLA +M++VY Q+++KFTVD+YSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V        D IL + +  +W  ++ D++ D ++VTWG+         P       GK LGKLTS  LKD I +GL+ Y R+ ++LDI+LF+EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYE KQF+NDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLLASGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +NLNF++NC+SNPA  K C V W+E WS  SM KIP ML ++        ++   +  +NS  P       D + S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL++IT  MQ A+E+K E+E+L  +  EE V + +RK+ IDDEL  ++P V +A+ AV +I+   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I +E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ+ L+ NL+  E + + LE  ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E  RWN Q+ E+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD  LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN DF+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+++EESLL+ LA + GNIL NKDL+ SLN+TK SS  I  SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL SFLRLFQRAL   + S ++  R   L+  L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  ++P L+  L ++D   W  +   S CE+E P  L  K+SLFQ++L++QALRPDRLQSA++ F C  L LK LSP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL++    SE Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  ++D++     +++QW+F+HGL EN+I+GGRVDN FD+RVL SY+K++FN S++      N    F   I LP++ S  DY A+I +L + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G KFD++IWS EL+PVLN WK LNQ  N+I  K S P+  +     SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +  A++ W E +EK  LL+  LDL ELFHPDTFLNALRQ TAR    S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW  +     YS D+ ISLP+Y    R+++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVN-----NFLDDGNQMLLRVQRSEAGLAFSNTIDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSSMLESPINSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWIEQAHRGSKQISKERASYFKELFETISREFYNLDSLSLLEVVDLVETTRDVVDDVWR-QTEHDHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSHLTGQVWQRYVPHPWKSGKYFPET-LDKLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDPSGPLSGKNLSEVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRS-GLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHTTFCEKVVILMNIDLLRQQQRWKDGLQELRTGLATVAAQGFQASDMRAWRQHWNHQLYKALEHQYQVGLEALNENLPEINVDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIPQSVEEIGDTNVQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGLQDMAKEDWITYRAKIYLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYKMIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELKDLNSRAQGEVTIREALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVEAWLNDLALEMKQTLKQLLKECVTAGRSSQGA---IDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIEAQLVAKLERYTSVDTSSEDPGNSESGILELKLKALILDIIHNIDIVKQLNQVQVHTTDDWAWKKQVRFYMKS-DHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLKK------NSTKQDVN----ENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYDELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPLEYRSNLENWIGDYFSKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETPPDSHRP--MDTYYDCDRGQLASYMLKKPESLTADDF-SNGHIL-PVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAIDYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAHHVSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLASGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIVNCESNPALHKKCQVLWMEGWSDSSMKKIPEMLFSETDGEEKYEKKRKDEKKRNSVDP-------DFIKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQDASEQKTELERLKQRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRESVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLKKTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDREHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSENTEERIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYHVIDRLF-DGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQ----GSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERERVVTNIDVPC-GGNQDQWIQCGAALFLKN 4305          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Match: Dync2h1 (dynein cytoplasmic 2 heavy chain 1 [Source:MGI Symbol;Acc:MGI:107736])

HSP 1 Score: 4509.9 bits (11696), Expect = 0.000e+0
Identity = 2340/4351 (53.78%), Postives = 3104/4351 (71.34%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF----------PNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPT-----KNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKI------PREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGI-------LIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  +F  T+++F          P  N   VN      F D+ +  +L V+  +    FSN ++  D     LVF K  P +IT  N+++ I+V+++ E+PI+SLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++RK  +   K +  E    GI +  DE  FW +     S   ++ R +      + ++ E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L+++I     R +Q +L  L  WED Y LVKE+L   I +C  W+ +C  L  + W++Y+PH W +      + +     RL E+ ++RT+HE++   LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+L    K  R DF +R R     P+     KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  ++ L++   + QEQF+ W++E+   L DS + G+ ++   R+MEL   DG L V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +  Q     +   W++H +HQLYKALE+QY +GLEALNENLPEI VDL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  Y KAE LF+RLSA L++ KEW+++G +D+E  V+++   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC+P+K  +D LIQ +FD L+ SL+K+I+  I  +D ++T ++K+L+  PQ+++EI +  + ++     R  I     ++E  N LLRTVAGGG++TVS L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG DI+++G       + + IK+KK+E ++L +I+  L  DC HF +E   F+L   I KDI+    +W+ +EE+Q GLQ++AKEDW+++R++ YLFEEFL  W E+LR   E + MT++LQ E+D YK IIPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQN++I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF +VDEDFRSIM D+ +++RV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F+++ +HI  MKSL+GEVV  +++VL+++ VE WL +L  EMK TL   L   +   R S  +   I+   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YT+   S     +S   + +LKLK+LILD +HNIDI+ QL      +  +W W KQ+RFY KS D  C +QMVD+E  YTYEYQGNAPKLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V ++ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVIL S+GFK+AKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL   K       N T ++V     E  ++VQALR+NT+SK T+AD   F++LIKDVFP ID KE+EYD L+SA+++V +E N   +  Q KK LE+YEQLRQR GVVIVGPSG+GKST+W++LR AL KIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    +  L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   K    F + LI+GLGGNLN  SR  F   V+    E  P+ ++   ++ Y++  + +L +Y  +  E L+ D   S+  IL P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S ++ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLC+I YP ++QL  IY AYL+ VL + +  H IW  +SK+ LLA +M++VY Q+++KFTVD+YSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V        D IL + +  +W  ++ D++ D ++VTWG+         P       GK LGKLTS  LKD I +GL+ Y R+ ++LDI+LF+EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYE KQF+NDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLLASGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +NLNF++NC+SNPA  K C V W+E WS  SM KIP ML ++        ++   +  +NS  P       D + S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL++IT  MQ A+E+K E+E+L  +  EE V + +RK+ IDDEL  ++P V +A+ AV +I+   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I +E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ+ L+ NL+  E + + LE  ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E  RWN Q+ E+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ I       + PFLIDPSS AT WLK H KD  LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN DF+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+++EESLL+ LA + GNIL NKDL+ SLN+TK SS  I  SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL SFLRLFQRAL   + S ++  R   L+  L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  ++P L+  L ++D   W  +   S CE+E P  L  K+SLFQ++L++QALRPDRLQSA++ F C  L LK LSP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL++    SE Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  ++D++     +++QW+F+HGL EN+I+GGRVDN FD+RVL SY+K++FN S++      N    F   I LP++ S  DY A+I +L + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G KFD++IWS EL+PVLN WK LNQ  N+I  K S P+  +     SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +  A++ W E +EK  LL+  LDL ELFHPDTFLNALRQ TAR    S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW  +     YS D+ ISLP+Y    R+++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVN-----NFLDDGNQMLLRVQRSEAGLAFSNTIDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSSMLESPINSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWIEQAHRGSKQISKERASYFKELFETISREFYNLDSLSLLEVVDLVETTRDVVDDVWR-QTEHDHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSHLTGQVWQRYVPHPWKSGKYFPET-LDKLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDPSGPLSGKNLSEVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRS-GLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHTTFCEKVVILMNIDLLRQQQRWKDGLQELRTGLATVAAQGFQASDMRAWRQHWNHQLYKALEHQYQVGLEALNENLPEINVDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIPQSVEEIGDTNVQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGLQDMAKEDWITYRAKIYLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYKMIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELKDLNSRAQGEVTIREALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVEAWLNDLALEMKQTLKQLLKECVTAGRSSQGA---IDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIEAQLVAKLERYTSVDTSSEDPGNSESGILELKLKALILDIIHNIDIVKQLNQVQVHTTDDWAWKKQVRFYMKS-DHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLKK------NSTKQDVN----ENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYDELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPLEYRSNLENWIGDYFSKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETPPDSHRP--MDTYYDCDRGQLASYMLKKPESLTADDF-SNGHIL-PVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAIDYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAHHVSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLASGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIVNCESNPALHKKCQVLWMEGWSDSSMKKIPEMLFSETDGEEKYEKKRKDEKKRNSVDP-------DFIKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQDASEQKTELERLKQRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRESVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLKKTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDREHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQIIGLKSWSRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSENTEERIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYHVIDRLF-DGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQ----GSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERERVVTNIDVPC-GGNQDQWIQCGAALFLKN 4312          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 984/3538 (27.81%), Postives = 1714/3538 (48.45%), Query Frame = 3
Query: 2772 IKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTV----SQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNL---------EKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEE--YQTGLQNLAKEDWLS--FRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGI-----YDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKEL-VKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDW-------IAKRNEFT--ISTSNVGTVY----NGLSNLKA----IKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ--VTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIE----VYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQY--SRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSY----FLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISE--------------AKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEK------TGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWI-DA--DRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSE-DFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFY-----GKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSST-------DSP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYY------DILRDKIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            + I  + ++C+ +K S+       QN F  LL  +     G +  + +YL ++ + +S  PQ ++E+  +         D   + +QI    +   +L        DTV      L  +W  F+ ++   + M+++  E  KT ++     F++      + ++   P    +  G T A     Q         +E   +++NL          KD +  + E +    + EI +D +++   W+Q++   +QT LQ  A E      FR    L +E+      K RN EI   T   + +I+ +K  +P++  +R   L + HW ++   +        E+ TL  I+    +  +H E I E++  A  E+ I   ++ +          +V Y D  ++ +   +E   +   + DNQ  L ++K S + + F+     WE  L+ + E ++ +  +QR+W+YLE IF     +  LP E + F +V+ ++++IM  +N++N  L      G+   L  M   L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I       V  +      + M S DGE ++  + VL+   VE+WLG++   M+ TL D L      L+   N+ +  +    +  Q++  +  I +TA   + L      + KK L V  LN Y+ A   +  + T I+  LK+ +L+   +H  D++++L       V+ ++WL QLRFY +     C+I+  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +         +N+  +  IFIT+NP   GY GR +LP+NLK +FRP+AM  PD+ LIAE+IL  +GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K + Q + + E V         ++ ++R   ++KLT  D   F ++++D+FPNI++  I+Y  L   IE+ I+E  +        K+L++YE    R   +IVG +GS K+T WK+L+ +L  + +        V+ + +NPKA+   +L G  D++T EW+DG+L+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  +L+ ASPAT+SR GM++        K  V SWL+K+ + +   L    + F  K L +       +    E++  IS   + TV     NG++   A       +  F   +I  +  +++E+ R+    ++ E+ +   P  NK  V  YY N K     ++  +  +           KI+ P   T D  R  +Y    L ++ Q P +L GP G GK+ +     Q L S Q  V  ++ SAQTT  +V   +      +   T  VY P   + +I ++ D+N+P  D +G+   +  ++  I Y  +YD   + +       + +       GR+ +S R  S   + ++++P++ Q+  I+   +   L+             +VK + N + E    VY+ +  +F       HYLF   D+++    +LR +        +++ L I  +E  R+F DRLV +   +   GIL + + + + +       +     +G           P   + L  LT   LK  ++  L +Y  S     + ++LF+E  +++ ++ RV+ +P G++LL G  G GR++ + L S + +      ++ + Y  ++F++D+K   + AGVE +    L  D Q  +  +LE IN++L+SGEVP LY ++E E I   + D A          SL  Y  +R+++ LHI+L +      F    +  PA     ++ W  +W R+++L++    I  I  + G+Q   +    +  +T   ++  Y     L+L       + T  +Y+  +  Y ++  +K+ E+  + N ++ G+ KI E              AK+ VAE + +  E   ++ +++ EAD+  K +T     A   K  +E++  +   +N       A  D E AL  P +++A  A+  +   D+ EI++   PP  +  +++ V+++ G  + +W   +  LG++   + +  FD   I+ +    ++++   C +  F P    R S+AA  L  WV+A   Y      + P     N     L+  +  + + ++ + +V + +   +K +++  A   +L  + +     +  A  LV  L  E  RW + +  L  +L  L    L+AAA + YM     + R E + Q+W+ K          +F +  FLT   +  +W  +GL SD  S EN +++ +G     +IDP   A  W+KN   ++ L+I++ Q  ++  VLE +++FG  +++Q V + L+P L P+L   +   G R ++++GDK ++YNP+F+ +L T+   P   P+  A  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L  +K ++  +++ LE S   ++++D  R+A+ P A+  S LFFV++D+ +I+ MY+FSL +++ LF  +++ S  S     R   L       VY Y CR++F+  +L+F+ HM  C +           E+  F   G  +  +   +     W+ DA  D    +  L +    + S      D  WH +  +S  E+  +P   +N  +  Q++LI+++LR DR+   ++ F    L  + + P  +N+  + E  T    P++ I+SPG DP+  L +L+     + R++ +++GQGQA I   LL +    G W+ L N HL  SW+P L+K +  L+   PH  FRLW+++ PH  F   +LQ+S+K+T E P G+K N+ R Y   +E  F   +        LF+L +FH+I+ ER+ F+  GW   Y F+ +D      +L   + +      W  +  L     +GG V + +D R+L++YI  YF D  ++ +  FY         +P   S   Y   I+ L   + P  F    N D +SQ   +  +   L  LQ   +  T+      SRE        K+L    + +K  +P+ +    T        SP  VV   +++RYN  KL+K +  SL  L K ++G  +++  ++ +  C+     P +W + +   +    + R L ++ +  E WA  +    L      L     P  FL A+ Q  AR   IS+D L +   V     SN+    K  V +  L++EG  +D      C  ++  + L+  +        +    S   M S P YY         R   V  ID+   S   D WI+ G AL +
Sbjct: 1043 LNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEM---AAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTV--GHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEES---WNQWKMGCFQT-LQTEAMESMAHGLFRRLTRLAKEY------KDRNWEIIETT---RSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMD--QHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRGTEE---VFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVK--DWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVSILNKYSEA---IRGNLTKIMR-LKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNP---GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGK-------KRRLQPDLSDEEV---------LLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI-EGSFP--NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVP---TVDTVR-YNYLVSTLVAN-QNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESR---VEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDF---------EEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWI--HECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGD------FLKEPKVYEDLVDLT--VLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYI--IGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRR---YNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVT-----ANSEKIAIEEVKCQALADN-------AQKDLEEAL--PALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN-EPTWAEAKRQLGEQNFIKSLINFDKDNISDKV---LKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHM--CAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRD--WHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDST-PRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEET-PWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCD--LSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQP-QITPTRVGGQ--SREE-------KVLELAAD-VKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYN--KLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFW----LSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRK--NSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLM 4452          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1229.93 bits (3181), Expect = 0.000e+0
Identity = 984/3544 (27.77%), Postives = 1719/3544 (48.50%), Query Frame = 3
Query: 2772 IKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTV----SQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNL---------EKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEE--YQTGLQNLAKEDWLS--FRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGI-----YDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTA---RC----EELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDW-------IAKRNEFT--ISTSNVGTVY----NGLSNLKA----IKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQ--VTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIE----VYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQY--SRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSY----FLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISE--------------AKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEK------TGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWI-DA--DRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSE-DFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFY-----GKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSST-------DSP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYY------DILRDKIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            + I  + ++C+ +K S+       QN F  LL  +     G +  + +YL ++ + +S  PQ ++E+  +         D   + +QI    +   +L        DTV      L  +W  F+ ++   + M+++  E  KT ++     F++      + ++   P    +  G T A     Q         +E   +++NL          KD +  + E +    + EI +D +++   W+Q++   +QT LQ  A E      FR    L +E+      K RN EI   T   + +I+ +K  +P++  +R   L + HW ++   +        E+ TL  I+    +  +H E I E++  A  E+ I   ++ +          +V Y D  ++ +   +E   +   + DNQ  L ++K S + + F+     WE  L+ + E ++ +  +QR+W+YLE IF     +  LP E + F +V+ ++++IM  +N++N  L      G+   L  M   L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I       V  +      + M S DGE ++  + VL+   VE+WLG++   M+ TL D L      L+   N+ +  +    +  Q++  +  I +TA   +C    +E  ++  +  +KK+ V  LN Y+ A   +  + T I+  LK+ +L+   +H  D++++L       V+ ++WL QLRFY +     C+I+  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +         +N+  +  IFIT+NP   GY GR +LP+NLK +FRP+AM  PD+ LIAE+IL  +GF N K L +K+  +++L+ + L+ Q HYD+GLRAL ++L+ A         K + Q + + E V         ++ ++R   ++KLT  D   F ++++D+FPNI++  I+Y  L   IE+ I+E  +        K+L++YE    R   +IVG +GS K+T WK+L+ +L  + +        V+ + +NPKA+   +L G  D++T EW+DG+L+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  +L+ ASPAT+SR GM++        K  V SWL+K+ + +   L    + F  K L +       +    E++  IS   + TV     NG++   A       +  F   +I  +  +++E+ R+    ++ E+ +   P  NK  V  YY N K     ++  +  +           KI+ P   T D  R  +Y    L ++ Q P +L GP G GK+ +     Q L S Q  V  ++ SAQTT  +V   +      +   T  VY P   + +I ++ D+N+P  D +G+   +  ++  I Y  +YD   + +       + +       GR+ +S R  S   + ++++P++ Q+  I+   +   L+             +VK + N + E    VY+ +  +F       HYLF   D+++    +LR +        +++ L I  +E  R+F DRLV +   +   GIL + + + + +       +     +G           P   + L  LT   LK  ++  L +Y  S     + ++LF+E  +++ ++ RV+ +P G++LL G  G GR++ + L S + +      ++ + Y  ++F++D+K   + AGVE +    L  D Q  +  +LE IN++L+SGEVP LY ++E E I   + D A          SL  Y  +R+++ LHI+L +      F    +  PA     ++ W  +W R+++L++    I  I  + G+Q   +    +  +T   ++  Y     L+L       + T  +Y+  +  Y ++  +K+ E+  + N ++ G+ KI E              AK+ VAE + +  E   ++ +++ EAD+  K +T     A   K  +E++  +   +N       A  D E AL  P +++A  A+  +   D+ EI++   PP  +  +++ V+++ G  + +W   +  LG++   + +  FD   I+ +    ++++   C +  F P    R S+AA  L  WV+A   Y      + P     N     L+  +  + + ++ + +V + +   +K +++  A   +L  + +     +  A  LV  L  E  RW + +  L  +L  L    L+AAA + YM     + R E + Q+W+ K          +F +  FLT   +  +W  +GL SD  S EN +++ +G     +IDP   A  W+KN   ++ L+I++ Q  ++  VLE +++FG  +++Q V + L+P L P+L   +   G R ++++GDK ++YNP+F+ +L T+   P   P+  A  + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L  +K ++  +++ LE S   ++++D  R+A+ P A+  S LFFV++D+ +I+ MY+FSL +++ LF  +++ S  S     R   L       VY Y CR++F+  +L+F+ HM  C +           E+  F   G  +  +   +     W+ DA  D    +  L +    + S      D  WH +  +S  E+  +P   +N  +  Q++LI+++LR DR+   ++ F    L  + + P  +N+  + E  T    P++ I+SPG DP+  L +L+     + R++ +++GQGQA I   LL +    G W+ L N HL  SW+P L+K +  L+   PH  FRLW+++ PH  F   +LQ+S+K+T E P G+K N+ R Y   +E  F   +        LF+L +FH+I+ ER+ F+  GW   Y F+ +D      +L   + +      W  +  L     +GG V + +D R+L++YI  YF D  ++ +  FY         +P   S   Y   I+ L   + P  F    N D +SQ   +  +   L  LQ   +  T+      SRE        K+L    + +K  +P+ +    T        SP  VV   +++RYN  KL+K +  SL  L K ++G  +++  ++ +  C+     P +W + +   +    + R L ++ +  E WA  +    L      L     P  FL A+ Q  AR   IS+D L +   V     SN+    K  V +  L++EG  +D      C  ++  + L+  +        +    S   M S P YY         R   V  ID+   S   D WI+ G AL +
Sbjct: 1043 LNIQFVMLDCSHLKFSLVQHCNEWQNKFTTLLKEM---AAGRLADLHSYLKDNAEKISHPPQTLEELGVSLQLMDTLQHDLPNLETQIPPIHEQFTILEKYEVPVPDTVLEMLESLNGEWLTFQQILLDSEQMLKKHKEKFKTGLIHAADDFKKKAHNLLEDFEFKGPFTSTV--GHTAALDQIAQMRAMLMAMRDEENNLRSNLGIFKIEQPVSKDLQILEKELDALQQVWEITRDWEES---WNQWKMGCFQT-LQTEAMESMAHGLFRRLTRLAKEY------KDRNWEIIETT---RSKIEQFKRTMPLISDLRNPALRERHWDQVKEEVQREFDQESESFTLEQIVKLGMD--QHVEKIAEISASATKELAIEVGLQNIAKTWDSTQLDIVPYKDKGHHRLRGTEE---VFQALEDNQVALSTMKASRFVKAFEKDVDHWERCLSLILEVIEMVLTVQRQWMYLENIFLGEDIRKQLPNESALFDQVNNNWKAIMDRMNKDNNALRSTHYPGLLETLIEMNAILEDIQKSLDMYLETKRHIFPRFYFLSNDDLLEILGQSRNPEAVQPHLKKCFDNIKLLKIQKVGGSSSKWEAVGMFSGDGEYIDFLHPVLLEGPVESWLGDVERAMRMTLRDLLRNCRVALKKFLNKRDKWVK--DWAGQVVITASQIQWTADVTKCLMTAKERSDKKILKVMKKKQVSILNKYSEA---IRGNLTKIMR-LKIVALVTIEIHARDVLEKLYKSGLMDVSSFDWLSQLRFYWEKDVDDCIIRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIYVIVVNCSEGLDYKSMGRMYSGLAQSGAWGCFDEFNRINIEVLSVVAQQILSILSALTANLTRFYFEGFEINLVWSCGIFITMNP---GYAGRTELPENLKSMFRPIAMVVPDSTLIAEIILFGEGFGNCKILAKKVYTLYSLAVQQLSRQDHYDFGLRALTSLLRYAGK-------KRRLQPDLSDEEV---------LLLSMRDMNIAKLTSVDVPLFNAIVQDLFPNIELPVIDYGKLRDTIEQEIREMGLQITPFTLTKVLQLYETKNSRHSTMIVGGTGSSKTTSWKILQASLTSLCRAGEPNYNIVREFPLNPKALSLGELYGEYDLNTNEWTDGILSSVMRVACADEKPDEKWILFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVENLAVASPATVSRCGMVYTDYVDLGWKPYVQSWLEKRPKTEVEPLQRMFEKFINKILSFKKDNCNELVPVPEYSGIISLCKLYTVLATPENGVNPADAENYSFMVEMTFVFSMIWSVCASVDEDGRKKIDSYLREI-EGSFP--NKDTVYEYYVNPKMRTWTSFEEKLPKSWRYPPNAPFYKIMVP---TVDTVR-YNYLVSTLVAN-QNPVLLVGPVGTGKTSIAQSVLQSLPSSQWSVLVVNMSAQTTSNNVQSIIESR---VEKRTKGVYVPFGGKSMITFMDDLNMPAKDMFGSQPPLELIRLWIDYGFWYDRVKQSIKHIRDMFLMAAMGPPGGGRTVISPRLQSRFNIINMTFPTESQIIRIFGTMINQKLQDF---------EEEVKPIGNVVTEATLDVYNTVVQRFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWI--HECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGD------FLKEPKVYEDLVDLT--VLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYI--IGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRR---YNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVT-----ANSEKIAIEEVKCQALADN-------AQKDLEEAL--PALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAVMILRGN-EPTWAEAKRQLGEQNFIKSLINFDKDNISDKV---LKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGNQGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHM--CAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELDKLTNFHGLMNSFEQYPRD--WHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDST-PRSPLVFILSPGVDPTSALLQLAEHTGMAHRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEET-PWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCD--LSLTTPFYRLSVLDTYYIPKDGSLASYKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQP-QITPTRVGGQ--SREE-------KVLELAAD-VKQKIPEMIDYEGTRKLLALDPSPLNVVLLQEIQRYN--KLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYPSQKPLASWTRDLAVRVEQFETWASRARPPVLFW----LSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDDSNLVYPPKDGVWVRGLYLEGAGWDRK--NSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLM 4458          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Match: sp|Q27802|DYHC2_TRIGR (Cytoplasmic dynein 2 heavy chain 1 OS=Tripneustes gratilla OX=7673 GN=DYH1B PE=2 SV=2)

HSP 1 Score: 4734.09 bits (12278), Expect = 0.000e+0
Identity = 2344/4304 (54.46%), Postives = 3159/4304 (73.40%), Query Frame = 3
Query:  192 LDKFFDNLDNNVLVVKF----IDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKP-LSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKS--VGSQSKTKNVVQ--WNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNA----EITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSA---DSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSV-EVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQ-------GILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSD--RNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG-----NFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            L+ F D+ + +VL  K      + K   SN+++ +D     + F K  P +I+PDN+ S I+  ++ ++P  +L + +  ++ P+L+ D       +PK+Q L+SEL  GL S++RK   S+    +  +    GI +  DE   W++   +  +   + R    +SF + V+ E  ++ + SL E+   +E     ++D+W+    +P YP+ RM  L+E+I +   R IQ +L     W D +  VK++L   I +C  W+  C+KL +++WK+   H WN         +S    RL EIS+LRT+HEQ+ ++L   E++E ++++ F  F  + PL YNPYTEP W+ AV ++ R I PAE  I  +L+  F+       P QLLR FQ+Y +L++R  +   ++ ERETLL QL ++ K +R+DF  R+ +   P  KN  + ++ IVW +QLEAK+ +   +   +L DL GF +F ++  + L+E+ NWRQ+QF+ W+ EM   + D  N  + L M GRLME   K+  L V+YS+RLV L+REVR L  LGY ++  +   A   QKFY   VILKQVA F+N+I  QMIP Q+ MML +A+ FE+++K+   GS+   +  VQ  W NP+EL ++I KLQ A+  + ++NR LRK H+ +C+K+V+LM IDLLRQQ +WK+ L EIR I+  +E+Q +  ++   WK H D QLYKALE+QY +GLEALNENLPEI+V+L YRQ  LQF P  EEI++KY++EMKKFI+LP  F+G+ D+  G  LI+P++IERNA+GF+  Y+ AE LF +L    + FK W++LGS+DL++ ++ H   +TD+E+NFKA+K +G+++EKLP+++K+ C+TV+ AP+K ++D  IQ +FD+LL+SLR++I  ++  ++ +L + ++ L+  PQ ++EI  A   HAE    +  +R   D++E  N LLRTVAGGG+D  +QL   W+KFELMMES Q+M++EQ+ VMK+N+ SR   F+ ++ KF+ RW   KP  ++++SG  ++CL AV+ +K+KK+E +E+   K +L  DC+HF++E   F++  ++  D DQ   MW+ +EE+  GL  L  EDW+ FRS+ Y F++FLT W EKL++     E T MT+RL K+ID YK + P+LK++  +  +Q+HW++++R+L MPR  T+E +T   IL  A  I+ +A+ +K+L  +A+GEV+IREA+REL++WG GA F L EY DS ++ + LIK+W+D+++QVGDNQ LLQSLKDSPYY+ F DKA +WE +LADLDEYLQNLNQIQRKWVYLEPIFG+ ALPKE+ RFRRVD+DFRSIM DV R+NRVLSL   SG++  L+T++DQLQRCQKALNE+LEEKRS+ PRFYFIGDDDLLEILGQS NP VI+SHLKKLF GI+ V+F++  +HI  MKSL+GEVV L   V IT EVE WLG+L  EMK+TL   L   L+D + S+ S  G++  KYPSQIL L+  I FT +CE  + +N++  L  EL ++L  YT+A +S +A   ++   V +LKLK+LILDT+H++D++  L  +N  S+  W W KQLR+Y  +  +  +++MVDAEF YTYEYQGNA KLVHTPLTDKCYLTLTQGMHMG+GGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEG+DVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQ  +K K  ++ LL+R +++D NS IFITLNPAGKGYGGRQKLPDNLK +FRPVAMSRPDN+ IAEVIL S+GFK+ K LGRKLVAIFNL++ELLTPQQHYDWGLRALKTVL+G  NLL++     + Q       VQ    E KL+VQALRVNTLSKLT++DGI F++L+KDVFP +++K+IEY  LA AI +  KE N+V ++ Q KK LE+YEQLRQRMGVV+VGPSGSGKST W++LR ALN  GQ VK Y MNPKA+PRTQLLGHID+DTREWSDGVLTYSARQVV+EPQEI SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIF+S E T++K LV SWL  Q E  ++ L+ +++D FY++L+W+ ++ +F + TS VG V NGLS+L+  +  + F++ LI+GLG NL E +R  FA  V+ +T E+ P  + + +L+ YF+E+   L TY+ +  +ELS     +   +  P+I T D+QR LD+F  WL +D +QPFIL GP+GCGK ++L HCF +L+S Q+ T+HC+AQT+P H+LQKL Q C+++++NTGRVYRPK+ E L+LYLKD+NLPK DKWGT QL++FLQQV+TY GFYD  LE+VGLDGVQIV SMN++ ++GR  LSTRFTSIVR+CSI Y  ++QL  IY+AYL+PVL R +  HP+WS  SKV +LA +MI +Y Q++SKFT+DD+SHYLFTP DLTQWVL LLRYDL  +S++T+  +LE++SYE+ R+F DRLV  +AR R D IL  T+ ++W+  ++  +LN  ++VTWG+R   ++G   P  GKSLG+L++  LK+ I +    ++RE R+LDI +F EV D+VA++DRVLT+P GS+LLAG+SGVGRRT + LV+H H  +L SP + R Y LKQFKNDLK+ +Q AGVEG  +VLLLEDHQF++PQ+LELINSLL+SGE+PGLY+ EELEP+L  ++D A+E G RG+L +Y+A RI   LH++LIMD  N +F +NCQSNPAF+K CSVQW+E WS++SM +IP +L+     +   + ++   K   +++G D +   FL++H +  V  ST R Y+ F+  Y+ +Y +KK  +E +Q H+Q G+ K++EAK +VAEL SKAA+QS LL EKQ EAD+ALKKI + M+ A E++ E+E L  +  EENV L KRK  ID+ELA IEPQV+ A+ AV  IKS  LSEIRA+RAPPDVIRDILEGVL +MG  DTSWVSM++FL KRG++EEI TFDAR+I ++ R   E+LL +   SFDP+NAKRAS+AAAPLAAWVKANVKYSYALEKI PLE EQNQLK+NLE A  +++ L KG++DVD  V  Y++ F+K   +AAKL++EL+   ETI++AE+L+ KLE E++RWN Q+ ELN EL  L  K+  AA  + Y+ SSPED+RK+K+  W +  GLE+FDMR+FL+TE EQL WK EGL SDELS+ENA++ILQ         L PFLIDPS  AT WLK H K+ +LE++NQQD+NFST LEL+VRFGKTLIIQE+D +EPVLYPLLR DLISQGPR VVQ+GDK+IDY+ DF+LF+ TRNP P++PPDA +I+S +NFTTT+AGL GQLLA T+QH KP+LE RKT LL++EE LKI+L+++EESLL+ LA A GNIL NK LL SLNKTKESS TI+QSL ESV+LQ SLD+ER A+LPLAE+GS+LFFVISDL+K+NNMYRFSL +FLRLF +AL      + + MR   LI  L+ LVYEYVC+S+FK+DRLMFALH+ H   P+ FK  EWE F G  ++D  D  ++ ++P W+D DR  A+++  +  P +   L++ D+ LW  F +SS+CE E P SL+ K+S FQ++L+IQA+RPDRLQSA++ F    L +K L+  ++NL ++ + +T+ +EPILIIISPGADP+Q+LQE++ +VIG++ Y++VAMGQGQADI + LLH+CS+NG+WLCLKNLHLVT+WLPVLEKE+N+L PH++FRLW+TAE H  F TILLQSSLKITYEAPPG+K NLLRSYD+W+ +FI +  +  RA ALF+LAWFHAI QERRNFIPQGWTKFYEFS++DLRAG +I+D++     + +Q++FI+GLFENAI+GGRVDNPFDMRVL SY+ +YFN  ++ GS         G   +P ++  +D+  ++++  D + PSFF LP NI+RSSQRIIS QVI QL+IL+R      KFD + W+ EL P+L+ WK LNQG N+I+        RS T  P+ +F+QLERYN+++LV+FVHS+L +LSKV++G+ LLT EVQ L+  LL  +TP  W  +WEGPE+P  Y++ ++ +  A++ W E ++++ LLS  L+L ELFHPDTFLNALRQ TAR  K SMD LKF CRW G+   AKY VKIG LH+EGC FDG  ++E  RDS S+  +P  SV WV K+ PN+Y   + ISLP+Y+   R+KIVT + +PC  G+QD WIQ+G ALFL++
Sbjct:   37 LNTFLDDGNCSVLSAKLNSSGGNKKVYLSNKVDPSDTGEKVIAFFKLRPDVISPDNVQSSILTVSMMDSPAGALLHAVDKVFAPLLIEDEKYNRSFNPKLQSLLSELRAGLKSLVRKQDPSQGGPVKRGDNDFAGILTPSDEFQHWSEVAMSGRNQDAKERAEHFLSFFETVSREFDVLDTLSLEEAQELVETTQDAVDDVWKQGEFDP-YPEKRMAHLLEVIGSAFGRFIQRKLGEFDLWLDPFHKVKQALLSGIAICEKWVSSCEKLTEQFWKRDPMHPWN-GAKFTPEGLSQLSKRLQEISTLRTIHEQLIRLLSKGEQEEVRLKDVFSAFSGLNPLQYNPYTEPHWRAAVSQYERAINPAERRIAIKLRSQFRNVEGN--PNQLLREFQKYKELVSRESVRKEVVSERETLLGQLQVYLKSIRDDFNVRTSESSPPTGKNLPEVVNNIVWVRQLEAKVEQTSQVADTLLNDLSGFGRFRRDAGDLLDELRNWRQDQFDSWSSEMQAAISDP-NKPLSLQMTGRLMEFETKNNELIVSYSERLVTLMREVRQLQALGYPVAAKIQHTAAIAQKFYKHGVILKQVAHFHNSIAEQMIPSQRNMMLQSALAFERIIKNPRTGSKDAGQGKVQVTWENPKELEEYITKLQAAAEKLTTENRRLRKWHYTVCDKVVSLMSIDLLRQQPRWKEGLQEIRGIMASLESQGYKSQDMKSWKMHWDRQLYKALEHQYQMGLEALNENLPEIKVELTYRQQALQFRPPIEEIRAKYYREMKKFISLPYHFRGIGDT--GEPLIYPAIIERNASGFLNVYKMAEVLFSKLEKAKDIFKNWVVLGSVDLDKLLETHLHTVTDWERNFKALKARGRDSEKLPSQVKVYCVTVSTAPVKGTIDDHIQRLFDSLLSSLRRSITESVTEIEKFLKDGMEALATMPQTVEEIGNANAKHAELEAKKPEMRPMFDRAEAKNKLLRTVAGGGVDQFTQLHAHWEKFELMMESHQLMIKEQVNVMKSNVESRVDAFRAELEKFSARWNHAKPSPEVIESGDKESCLRAVELVKEKKVEFDEMQKTKNSLIFDCKHFELEEPFFSIANDLEVDFDQQTTMWTLYEEFSNGLSVLETEDWIVFRSKTYQFDDFLTTWTEKLKSGGPDVEHTIMTVRLSKDIDKYKTVSPLLKYLSSDIFTQEHWMDLYRMLKMPRSKTVERMTFGDILATADHIVANADGLKDLFNRAKGEVSIREALRELDVWGVGACFSLTEYSDSTDHQLMLIKDWKDLVTQVGDNQSLLQSLKDSPYYKGFADKATIWEQRLADLDEYLQNLNQIQRKWVYLEPIFGRGALPKEQGRFRRVDDDFRSIMMDVARDNRVLSLVGRSGLRTTLTTLLDQLQRCQKALNEFLEEKRSILPRFYFIGDDDLLEILGQSQNPAVIQSHLKKLFAGIHSVEFDQGCKHITAMKSLEGEVVPLLKAVEITPEVEIWLGDLAKEMKSTLRKLLVDCLKD-QQSSSSGVGVDPTKYPSQILGLAAQIQFTEQCETAIRDNSLQDLLIELEQQLEGYTSADISGAAGERNAAIHVLELKLKALILDTIHSLDVVQLLQKENVTSLDNWLWQKQLRYYLDNT-KTAIMRMVDAEFQYTYEYQGNAAKLVHTPLTDKCYLTLTQGMHMGMGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGVDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQAALKQKKPKVDLLDRTIDIDPNSGIFITLNPAGKGYGGRQKLPDNLKHVFRPVAMSRPDNEQIAEVILFSEGFKDGKSLGRKLVAIFNLAKELLTPQQHYDWGLRALKTVLRGCGNLLQI----ARQQAGQDRSKVQ----EPKLVVQALRVNTLSKLTFSDGIRFDALVKDVFPGVELKDIEYMTLADAIRQHCKEHNLVVMETQVKKALELYEQLRQRMGVVVVGPSGSGKSTTWQILRAALNNTGQVVKQYTMNPKAMPRTQLLGHIDMDTREWSDGVLTYSARQVVREPQEIHSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFMSDEDTEIKDLVQSWLSHQAEESRNRLAAWIEDHFYRALEWVMRQGDFVVDTSLVGVVMNGLSHLRGAECISDFTIKLIRGLGANLPEATRMNFAKEVFHMTREQPP--DPRRILDTYFDERTGSLATYTMQDNDELSASDFNNPSSL--PVIRTPDVQRCLDFFNPWLEADNRQPFILVGPDGCGKGMVLRHCFAQLRSTQIATIHCNAQTSPTHLLQKLQQMCMVLSTNTGRVYRPKDCENLVLYLKDLNLPKPDKWGTCQLLAFLQQVLTYHGFYDDKLEWVGLDGVQIVASMNAAHTVGRHPLSTRFTSIVRICSIGYADREQLQGIYSAYLRPVLHRSLGNHPVWSSPSKVSMLAGSMISIYEQVRSKFTIDDHSHYLFTPRDLTQWVLGLLRYDLGGSSESTSEHVLEVLSYEARRLFCDRLVGEEARNRFDNILNGTLQADWNAGQILQNLNGHYYVTWGARTETSSGGSLPPAGKSLGRLSASDLKEVIKKAKKTFARENRELDIQIFHEVLDHVARVDRVLTQPRGSLLLAGRSGVGRRTAASLVAHCHRTELFSPNLSRAYGLKQFKNDLKTAMQQAGVEGNQVVLLLEDHQFIQPQFLELINSLLSSGEIPGLYSPEELEPLLAPIRDQASEEGFRGTLISYYASRILTNLHVVLIMDSKNASFAVNCQSNPAFYKSCSVQWMEGWSKESMKEIPRLLLRHHKGDTKDEGSKEDRKRHRKVSGGDEIIRNFLEIHKSSSVRHSTPRRYMTFLHTYLDVYRRKKQGVEEKQKHLQAGVAKLNEAKALVAELNSKAAKQSALLAEKQKEADEALKKIQTSMEKAGEQRREIEILKQQADEENVKLEKRKRVIDEELAEIEPQVQAAKSAVGSIKSESLSEIRAMRAPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVKEEISTFDARKINKDLREGTEQLLKKHASSFDPQNAKRASVAAAPLAAWVKANVKYSYALEKIEPLETEQNQLKKNLEKAVGRIEKLSKGLADVDHRVDEYKRRFQKLNEEAAKLKYELEKEQETIASAENLIGKLEGEYQRWNNQVSELNTELETLPKKAQCAAGFITYLTSSPEDERKQKLAEWSKLCGLERFDMRRFLSTESEQLTWKGEGLPSDELSVENAVMILQTNDMSIKSSLRPFLIDPSLRATEWLKTHLKEARLEVINQQDANFSTALELAVRFGKTLIIQEMDKIEPVLYPLLRADLISQGPRFVVQIGDKVIDYHEDFRLFMTTRNPNPEIPPDAASIISEINFTTTRAGLTGQLLAATIQHEKPELEVRKTELLKQEEDLKIQLAQLEESLLETLAKAEGNILENKALLESLNKTKESSQTITQSLVESVQLQESLDQERAAYLPLAENGSALFFVISDLAKLNNMYRFSLGAFLRLFSKALQGRMDGSSTEMRIQKLIKSLQMLVYEYVCQSLFKADRLMFALHLVHGMHPNHFKENEWEAFLGQIVADVRDSQQSGSMPSWVDQDRHKALASFMATFPSVGQSLSLTDNGLWGHFNRSSQCEHEFPTSLEKKISPFQQLLLIQAIRPDRLQSAMTFFAQRGLGMKELTTPTINLKRLCQ-DTVPSEPILIIISPGADPTQELQEVAAEVIGADHYHEVAMGQGQADIAMQLLHECSRNGEWLCLKNLHLVTAWLPVLEKEMNALSPHENFRLWLTAESHPKFPTILLQSSLKITYEAPPGIKKNLLRSYDSWTPEFIGRENNVVRAQALFALAWFHAICQERRNFIPQGWTKFYEFSMSDLRAGADIIDRLCHGKGKEVQFEFIYGLFENAIYGGRVDNPFDMRVLRSYLAQYFNKEMLGGSSARRSKKLPGGNSIPVSSYYKDFTELVSKFPDDDKPSFFGLPANIERSSQRIISVQVISQLKILRRSDEAAEKFDTEKWNTELGPILSLWKKLNQGSNLIQTKAQPPSDRSGTQGPIDSFIQLERYNALQLVQFVHSTLAALSKVIRGTSLLTSEVQALASNLLKQETPLSWQSKWEGPEDPVLYLKTIVSRTMAIQGWVEKAQRNNLLSDTLNLSELFHPDTFLNALRQQTARDSKTSMDSLKFACRWSGNISGAKYQVKIGGLHLEGCTFDGQRLSENQRDSPSVCSVPACSVAWVLKDTPNTYHASESISLPVYFTEQREKIVTHLVLPC-GGEQDHWIQTGAALFLQN 4317          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Match: sp|Q8NCM8|DYHC2_HUMAN (Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC2H1 PE=1 SV=4)

HSP 1 Score: 4532.63 bits (11755), Expect = 0.000e+0
Identity = 2338/4334 (53.95%), Postives = 3110/4334 (71.76%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFPNQNSKFVNE---ECLD--KFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVP-------PTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLL-EMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  IF  T+++F   +  +       CL+   F D+ +  +L V+  D    FSN +   D     LVF K  P +IT +N++  I+V+++ E+PISSLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++R+  +  +K +  E    GI +  DE  FW +     +   ++ R N      + +  E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L++II     R +Q +L  L  WED Y LVKESL   I +C  W+ +C+ L  + W++Y+PH W  +     + +     RL E+ ++RT+HE+    LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+LV   K  R DF +R R   +P         KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  K+ L+++  + QEQF+ W++++   L DS + G+ ++   R+MEL   DGLL V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +E Q     +   WK+H +HQLYKALE+QY +GLEALNENLPEI +DL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  + KAE LF+RLSA L++ KEWI++G +D+E  V++H   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC P+K  +D LIQ +FD L+ SL+K+I+  +  +D ++T ++++L+  PQ+++EI +A L +++  + +  I     ++E  N LLRTVAGGG++T+S L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG D++++G       + + IK+KK+E ++L + +  L  DC HF++E   F+L   I KDI+    +W+ +EE+Q G Q +A EDW++FR++ YLFEEFL  W ++LR  E  + MT++LQ E+D YK +IPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQ+ ++ LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA+LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF RVDEDFRSIM+D+ ++NRV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F++  +HI  MKSL+GEVV  +N+V +++ VE WL +L  EMK TL   L   +   R S  +   ++   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YTN   S     ++   + +LKLK+LILD +HNID++ QL      +  +W W KQLRFY KS D  C +QMVD+EF YTYEYQGNA KLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEE+VLSAVSMQIQ IQD +KN      LL + V V+ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS PDN+LIAEVIL S+GFK+AK L RKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL +++KS      N           E+ ++VQALR+NT+SK T+ D   F++LIKDVFP I++KE+EYD L++A+++V +E N   +  Q KK LE+YEQL QRMGVVIVGPSG+GKST+W++LR AL K G+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    ++ L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   ++   F + LI+GLGGNLN  SR  F   V+    E  P+ +K   ++ Y++  + RL TY  +  E+L+ D   +   +  P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S Q+ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLCSI YP ++QL  IY AYL+PVL + +  H IW  +SK+ LLA +M++VY Q+++KFTVDDYSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V +      D IL +    +W  ++ D+++D ++VTWG+R    A A P       GK LGKL S  LKD I +GL+ Y R+ ++LDI+LF EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYELKQFKNDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLL+SGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +N NF+INC+SNPA  K C V W+E WS  SM KIP ML ++    E     +   + K      D L S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL+ IT  MQ A+E+K E+E+L  +  EE V + +RK  IDDEL  ++P V +A+ AV +IK   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I++E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKAN++YS+ LE+I PLE EQ  L+ NL+  E + + LE+ ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E +RWN Q+VE+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD +LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN +F+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+K+EESLL+ LA + GNIL NKDL+ SLN+TK SS  I +SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL +FLRLFQRAL   + S ++  R  SLI+ L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  A+P L+  L  +D  LW  +  +S CE+E P  L  K+SLFQ+IL++QALRPDRLQSA++ F C  L LK +SP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL+      E Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  I+D++   + +++QW+F+HGL ENAI+GGR+DN FD+RVL SY+K++FN SV+      N    F   + LP + S  DY A+I ++ + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G+KFD++IWS EL+PVLN WK LNQ  N+I   +P    R    SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +A A++ W + +EK  LLS  LDL ELFHPDTFLNALRQ TAR +  S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW+ ++    YS D+ ISLP+Y    RD++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFIFTTTQNYFGLMSELWDQPLLCNCLEINNFLDDGNQMLLRVQRSDAGISFSNTIEFGDTKDKVLVFFKLRPEVITDENLHDNILVSSMLESPISSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRRSDTNLTKLKFKEDDTRGILTPSDEFQFWIEQAHRGNKQISKERANYFKELFETIAREFYNLDSLSLLEVVDLVETTQDVVDDVWR-QTEHDHYPESRMLHLLDIIGGSFGRFVQKKLGTLNLWEDPYYLVKESLKAGISICEQWVIVCNHLTGQVWQRYVPHPWKNEKYFPET-LDKLGKRLEEVLAIRTIHEKFLYFLPASEEKIICLTRVFEPFTGLNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLVDSIKDFRLDFENRCR--GIPGDASGPLSGKNLSEVVNSIVWVRQLELKVDDTIKIAEALLSDLPGFRCFHQSAKDLLDQLKLYEQEQFDDWSRDIQSGLSDSRS-GLCIEASSRIMELDSNDGLLKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANIAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRKLRKWHTTFCEKVVVLMNIDLLRQQQRWKDGLQELRTGLATVEAQGFQASDMHAWKQHWNHQLYKALEHQYQMGLEALNENLPEINIDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSIMIDRNASGFLTIFSKAEDLFRRLSAVLHQHKEWIVIGQVDMEALVEKHLFTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCNPVKTVIDDLIQKLFDLLVLSLKKSIQAHLHEIDTFVTEAMEVLTIMPQSVEEIGDANLQYSKLQERKPEILPLFQEAEDKNRLLRTVAGGGLETISNLKAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELEKFKARWDQLKPGDDVIETGQHNTLDKSAKLIKEKKIEFDDLEVTRKKLVDDCHHFRLEEPNFSLASSISKDIESCAQIWAFYEEFQQGFQEMANEDWITFRTKTYLFEEFLMNWHDRLRKVEEHSVMTVKLQSEVDKYKIVIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVAKAADLKDLNSRAQGEVTIREALRELDLWGVGAVFTLIDYEDSQSRTMKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAELDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNRVDEDFRSIMTDIKKDNRVTTLTTHAGIRNSLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEKSKHITAMKSLEGEVVPFKNKVPLSNNVETWLNDLALEMKKTLEQLLKECVTTGRSSQGA---VDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIETQLVNKLEQYTNIDTSSEDPGNTESGILELKLKALILDIIHNIDVVKQLNQIQVHTTEDWAWKKQLRFYMKS-DHTCCVQMVDSEFQYTYEYQGNASKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEESVLSAVSMQIQTIQDALKNHRTVCELLGKEVEVNSNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSHPDNELIAEVILYSEGFKDAKVLSRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLNKSGTTQNAN-----------ESHIVVQALRLNTMSKFTFTDCTRFDALIKDVFPGIELKEVEYDELSAALKQVFEEANYEIIPNQIKKALELYEQLCQRMGVVIVGPSGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCRDHDEFIINLIRGLGGNLNMKSRLEFTKEVFHWARESPPDFHKP--MDTYYDSTRGRLATYVLKKPEDLTADDFSNG--LTLPVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTQIATVHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCSIDYPEREQLQTIYGAYLEPVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGAKELHLFDIILTSVFQGDWGSDILDNMSDSFYVTWGARHNSGARAAPGQPLPPHGKPLGKLNSTDLKDVIKKGLIHYGRDNQNLDILLFHEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTITSLVSHMHGAVLFSPKISRGYELKQFKNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANSNFMINCESNPALHKKCQVLWMEGWSNSSMKKIPEMLFSETGGGEKYNDKKRKEEKKKNSVDPDFLKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSVLLKTKQDEADAALQMITVSMQDASEQKTELERLKHRIAEEVVKIEERKNKIDDELKEVQPLVNEAKLAVGNIKPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNISKEIRESVEELLFKNKGSFDPKNAKRASTAAAPLAAWVKANIQYSHVLERIHPLETEQAGLESNLKKTEDRKRKLEELLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLINQLDREHKRWNAQVVEITEELATLPKRAQLAAAFITYLSAAPESLRKTCLEEWTKSAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSRLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEEFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLAKLEESLLETLATSQGNILENKDLIESLNQTKASSALIQESLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLAAFLRLFQRALQNKQDSENTEQRIQSLISSLQHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQKIRDQLPSWIDQERSWAVATLKIALPSLYQTLCFEDAALWRTYYNNSMCEQEFPSILAKKVSLFQQILVVQALRPDRLQSAMALFACKTLGLKEVSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELANAERSGECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDTFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNTHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYNIIDRLFDGA-KDVQWEFVHGLLENAIYGGRIDNYFDLRVLQSYLKQFFNSSVIDVFNQRNKKSIFPYSVSLPQSCSILDYRAVIEKIPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSITAGSKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVPPPNDRQG--SPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLAWQSKWEGPEDPLQYLRGLVARALAIQNWVDKAEKQALLSETLDLSELFHPDTFLNALRQETARAVGRSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNQLSENQLDSPSVSSVLPCFMGWIPQDACGPYSPDECISLPVYTSAERDRVVTNIDVPC-GGNQDQWIQCGAALFLKN 4306          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Match: sp|Q9JJ79|DYHC2_RAT (Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Dync2h1 PE=1 SV=1)

HSP 1 Score: 4517.22 bits (11715), Expect = 0.000e+0
Identity = 2333/4338 (53.78%), Postives = 3099/4338 (71.44%), Query Frame = 3
Query:  105 IEDQRKDTIFLITKSHF---PN--QNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVP-------PTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAE-ITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLL-EMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            + D RK  +F  T+++F   P     +   N   ++ F D+ +  +L V+  D    FSN ++  D     LVF K  P +IT  N+++ I+V+++ E+PI+SLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++RK  +   K +  E    GI +  DE  FW +     S   ++ R +      + +  E   + S SL E    +E    +++D+W+ +  + +YP+SRM  L+++I     R +Q +L  L  WED Y LVKE+L   I +C  W+ +C  L  + W++Y+PH W ++     + +     RL E+ ++RT+HE++   LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+L    K  R DF +R R   +P         KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  ++ L++   + QEQF+ W++E+   L DS + G+ ++   R+MEL   DG L V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +  Q   P +   W++H +HQLYKALE+QY +GLEALNENLPEI VDL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+  +  G++ IF  +I+RNA+GF+  Y KAE LF+RLSA L++ KEW+++G +D+E  V+++   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC+P+K  +D LIQ +FD L+ SL+K+I+  I  +D ++T ++K+L+  PQ+++EI +  L ++     R  I     ++E  N LLRTVAGGG++TVS L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG DI+++G       + + IK+KK+E ++L +I+  L  DC HF +E   F+L   I KDI+    +W+ +EE+Q GLQ +AKEDW+++R++ Y+FEEFL  W E+LR  E  + MT++LQ E+D YK IIPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQN +I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF +VDEDFRSIM D+ +++RV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F+++ +HI  M+SL+GEVV  +++VL+++ VE WL +L  EMK TL   L   +   R S  +   I+   +PSQILCL+E I FT   E+ + ++++  ++ +L  KL  YT+   S     +S   + +LKLK+LILD +HNIDI+ QL      +  +W W KQ+RFY KS D  C +QMVD+E  YTYEYQGNAPKLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V V+ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVIL S+GFK+AKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL ++ KS  K   N           E  ++VQALR+NT+SK T+AD   F++LIKDVFP ID KE+EY+ L+SA+++V +E N   +  Q KK LE+YEQLRQR GVVIVGPSG+GKST+W++LR AL KIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    +  L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   K    F + LI+GLGGNLN  SR  F   V+    E  P+ ++   ++ YF+  + +L +Y  +  E L+ D   S   +  P+I T D+QR LDYFK WL+S+T+QPFIL GPEGCGK ++L + F +L+S ++ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLC++ YP ++QL  IY AYL+ VL + +  H IW  +SK+ LLA +M++VY Q+++KFTVDDYSHY FTP  LTQWVL L RYDL   S N  +  +LE+V+YE+ R+F+D++V        D IL + +  +W  ++ D++ D ++VTWG++    A   P       GK LGKL+S  LKD I +GL+ Y R+ ++LDI+LF+EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYE KQF+ DLK  L  AG+E + +VLLLED+QF+ P +LE+INSLL+SGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +NLNF+INC+SNPA  K C V W+E WS  SM KIP ML ++   EE  +  +   K K+ +   D + S+ L +H++C    +T   Y+ F+++Y  I   K+ E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL++IT  MQ A+E+K E+E+L  +  EE V + +RK+ IDDEL  ++P V +A+ AV +I+   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I +E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ+ L+ NL+  E + + LE  ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E  RWN Q+ E+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD  LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN DF+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+++EESLL+ LA + GNIL NKDL+ SLN+TK SS  I  SL+ES KLQ+SLD ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL SFLRLFQRAL   + S  +  R   L+  L+ +VYEY+CR +FK+D+LMFALH      P+ F+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  ++P L+  L  +D  LW  +   S CE+E P  L  K+SLFQ++L++QALRPDRLQSA++ F C  L LK LSP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL+     SERY+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P + FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRNFIPQGWTKFYEFS++DLRAG  ++D++   S +++QW+F+HGL EN+I+GGR+DN FD+RVL SY+K++FN S++      N    F   I LP + S  DY A+I +L + + PSFF LP NI RSSQR+ SSQVI QLRIL R    G KFD++IWS EL+PVLN WK LNQ  N+I  K S P+  +     SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +  A++ W E +EK  LL+  LDL ELFHPDTFLNALRQ TAR    S+D LKFV  W G    AK  +KI  L +EGC FDG+ ++E   DS S+  + P  +GW  +     YS D+ ISLP+Y    RD +VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    5 LSDVRKLFLFTTTQNYFGLRPELWDQTPLSNCPEVNNFLDDGNQMLLRVQRSDAGLAFSNTIDFDDTKDKVLVFFKLRPEVITDGNLHTNILVSSMLESPINSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGVVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWIEQAHRGSKQISKERASYFKELFETIAREFYNLDSLSLLEVVDLVETTRDVVDDVWR-QAEHDHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSHLTGQVWQRYVPHPWKSEKYFPET-LDRLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCR--GIPGDASGPLSGKNLSEVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRS-GLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHITFCEKVVILMNIDLLRQQQRWKDGLQELRTGLASVAAQGFQPSDMRAWRQHWNHQLYKALEHQYQMGLEALNENLPEINVDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGGA--GDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIPQSVEEIGDTNLQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLVDDCHHFGLEESNFSLAYSISKDIESCAQIWALYEEFQQGLQEMAKEDWITYRTKIYIFEEFLINWHERLRKVEEHSVMTVKLQSEVDRYKIIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASDLKDLNSRAQGEVTIREALRELDLWGVGAVFSLIDYEDSQNRTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMRSLEGEVVPFKSKVLLSNNVEAWLNDLALEMKQTLKQLLKECVTAGRSSQGA---IDPSLFPSQILCLAEQIKFTEDVEDAIRDHSLHQIEAQLAAKLERYTSVDTSSEDPGNSESGILELKLKTLILDIIHNIDIVKQLNQAQVHTTDDWAWKKQVRFYMKS-DHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRSVCELLGKEVEVNANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLKKSGTKQDVN-----------ENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYNELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPVEYRSNLENWIGDYFSKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETPPDSHRP--MDTYFDCDRGQLASYVLKKPESLTADDFSSGHSL--PVIQTPDMQRGLDYFKPWLSSETKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAVDYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDDYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEVVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAQHISGAKIAPGQPLPPHGKPLGKLSSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRTDLKHVLHLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLSSGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIINCESNPALHKKCRVLWMEGWSDSSMKKIPEMLFSEADIEEKYEKKRKDEKKKSSVD-PDFIKSFLL-IHESCKAYGATPSRYMTFLRVYSAISSSKRKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQDASEQKTELERLKHRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRESVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLKKTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDREHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKLQISLDRERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSESTEQRIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPEFFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKISLPGLYQTLCFEDGTLWRTYYHHSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELANAERSSERYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKESFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKKDNIHRAHALFSLAWFHAACQERRNFIPQGWTKFYEFSLSDLRAGYHVIDRLFDGS-KDVQWEFVHGLLENSIYGGRIDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPDSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMTSSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQ----GSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSKWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQALLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGSRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERDCVVTNIDVPC-GGNQDQWIQCGAALFLKN 4305          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Match: sp|Q45VK7|DYHC2_MOUSE (Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus OX=10090 GN=Dync2h1 PE=1 SV=1)

HSP 1 Score: 4514.52 bits (11708), Expect = 0.000e+0
Identity = 2339/4344 (53.84%), Postives = 3103/4344 (71.43%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF----------PNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPT-----KNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS--ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX----XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKI------PREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD---KSDRNITV----PKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  +F  T+++F          P  N   VN      F D+ +  +L V+  +    FSN ++  D     LVF K  P +IT  N+++ I+V+++ E+PI+SLY  ++ ++ P+LL D       DPK+Q L+SELE GLG ++RK  +   K +  E    GI +  DE  FW +     S   ++ R +      + ++ E   + S SL E    +E    +++D+W+ +T + +YP+SRM  L+++I     R +Q +L  L  WED Y LVKE+L   I +C  W+ +C  L  + W++Y+PH W +      + +     RL E+ ++RT+HE++   LP  E +   +   F+ F  + P+ YNPYTEP+WK AV ++ + I PAE  I  +LK    E   +  PQQLL+ F +Y +L+ RP IS  L+ ERETLLA+L    K  R DF +R R     P+     KN S+ ++ IVW +QLE K+++ + I   +L DL GF  F +  ++ L++   + QEQF+ W++E+   L DS + G+ ++   R+MEL   DG L V+YSDRLV L+REVR LS LG+ I   +   A+  QKF  +A+ILKQVA FYN+I+ QMI  Q+ MML +A+ FE+++K+  + S  K+ + W+NP+EL  +I KLQ A+  + ++NR LRK H   CEK+V LM IDLLRQQQ+WKD L E+R  L  +  Q     +   W++H +HQLYKALE+QY +GLEALNENLPEI VDL Y+QGRLQF P FEEI++KY++EMK+FI +PNQFKG+ ++  G++ IF  +I+RNA+GF+  Y KAE LF+RLSA L++ KEW+++G +D+E  V+++   + D+EKNFKA+K KGKE E+LP+ +K+DC+ +NC+P+K  +D LIQ +FD L+ SL+K+I+  I  +D ++T ++K+L+  PQ+++EI +  + ++     R  I     ++E  N LLRTVAGGG++TVS L+ KWDKFELMMES Q+M+++QIEVMK N+ SR + + Q++ KF  RW  LKPG DI+++G       + + IK+KK+E ++L +I+  L  DC HF +E   F+L   I KDI+    +W+ +EE+Q GLQ++AKEDW+++R++ YLFEEFL  W E+LR   E + MT++LQ E+D YK IIPILK++RGE LS DHWL++FRLL +PRG +LE L    +L  A  I+  A  +K+LN +AQGEVTIREA+REL+LWG GAVF L++Y DSQN++I LIK+W+DI++QVGDN+CLLQSLKDSPYY+ F+DK ++WE KLA LDEYLQNLN IQRKWVYLEPIFG+ ALPKE++RF +VDEDFRSIM D+ +++RV +L + +G++N L T++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQSTNP VI+SHLKKLF GI  V F+++ +HI  MKSL+GEVV  +++VL+++ VE WL +L  EMK TL   L   +   R S  +   I+   +PSQILCL+E I FT   E  + ++++  ++ +LV KL  YT+   S     +S   + +LKLK+LILD +HNIDI+ QL      +  +W W KQ+RFY KS D  C +QMVD+E  YTYEYQGNAPKLV+TPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG L GRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +KN      LL + V ++ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVIL S+GFK+AKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVL+G+ NLL   K       N T ++V     E  ++VQALR+NT+SK T+AD   F++LIKDVFP ID KE+EYD L+SA+++V +E N   +  Q KK LE+YEQLRQR GVVIVGPSG+GKST+W++LR AL KIG+ VK Y MNPKA+PR QLLGHID+DTREWSDGVLT SARQVV+EPQ++ SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+ SL+ SWL+ Q    +  L  ++ D+F K+L W+ K+N++ + TS VGTV NGLS+L   K    F + LI+GLGGNLN  SR  F   V+    E  P+ ++   ++ Y++  + +L +Y  +  E L+ D   S+  IL P+I T D+QR LDYFK WL+SDT+QPFIL GPEGCGK ++L + F +L+S ++ T+HCSAQTT  H+LQKL+Q C++I++NTGRVYRPK+ ERL+LYLKDINLPKLDKWGTS L++FLQQV+TY+GFYD NLE+VGL+ +QIV SM++   +GR  L+TRFTSIVRLC+I YP ++QL  IY AYL+ VL + +  H IW  +SK+ LLA +M++VY Q+++KFTVD+YSHY FTP  LTQWVL L RYDL   S N  +  +LEIV+YE+ R+F+D++V        D IL + +  +W  ++ D++ D ++VTWG+         P       GK LGKLTS  LKD I +GL+ Y R+ ++LDI+LF+EV + ++++DRVL+ PGGS+LLAG+SGVGRRT + LVSHMH   L SPK+ RGYE KQF+NDLK  LQ AG+E + +VLLLED+QF+ P +LE+INSLLASGEVPGLYT EELEP+L+ LKD A++ G  G + NYF  RI+  LHI+LIMD +NLNF++NC+SNPA  K C V W+E WS  SM KIP ML ++        ++   +  +NS  P       D + S+ L +H++C    +T   Y+ F+ +Y  I   KK E+  RQ+H+Q G+ K++EAK +V EL  KA EQS LL  KQ EAD AL++IT  MQ A+E+K E+E+L  +  EE V + +RK+ IDDEL  ++P V +A+ AV +I+   LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR I +E R  VEELL + K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ+ L+ NL+  E + + LE  ++ V + V+  ++ F+  T++AAKLE E+  A ETI AAE L+ +L+ E  RWN Q+ E+  EL+ L  ++ LAAA + Y+ ++PE  RK  ++ W +  GLEKFD+R+FL TE EQL WK EGL SD+LS+ENALVILQ  + PFLIDPSS AT WLK H KD  LE++NQQDSNF T LEL+VRFGKTLIIQE+DG+EPVLYPLLR DL++QGPR VVQ+GDK+IDYN DF+LFL+TRNP P +PPDA +IV+ VNFTTT++GL+GQLLALT+QH KP LEE+KT LLQ+EE  KI+L+++EESLL+ LA + GNIL NKDL+ SLN+TK SS  I  SL+ES KLQ+SLD+ERDA+LPLAE  S ++F+ISDLSKINNMYRFSL SFLRLFQRAL   + S ++  R   L+  L+ +VYEY+CR +FK+D+LMFALH      P+LF+  EW+ FTG  + D   K+D    +    P WID +R+ A++ L  ++P L+  L ++D   W  +   S CE+E P  L  K+SLFQ++L++QALRPDRLQSA++ F C  L LK LSP  +NL ++Y+ ET+  EPILIIISPGADPSQ+LQEL++    SE Y+QVAMGQGQAD+ + +L +C++NGDWLCLKNLHLV SWLPVLEKELN+L+P   FRLW+TAE H  F+ ILLQSSLKITYE+PPG+K NL+R+Y++W+ + ISK  +  RA+ALFSLAWFHA  QERRN+IPQGWTKFYEFS++DLRAG  ++D++     +++QW+F+HGL EN+I+GGRVDN FD+RVL SY+K++FN S++      N    F   I LP++ S  DY A+I +L + + PSFF LP NI RSSQR+ISSQVI QLRIL R    G KFD++IWS EL+PVLN WK LNQ  N+I  K S P+  +     SP+++F+ LE++N+I+LV+ VH SL +LSKV++G+ LL+ EVQ L+  LL  + P  W  +WEGPE+P  Y+R L+ +  A++ W E +EK  LL+  LDL ELFHPDTFLNALRQ TAR    S+D LKFV  W G    AK  +KI  L +EGC FDG  ++E   DS S+  + P  +GW  +     YS D+ ISLP+Y    R+++VT ID+PC  G QD+WIQ G ALFLK+
Sbjct:    7 DVRKLFLFTTTQNYFGLRPELWDQPPLSNCPEVN-----NFLDDGNQMLLRVQRSEAGLAFSNTIDFDDAKDKVLVFFKLRPEVITDGNLHNNILVSSMLESPINSLYQAVRQVFAPMLLKDQEWSRNFDPKLQNLLSELEAGLGIVLRKSDTNLPKLKLKEDDTRGILTPSDEFQFWIEQAHRGSKQISKERASYFKELFETISREFYNLDSLSLLEVVDLVETTRDVVDDVWR-QTEHDHYPESRMLHLLDVIGGSFGRFVQKKLGSLKLWEDPYYLVKENLKAGISICEQWVIVCSHLTGQVWQRYVPHPWKSGKYFPET-LDKLGKRLEEVLAIRTIHEKLLYFLPASEERIVCLSRVFEPFTGVNPVQYNPYTEPLWKAAVSQYEKIIAPAEQKIAGKLKNYISEIQDS--PQQLLQAFLKYKELVKRPTISKELMLERETLLARLGDSAKDFRLDFENRCRGIPGDPSGPLSGKNLSEVVNNIVWVRQLELKVDDTIKIAEALLSDLSGFRSFHRSAEDLLDQFKLYEQEQFDDWSREVQSGLSDSRS-GLCIEANSRIMELDPNDGALKVHYSDRLVILLREVRQLSALGFVIPAKIQQVANVAQKFCKQAIILKQVAHFYNSIDQQMIQSQRPMMLQSALAFEQIIKNSKAGSGGKSQITWDNPKELEGYIQKLQNAAERLATENRRLRKWHTTFCEKVVILMNIDLLRQQQRWKDGLQELRTGLATVAAQGFQASDMRAWRQHWNHQLYKALEHQYQVGLEALNENLPEINVDLTYKQGRLQFRPPFEEIRAKYYREMKRFIGIPNQFKGVGEA--GDESIFSVMIDRNASGFLTIYSKAEDLFRRLSAVLHQHKEWVVIGQVDMEALVEKNLSTVHDWEKNFKALKIKGKEVERLPSAVKVDCLNINCSPVKTVIDDLIQKLFDLLVLSLKKSIQTHIHEIDTFVTEAMKVLTVIPQSVEEIGDTNVQYSNLQDRRPEILPLFQEAEDKNRLLRTVAGGGVETVSNLRAKWDKFELMMESHQLMIKDQIEVMKGNVKSRLQIYYQELDKFKARWDQLKPGDDIIETGQQNTMDQSAKSIKEKKIEFDDLEVIRKKLVDDCHHFGLEEPNFSLAYSISKDIESCAQIWALYEEFQQGLQDMAKEDWITYRAKIYLFEEFLINWHERLRKIEEHSVMTVKLQSEVDRYKMIIPILKYVRGEHLSPDHWLDLFRLLGLPRGTSLEKLLFGDLLRVADTIVEKASELKDLNSRAQGEVTIREALRELDLWGVGAVFSLIDYEDSQNHTIKLIKDWKDIVNQVGDNRCLLQSLKDSPYYKGFEDKVSIWERKLAQLDEYLQNLNHIQRKWVYLEPIFGRGALPKEQTRFNKVDEDFRSIMMDIRKDSRVTTLTTHAGIRNTLLTILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQSTNPSVIQSHLKKLFAGINSVCFDEESKHITAMKSLEGEVVPFKSKVLLSNNVEAWLNDLALEMKQTLKQLLKECVTAGRSSQGA---IDPSLFPSQILCLAEQIKFTEDVENAIKDHSLHQIEAQLVAKLERYTSVDTSSEDPGNSESGILELKLKALILDIIHNIDIVKQLNQVQVHTTDDWAWKKQVRFYMKS-DHTCYVQMVDSELQYTYEYQGNAPKLVYTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLLGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQDALKNHRTVCELLGKEVEINANSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILYSEGFKDAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGSGNLLRQLKK------NSTKQDVN----ENHIVVQALRLNTMSKFTFADCTRFDALIKDVFPGIDFKEVEYDELSSALKQVFEEANYEVIPNQMKKALELYEQLRQRTGVVIVGPSGAGKSTLWRMLRAALCKIGKVVKQYTMNPKAMPRHQLLGHIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFVFETHDLSCASPATISRMGMIFLSDEETDLNSLIKSWLRNQPLEYRSNLENWIGDYFSKALQWVLKQNDYVVETSLVGTVMNGLSHLHGCKYHDQFIINLIRGLGGNLNMKSRLEFTKEVFNWARETPPDSHRP--MDTYYDCDRGQLASYMLKKPESLTADDF-SNGHIL-PVIQTPDMQRGLDYFKPWLSSDTKQPFILVGPEGCGKGMLLRYAFSQLRSTEIATIHCSAQTTSRHLLQKLSQTCMVISTNTGRVYRPKDCERLVLYLKDINLPKLDKWGTSTLVAFLQQVLTYQGFYDENLEWVGLENIQIVASMSAGGRLGRHKLTTRFTSIVRLCAIDYPEREQLQTIYGAYLEAVLHKNLKNHSIWGSSSKIYLLAGSMVQVYEQVRAKFTVDEYSHYFFTPCILTQWVLGLFRYDLEGGSSNHPLDYVLEIVAYEARRLFRDKIVGVKELHLFDNILTSVLQGDWGSDILDNMADSFYVTWGAHHVSGGKTAPGQPLPPHGKPLGKLTSADLKDVIKKGLIHYGRDNQNLDILLFQEVLEYMSRIDRVLSFPGGSLLLAGRSGVGRRTVTSLVSHMHGAVLFSPKISRGYEPKQFRNDLKHVLQLAGIEAQQVVLLLEDYQFVHPTFLEMINSLLASGEVPGLYTLEELEPLLLPLKDQASQDGFFGPVFNYFTYRIQQNLHIVLIMDSANLNFIVNCESNPALHKKCQVLWMEGWSDSSMKKIPEMLFSETDGEEKYEKKRKDEKKRNSVDP-------DFIKSFLL-IHESCKAYGATPSRYMTFLHVYSAISSSKKKELLKRQSHLQAGVSKLNEAKALVDELNRKAGEQSILLRIKQDEADSALQEITVSMQDASEQKTELERLKQRIAEEVVKIEERKSKIDDELKEVQPLVNEAKLAVGNIRPESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNIPKEIRESVEELLFKNKASFDPKNAKRASTAAAPLAAWVKANVQYSHVLERIQPLETEQSGLELNLKKTEDRKRKLEDLLNSVGQKVSELKEKFQSRTSEAAKLEAEVSKAQETIKAAEVLISQLDREHRRWNAQVAEIAEELATLPKRAQLAAAFITYLSAAPEGLRKNCLEEWTKAAGLEKFDLRRFLCTESEQLIWKSEGLPSDDLSIENALVILQSRVCPFLIDPSSQATEWLKTHLKDSHLEVINQQDSNFITALELAVRFGKTLIIQEMDGVEPVLYPLLRRDLVAQGPRYVVQIGDKIIDYNEDFRLFLSTRNPNPFIPPDAASIVTEVNFTTTRSGLRGQLLALTIQHEKPDLEEQKTKLLQQEEDKKIQLARLEESLLETLATSQGNILENKDLIESLNQTKASSALIQDSLKESYKLQISLDQERDAYLPLAESASKMYFIISDLSKINNMYRFSLASFLRLFQRALQNKQDSENTEERIQCLVNSLKHMVYEYICRCLFKADQLMFALHFVRGMHPELFQENEWDTFTGVVVGDMLRKADSQQRIRDQLPSWIDQERSWAVATLKISLPSLYQTLCLEDGAFWRTYYHHSMCEQEFPSILAKKVSLFQQVLVVQALRPDRLQSAMALFACKALGLKELSPLPLNLKRLYK-ETLEIEPILIIISPGADPSQELQELASAERSSECYHQVAMGQGQADLAIQMLKECARNGDWLCLKNLHLVVSWLPVLEKELNTLQPKDSFRLWLTAEVHPNFTPILLQSSLKITYESPPGLKKNLMRTYESWTPEQISKRDNIHRAHALFSLAWFHAACQERRNYIPQGWTKFYEFSLSDLRAGYHVIDRLF-DGTKDVQWEFVHGLLENSIYGGRVDNYFDLRVLQSYLKQFFNSSIIDVLNQRNKKSIFPYSISLPNSCSILDYRAVIEKLPEDDKPSFFGLPANIARSSQRMISSQVISQLRILGRSVTAGCKFDREIWSNELSPVLNLWKKLNQNSNLIHQKVSPPNDRQ----GSPILSFIILEQFNAIRLVQSVHQSLAALSKVIRGTTLLSSEVQKLASALLNQKCPLTWQSRWEGPEDPLQYLRGLVARTLAIQNWVEKAEKQVLLADTLDLSELFHPDTFLNALRQETARATGCSVDSLKFVASWKGRLQEAKLQIKISGLLLEGCSFDGNRLSENQHDSPSVSSVLPCYMGWTPQGSYGPYSPDECISLPVYTSAERERVVTNIDVPC-GGNQDQWIQCGAALFLKN 4305          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Match: sp|Q9SMH5|DYHC2_CHLRE (Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1B PE=1 SV=2)

HSP 1 Score: 3049.23 bits (7904), Expect = 0.000e+0
Identity = 1702/4353 (39.10%), Postives = 2616/4353 (60.10%), Query Frame = 3
Query:  300 ALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT-------DPKIQKLISELENGLGSIIRK--PLSKKSKYQTDETIVLGIFSIDDEIMFW---NDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSY------LENVFGLLNDIWQSETINPNYP--QSRMKTLMEIIANELVRIIQTQLNPLW------FWEDSYALVKESLTQAIEVCSHWIDMCDKLIK--RYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIF-------------------KECASAEM--PQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF-IHR---SRQGKVPPTKNASDEI-SKIVWSKQLEAKLNEILSITSNVLK-----DLDGFEKFLKETKNFLEEISN----WRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEK-LVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEM-KKFITLPNQFKGLNDSS--PGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDT------VSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNI---LSRQ-KQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILK-WIRGEGLSQDHWLEMFRLLNM----PRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDS---QNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVH---DLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCV-IQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQ--DEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLK-AIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQAC-IIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANE----SGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGI-LIPFLIDPSSNATAWLKNHFK--DRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNT-SEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLK-NKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSER-YNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFY-----GKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTD---SPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVE-KWAELSEKDELLSTI-------LDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVK----IGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQ-DKWIQSGVALFL 12986
            ++V  K     I  +++ +G+ V T++ +P+SSLY+ ++++Y P++ S T       D ++ +L+++++ GLG+ +RK  P S +     ++  +  + +  DEI FW    +S +A     +  +++  +  L+Q  E++   A E    S  +      ++     L   W  +     +   Q R    + ++   L   +Q +++ L        W   +  V+  L  A  + + W+     L++  R       H W      + +Y+ +FQ RL EI ++R + +++ +++   E     +++ F  F  +  L  + +   +WK A + F R + P E  I  +LK +F                   +  A   +  PQQ+    +RY+ L+ R  I+  L  E+ETL  Q+  H   ++ +F  HR   +   KV P    +  I  +I+W  Q   KL ++  +  ++L+     D       L+ T   + E+      +R+EQ+  W + M+  L + +N         +LM    ++  +  +++D+LV L+REVR L  LG+ + K ++   +   KFY   ++LKQ A FYN I T+M+ CQ+ MML  A++FEK L+    +Q K    + W N   L+ ++ +L + +  +  +NR LRK H ++ +K+V L G DL+R + KW   + E+R+I  ++E + +  E+   W++H D QLYKALE QY  GLE +N+ LPE+ V +V+RQ RLQ++P  EE++ ++ K++   F+ LP + KG++D S  PG    F  +++ N  G    Y  AE LF +L+  L K+++W++LG+LDL+EF D + L+++D+E NF+ +K   ++AEKLPNEI+I+C  V+ AP+K S+D  ++ + D L+ SLR+      D ++ ++ N  ++ +++   +++I  A           + +++   + ++ N LLR +AGGG D       ++++   WD F   ++ F       +E  K N+   +SRQ ++F+  +   N RWQ LKP      SG+    L  +Q+  +   EL E       L K+ E F+++  +F L+ E+  D+   +  W ++ ++      +A  DWLS R + +  E+FL +W +         + + L +EID Y   +P LK  +RG G    HW ++F LL M    P  ++ E +TL H L+ A  +++HA+ IK L+ +AQGE  IR+A+ EL++WG    F   E   S   +     LIKEWRD +++VGDNQ L+ SLK S YY  F+D+ + WENKL+ L E L  LNQIQRKWVYLEPIFG+ ALP ++ RFR VDE+FR  M+ +    +V++   + G+++ L  M  QL  CQ+AL ++LEEKRS FPRFYF+GDDDLLEILGQ+ NP VI+SHLKKLF GI  V F++D   I  M+S++GEVV+L   V IT ++E WLG+L   MK TL  Q +  L   RM+++           SQ L L E + FT + E  L   +        + KL     A++     S F  H    LK ++L+LD +H  D+ + L        TEW W +QLR+Y ++  +G V + M +A F+YT+EYQGNA KLV+TPLTDKCYLTLTQGM +G GGNPYGPAGTGKTESVKALG    RQVLVFNCDE  D KSMGRIF+GLVKCG+WGCFDEFNRL+E VLSAVS QIQ IQ  +K   + +  +++ V VD N+ IF+TLNPAGKGYGGR KLPDNLKQLFR +AM+ P+N+LIAEV+L S+GF +AK+L RKLV++F+LSRELL+PQQHYDWGLRALKTVL  A    E+  ++   Q      NV D++ E ++I++++    L  LT+ D   F++LI D+FP   + +   + L  A+ E      M   + Q  +ML+++    QR+GV+IVGPSGSGKST+W+LL  A  ++G+    Y MNPKA+PR QLLG +++DTREWSDGVLT +AR+VVKEP E +SWIICDGD+DPEWIESLNSVLDDNRLLTMP+GERIQF  NVNFIFE H L  ASPAT+SR GM+F+S EA +V+ ++  WLK Q  D  D   + ++++DFF K+  W A  +   + T+  G + +GLS+LK    +K  F   L +GLG N+N + R  F    Y      + E    +V         + L+    E  E   +D+          L++T ++ +NL     W  +  + PF++ GPEGCGK  +L++CF+++  VQV  ++CSAQT+  +V+QKL Q C   + + +G+  RP ++ R+ILYLKD+NLP+ DK+ T QLISFLQQ+I + G+YD NL+F+ ++ VQIV SM    S+GR +LSTRFT++VR+ ++ YP ++ L  IYT     + +R++      S  S   L +  M+EVYS ++ +FT +DY HY F   +L+ W+  + RY L        ++L++ +++E +R+F+DRLV  D +++   +L+ T+ S    +   +    W+ +      +   +    + K L +   +   + +   L  Y RE ++L+++LF EV + V++ DRVL++ GGS+LL G SGVGRR+  LL+++MHN+  I+PKM + Y+LK F+NDLK  L+ AGVE + ++L LEDHQ +   +LEL+NSLL+ GEVPGL+T EEL   L  L    +E    +G   S A +F+ RI+  LHI++ MD SN  F   C++NPA F  CSVQWLE WS   + +I    +        ++L ++S  P+    G D L ++ + +H +   +  T+R Y+  + +Y +IY +K+ ++  +QN ++ G+ K++EA   V  L ++A +Q  +L  KQ EAD+AL  I   M  A +R+ E+E L  +T  E V + +R+  +++EL+ ++P +  AR AV +IK  +++EIR+L+ PPD IRD+LEGVL+++G  DTSW +M+ FLGK  ++++I  +DA +IT E R +  +LL    +SF+    +R S+AAAP+A W KAN+++S  LE+++PLE+E ++L+ +LE +++ +K  E+ +  +D AVA  + +F K T++A  L+  +  A   +S+A  L+  L  E  RW   +  L  +L  L + SLLAAA + Y+PS PE+ R +  + W    G  +FD+ +FL++E E L+WK EGL +D LS +NA+VIL      P +IDPS+ A+ WLK+H +   + +E+    D  F+T LEL+VRFGKTL++ EVD +EP+LYPLLR DL  QGPR VVQ+GDK  DYN  F+LFL TRNP P LPPDA ++++  NFT T++GL+GQLL LT+Q  +P+LEE+K+ +L++E++ K+ L+++E +LLQ LA +TGNIL NKDLL  LN+TK  S T+ ++L ES  LQ SLD++R+ + P+A  GS ++F+++DL  +N MY FSL+ FL LF++AL+  +    D T R   L   L +LV+ YV RS+F +DRL F +HM+   +P LF   +W  F G  + D S      P W+  ++  A S LA+A P+L +   + D  LW Q+A  S     +P  +   K++ FQ++L+++A RPDRLQSA+S F C  L +K +SP   +L  + E ET  +EP+L I +PGADPSQ+L E + + +G ER Y +VAMGQGQA+  + LL +C++NGDWL LKN+HL  SWLP LEKEL  L+ H +FR+++T+EPH  F + LL+ SLK+T+EAPPG+K NL R+Y+ WS ++++ +G   RA  LF LAWFHA++QERR +IPQGWTKFYEFS ADLR+G +++  +  ++    QW  + GL ++AI+GGR+DNPFD +VL ++++R F+   V  +G         K+ +P+   + DY++II+ L D ++P  F +PDNIDR++Q++ S++VI QL+ +   +     F++  W  +L P+L  W  L  G + +KA++ D   R +TD   +P+  F+ LERY    LV  +  +L ++++VLKG++ L+  VQ+    LL    P  W   WEGPE P DY R ++ KA A+E  WA   +               L+L  +FHP TFLNALRQ +ART+  SMD LK V  W  + + A         +G L ++G  FDG+ ++    ++ +   +P +S+ W+ K+ P +Y+    +  P+Y    R K++ ++ +P    ++ D W+ +G++LFL
Sbjct:   79 SVVLSKLRAGPIRTEDVPAGVAVATVAHSPLSSLYHTLKDVYSPLIKSQTAEGVPVLDKRLSELLAQVQAGLGTAVRKGVPASAQEVADPNQAPLQEVVTPLDEINFWAELTNSPNAGPIKSSALQVSSALEPLRQSFEQLSSDAPEGEGGSIGWEGAKELVDLTTNALRAAWPVKLPIGGWAMGQKRADNFLRVVGAALATYVQRRVDRLAAAGRGDLWSAPFGEVRAVLVGASGLMTRWVQESTALVEDWRLGVDTGGHDWEGAAFAD-AYVRSFQERLEEIYNMREMVDELAKLVGREEAGSLGVQQVFAPFQGLQALQVSDFNTHVWKAAHEDFERRMGPIEQRISQKLKELFASVIIPSLTSAIGPGRGGDRAAAGGSLIQPQQVFAEIKRYSSLMGRKNIASALQSEKETLAKQVDRHLDSVQAEFDAHRDSATGGAKVAPVGRVTASIVERIMWCMQTLQKLGKVSEVLKHMLRGGVAGDEGSGGAALRNTLGVVSELQKEVEIFRKEQYSAWEEWMSEELGEMANW-----KNSKLMTFDSQNSHVKTHFNDQLVLLLREVRQLQSLGFGVRKDILNEVEIANKFYRYGMVLKQRANFYNNIATEMVQCQKPMMLKDALDFEKVLMNPKDAQGKE---ITWRNAAALDGYVRRLNEVADRLAEKNRTLRKWHSVLSDKVVTLAGTDLVRHKDKWAAGVKEMREIFGRLEAEGYSRESQQVWRQHWDFQLYKALEVQYLSGLEMINKTLPEVEVKMVFRQHRLQYDPPLEELRIRHVKDLLNTFLGLPLRMKGVSDLSERPG---FFRPIVDANPTGIARVYAAAESLFTQLADELKKYQDWMVLGTLDLDEFADANLLEVSDWELNFRMLKAASRDAEKLPNEIRIECYKVSLAPVKGSIDEHMKKLQDTLVASLRRKTVAEKDQIEDFMKNGRELFTRQANTVEDIGLAGQEAKGLTAKLAEVQAARRRIDEKNKLLRQMAGGGRDAAFAVVDLTEVNNSWDAFTNQLQQFDAH----LEEQKGNLAVQISRQLEEFKGKVAGMNSRWQELKPKSG--PSGNPAVVLAKIQEYANAIKELREES---AKLYKEAEAFKIDVPDFELMTEMETDVMATKAHWDRYADFLRERDEMANRDWLSMRDQVWKIEDFLAKWTKATAGKSDDPIAVILTQEIDNYTLCLPHLKSCLRGAGWEDTHWNQLFGLLGMKTSGPAAVSKETVTLTHFLEKADLVVKHADVIKSLDAQAQGEAVIRKALTELKMWGMAREFTFTESTQSVAGRQRRTPLIKEWRDAMTEVGDNQSLVASLKQSSYYNMFKDEVSSWENKLSFLQEGLTLLNQIQRKWVYLEPIFGRGALPSQQQRFRNVDEEFRRTMTSLESTKKVVTFADIPGIRDKLPQMAQQLDVCQRALADFLEEKRSQFPRFYFLGDDDLLEILGQARNPAVIQSHLKKLFAGIQKVKFSQDQSTIQAMQSMEGEVVDLAPTVRITEQIETWLGDLTRSMKNTLQQQ-NEVLCAGRMNDEFRAAA------SQCLQLKEAVAFTEKAEVALKAGS------SGLAKLVTEMRAQLMKLTGSDFTGHHLLQLKKQALVLDFIHYCDVAEYLAKDKIGGTTEWGWTRQLRYYHRA--EGSVKVAMAEATFDYTWEYQGNAAKLVYTPLTDKCYLTLTQGMALGYGGNPYGPAGTGKTESVKALGQALARQVLVFNCDEEFDFKSMGRIFVGLVKCGAWGCFDEFNRLDEEVLSAVSQQIQTIQLALKEGAKTMMFMDKTVEVDKNAGIFVTLNPAGKGYGGRSKLPDNLKQLFRSIAMTVPNNELIAEVLLLSEGFNHAKDLARKLVSLFSLSRELLSPQQHYDWGLRALKTVLGIAGR--ELRDARKAGQ------NV-DAEIEAEIIIRSVAATKLPTLTFDDNSRFKALINDLFPGAKLTDARNEALEKALAEAAAACKMELTQQQIDRMLQLHLACEQRIGVIIVGPSGSGKSTLWELLEKAYERLGRKPIVYKMNPKAMPRQQLLGSMNMDTREWSDGVLTAAARKVVKEPLEQRSWIICDGDVDPEWIESLNSVLDDNRLLTMPNGERIQFANNVNFIFECHSLEFASPATVSRCGMLFMSDEAMEVERMLQRWLKVQATDNGDPGQMQSWMNDFFDKAFQW-ALSHPRAVETTKGGILDSGLSHLKLGPGSKQEFMAGLCRGLGSNMNPDIRNQF----YNDMARMSGEGGIMDV-----GVATDPLIVLGDELRER-GMDEADGG------LVVTPEVTQNLLMMAPWFKN--RDPFLVVGPEGCGKGALLDYCFKRIMGVQVAVVNCSAQTSAANVVQKLVQVCGKPVTTTSGKALRPPDNTRVILYLKDLNLPRPDKYNTCQLISFLQQLIAHHGYYDENLDFIRVERVQIVGSMTPPGSVGRHALSTRFTALVRIVTMGYPDRENLATIYTN----MAQRVLANSKTASSVSPAAL-SKAMLEVYSSVRERFTPNDYPHYEFNARELSDWINGIQRYSL-----EGGLTLVQAIAHEGLRVFRDRLVG-DHQEQFTSMLYGTLTSLLGYKPDAT---PWYTSTLGASAEERISGDLTKIKML-RWEQDTFAELVAEKLKGYEREHKELNLLLFPEVLERVSRFDRVLSQQGGSLLLCGNSGVGRRSLMLLLAYMHNMDFITPKMTKNYDLKSFRNDLKEVLRRAGVEAKPVMLFLEDHQLVNNAFLELVNSLLSGGEVPGLFTPEELAKELAPLDKARDEDPLYTGPSNSYA-FFSYRIRRNLHIVVSMDPSNEMFRSRCEANPALFTRCSVQWLEGWSVKGLQQIAAARL--------TELVESS--PELMKLGRDKLINHMIHIHASSGSQ--TTREYLALVSLYGQIYNRKRTQVLEQQNFLKGGLGKLAEAAVTVDTLSAEAEKQRVVLKAKQAEADEALVHIQDSMLKAADRRKEVEVLKKRTAIEEVEMKERRVKVEEELSEVQPLIDAARKAVGNIKKDNIAEIRSLKMPPDAIRDVLEGVLMVLGQQDTSWNNMKTFLGKGSVKDDIINYDAHKITPEIRARCAKLLAAKGNSFEDAVIRRVSVAAAPMAQWFKANLEFSKVLERVSPLESELHRLQSSLEESQRLIKQYEEELVQLDAAVASLKAEFSKKTSEAETLKISVDKAESVLSSARQLLDGLRGEKVRWEITVGTLGEQLKELPLSSLLAAAFITYLPSHPEEHRLKVTKDWCAYLGAAEFDVTRFLSSESEMLKWKAEGLPADGLSAQNAVVILNSTSRSPLIIDPSTQASEWLKSHLRVTGQNVEVTTMADQRFTTTLELAVRFGKTLVVAEVDKVEPILYPLLRMDLDRQGPRFVVQIGDKATDYNDTFRLFLVTRNPDPYLPPDARSLLAVTNFTVTRSGLEGQLLGLTLQKERPELEEQKSTMLRQEDECKVALAELERNLLQTLATSTGNILENKDLLDKLNETKTRSATVEKALTESKTLQASLDQQREVYRPIAARGSVMYFLLADLQALNQMYTFSLSVFLNLFKKALDRDTPPGGDVTARIALLAESLLELVFAYVSRSLFNADRLTFGMHMARHLQPSLFPEAQWAFFLGKPVPD-SASPPPKPSWVREEQAGAFSALAAAFPQLVAAAELADSALWAQWA--SGATDALPGKIAGGKVNPFQQLLLVKAFRPDRLQSAMSSFICGTLNIKSVSPPPFSLKALIEGETRPDEPVLFITTPGADPSQELSEYAAQTMGKERWYFEVAMGQGQAEKAVTLLRECAKNGDWLVLKNVHLAVSWLPSLEKELLMLQKHDNFRIFLTSEPHPKFPSTLLEMSLKVTFEAPPGMKKNLQRTYEAWSAEYLA-SGPPIRAQLLFVLAWFHAVVQERRTYIPQGWTKFYEFSFADLRSGMDVI-TLATRAGTAPQWPLLLGLLDDAIYGGRLDNPFDSQVLLTFLRRLFSAETVGAAGGKVRPLPGSKVVVPTTNHRADYVSIISALPDVDTPGLFCMPDNIDRTAQQVNSARVISQLKAMSLRADAAGGFNRAQWQAQLGPLLRLWDQLMSGASALKAAMKDIRARGTTDKGGAPIENFVALERYKGASLVALIDRTLGAIARVLKGTDTLSSGVQSSGAALLADVIPGSWDAAWEGPEAPMDYCRAVVAKALAIEGHWARCQQPGGGGLLDGSGGAGPLELSSVFHPGTFLNALRQQSARTLGCSMDMLKAVTSWETAKLKAAAGGAPVALLGGLIMQGATFDGSRLSPVAAEAPAFRAVPAMSMAWLHKDSPMAYA--SYMEAPLYMTSDRSKLLARVQLPVSGPEEMDGWVLAGLSLFL 4332          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15757237 (tr|A0A1I8GFW0|A0A1I8GFW0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013490g1 PE=4 SV=1)

HSP 1 Score: 5044.94 bits (13085), Expect = 0.000e+0
Identity = 2487/4281 (58.09%), Postives = 3268/4281 (76.34%), Query Frame = 3
Query:  192 LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKI-EEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSR-QGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSV--GSQSKTKNVVQ--WNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGL-EKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASL-PDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVS-AKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            LD+F D+   ++L+      +   SN+     K  N++ F+K  P  ITPDN++S I+V++++E+P+S LY+ IQ +Y P+LL  +      DPK+Q L+++LE+G+   +RK  S KSK  +       I S  DE  +W +  S +  D  + R     +  + V+ E   ++  ++ ++   ++    +L+++W+     P YP+SRM+ LMEI  NE+VR +Q +L+ L  W ++Y++VK+SL  A++VC  W+  C++L  ++WK+Y P+ W       L+Y+  F+ RL E+ + RTVHEQ+ ++L   E+ + ++ EEAF+    + PL +NPYTEP+W+ AV KF  H+ PAE  +  +L+   ++C     PQQLL+ FQRY +L+ RP I   LL ERE LL QL +H KQLR++F+ R++  G+  P+KN  D+ ++I+W++QLE ++ EI  +  ++L DL GF+ F +    FLEE+ NWR++ F+ W  EM   +DD  N  + L+ QG+LMEL Q DG L+VNYS+RLV L+REVRTL+ LGY+I K +    D   KFY  A++LKQVA FYNTI+ QMI  Q+ MML+ A+ FE+LVKS   GS+ K    VQ  W++PEEL  +I  LQ+A++ I+  NR LRKQH +I EK+V+LMGIDLLRQQ +WK+ L EIR I+  I  Q   P+N LPW+ H D QLYKALE+QY +GLEALNENLPEIRVDL  +QGRL F P FEEIK+KY++EMKKF+ +PN FKG+++SS G  LI+PS+IERNA  F  C+ KA FLF+RL A L +FK+W++LG LDL+ FV+Q+CL+L +YEKN KA+K KG++AEKLPNEI+IDC+TVNC P+K S+DTLI N+FD+LLN+LR +IK   D  DA+LT +++ L KRPQ +DEI+EA  NHA+F K+R + +  ++ +E  N LLR VAGGG++ ++ L  KW+ FE+MMESFQMM+ EQIE+MKTN+ SR K + QD+ KF+ RW  LKPGRDILD G  + CL A++ IK+KK E  EL   + +L  DCEHFQME  EF L EE+  D+D  +L W QFE++ +GLQ+LAKEDW+SFRSRYY+FEEFL QWF++LR  E T+MT+RLQKEID YKD++P+LKW+RGE L  DHWL++FRL+++PRG TLE LT  ++L  +SEII +AEA+KELN +AQGEV+IREAIRELELWGAGA FQL +Y DS N  +SLIK+W+D++SQVGDNQC+LQSLKDSPYY+ F DKA +WE +LADLDEYLQNLN IQRKWVYLEPIFG+ ALPKE+ RF+RVD+DFR+I+ D+ R++RVLSLC+ SG++N L+TM+DQLQRCQKALNE+LE KRS+FPRFYFIGDDDLLEILGQSTNP VIK+HLKKLFQGI+DV+F++D +HI+ +KSLDGE+V LR ++L+T+EVE+WL  L +EMK TL + L   L+D++ +      ++   YPSQ+LCL+EMI FT+R E  L   ++  L+ EL K+L+ YT + M  S +   I+ +LKLK+LILD +HNID++DQL+  N +   +W W KQLRFY K  D+ C I+MVDA F YTYEYQGNAPKLVHTPLTDKCYLT+TQGM MGLG NPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDV+SMGRIFIGLVK G+WGCFDEFNRLEEAVLSAVSMQIQ+IQDGIKN++ +I LL R ++VD NS IFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDN+ IAEVIL S+GF++ KELGRKLVAIFNLS+ELLT QQHYDWGLRALKTVL+ A  L++  K  +K   N+ +E     D E +L+VQALR+NTLSKLT++D   F+SL+KDVFP +D K+IEY  LA  I EV+ EQ +V  + Q KK LEVYEQ  QRMGVVIVGPSGSGKST+WK+LR A+ K G+ VK YVMNPKA+PRTQLLG ID+DTREWSDGVLT++ARQVVKEPQE+QSWI+CDGDIDPEW+ESLNSVLDDNRLLTMP+GERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS EATD++++V SWL  Q E D+ LLS Y++D+FY ++DW+ K N++ + T+ VGTV NGLS+LK ++NKAHF++ LI+GLGGNL E +RE FA  V+ +T E  P+  +   L+ +F+ +  RL +YS   + + S   ++S K    P+ILT+ IQRNLD FK WL ++T+QPFI++GP+GCGK ++L +CF +++S+QV  LHCSAQTTP H+LQKL Q C++I+SNTGRVYRPK+ ERL+LYLKD+NLPK DKWGTSQL++FLQQV+TY GFYDSNLEFVGL+GVQIVCSMN+S+++GR  LSTRFTS+VR+CS+ YP K+QL  IY++YLK +  +++P+HP+WS +SK+  LA+TM+ ++  ++ +F+ D+ SHYLFTP DLT+WV +LLRYDLP     +A  ++E+V+YE+ R+F+DRLV SDAR R D +L + I S+WS +  D L   WFVTWGSREPQAAGAPPP QGK+LGKL+ E L   +D+GLLQYSRE +DL+I++FKEV D+VA+ DRVL +PGGS+L+AGKSGVGRR+T+LLV+HMH + +++PK+ RGY +KQFK +LK+ +Q AG++GE ++ LLED Q LE Q+LE+INSLL+SGEVPGLYT EELEP+L  L+DLA+ESG RG LAN+ A R++  LHI+LIMD  + NF I C+SNPA FK C+VQWL  WSR+SM+++ ++L+ ++ REEGS+L +   K +  L+G ++L   FL +H++ P   +T R YIN +  Y  +Y  KK++I+ ++ H++ G+ K++EAK++V ELK KAA+Q  LLTEKQ EAD+ALK+IT  M  A E++ EMEKL+ +T EEN +L KR A ID EL  + P V++A+ AV  IK+  LSEIR+LRAPPD IRDILEGVL +MG +DTSW SM+NFL +RG+ EEI+TF+AR+IT E R +VE+LL R K SFDP NAKRAS+AAAPLA W KANV+YS+ L++I PLE+EQ +LK+NL+ +E +   L+  +++VD  VAG +  F+KF+ DAAKL+ +L  ANETI AAE+LV KL+ E +RWN+Q+  +++EL  L ++SLLAAA + YMP++PEDQR  +++ W+  T + + FD+R+FLT+E EQL WK EGL SD+LS+EN +VILQ  L PFLIDPSS AT WLK H KD+KLE +NQQD+NF+T LEL+VRFGKTLIIQEVDG+EPVLYPLLR +LI+QGPR VVQLG+K+IDYNP+F+LFL TRNP P LPPDA AIV+TVNFTTT+AGL GQLLA T+QH KP+LE +K+ LL++EE LKI+L+++EESLL+ELA A GNIL NK+LL SLN+TK SS TI +SL ESV+LQ+SLDEER AFLPLAE GS L+FVI DL+KINNMYRFSL++FL LF RAL +   S   +MR  +L+  L+ LVYEYVCRS+FK+DRLMFALHMS   RPDLF+ QEWE F G  +SD      TVP WI  +R   + +L  ++PEL   L  +D +LW  F++SSECE   P  L+ +LS FQK+L IQALRPDRL +AL+QF    L+L  +SP ++NL  ++E ET + EP+L++IS G+DPSQ+LQEL+ + IGSE Y+QVAMGQGQ++I L LL  CS+ GDWLCLKNLHLVTSWLPVLEKELN L+PH  FRLW+TAEPH  F  ILLQ+SLK+TYEAPPGVK NL R+Y+ W+  F+S  GS  R+  LF+LAWFHA++QERRNFIPQGWTKFYEFS ADLRAG +I+D+++KK    I W+F++GLFENAI+GGRVDN FD+RVL SY+ + F+ + +       G I++P   + R+++  +  L ++++PS+F LP+NIDRSSQRI+SSQVI QLR+LQR  V G KFDKD+W++EL+P+LN WK LNQG  +I+A   P S   S + +P+  F+ LER+N+IKLV++VHSSL SLSKV++GS+LLT ++Q L+E LL G+TP  WL +W+GPE+P  Y+  L+ +A A++ W +    + LL++ LDL ELF PDTFLNALRQ TAR    SMD LKF C WG   +  AK + ++    +EGC FDG  +TE +RDS S+  +P V++ W+ K   + YS D  ISLP+YYD  RD++V ++D+PC SG QD+WIQ G ALFLK
Sbjct:   34 LDEFLDDGKVSLLIASEYGGRITLSNKPQDQQKQKNSVAFMKLRPDPITPDNLHSDILVSSMTESPLSCLYHSIQKLYAPMLLEGSTTTEKLDPKLQTLLTDLESGIAIALRKDSSSKSKDDSKN--FAHILSPSDEFHYWAEEASRARGDA-KDRAAVFHNIFKSVSGEYSGLSELTIADALDLVDATQDILDELWKQSETTP-YPESRMRHLMEITGNEIVRYLQNRLSSLALWTETYSVVKDSLDLAVQVCDRWLRACEQLTGQFWKRYAPNPWKGSVQ-RLTYLEKFKQRLEEVLAARTVHEQMCRLLTDSEKVDARLGEEAFESLQKVQPLNFNPYTEPLWRAAVSKFESHLAPAEARVVGKLRGQLRQCEG--RPQQLLKEFQRYKELVRRPTIGNELLAEREQLLGQLTLHAKQLRDEFVQRTQGSGRALPSKNVPDQANRILWTRQLELRMKEITDVGHSLLGDLGGFKAFSQTASTFLEELQNWRRDAFDDWASEMQSLIDDP-NKPMSLETQGQLMELRQSDGKLHVNYSERLVTLLREVRTLNSLGYEIPKKIQRVHDVASKFYRHAIVLKQVAHFYNTIDAQMIHSQKPMMLEPAMKFERLVKSPKPGSKQKGSGGVQVTWDSPEELEAYIRVLQEAANDIMGINRKLRKQHHVISEKVVDLMGIDLLRQQHRWKEGLQEIRLIMTSIAAQGVSPDNMLPWRAHWDRQLYKALEHQYRLGLEALNENLPEIRVDLTIKQGRLVFKPPFEEIKAKYYREMKKFVNIPNVFKGVSESSEG--LIYPSIIERNAEAFNNCFVKACFLFKRLEALLTRFKDWVVLGGLDLDAFVEQNCLELAEYEKNVKALKVKGRDAEKLPNEIRIDCVTVNCQPMKNSIDTLINNLFDSLLNALRLSIKRDADECDAFLTRAMETLGKRPQTVDEISEAGSNHAQFGKERPQQKGLLESAEVKNRLLRGVAGGGVEFLAPLNAKWETFEIMMESFQMMILEQIEMMKTNVESRIKAYVQDLEKFSARWNQLKPGRDILDDGDQERCLAAIKVIKEKKEEFSELEKTRESLTSDCEHFQMERPEFPLAEELKADLDTVELEWGQFEKFNSGLQDLAKEDWISFRSRYYVFEEFLGQWFDRLREEEPTSMTVRLQKEIDKYKDVLPVLKWVRGEPLGPDHWLDLFRLIHLPRGTTLERLTFGNLLSVSSEIIANAEALKELNLRAQGEVSIREAIRELELWGAGAQFQLTDYEDSHNRKVSLIKDWKDLVSQVGDNQCILQSLKDSPYYKSFADKATLWETRLADLDEYLQNLNLIQRKWVYLEPIFGRGALPKEQPRFKRVDDDFRAILQDIARDSRVLSLCNQSGLRNNLTTMLDQLQRCQKALNEFLEAKRSIFPRFYFIGDDDLLEILGQSTNPTVIKTHLKKLFQGIHDVEFDQDAKHIVAIKSLDGEIVPLRREILVTAEVESWLSKLADEMKATLRELLVNCLEDMKSARHG--ALDPSAYPSQVLCLAEMITFTSRAESTLKSGSLSNLRSELEKQLDAYTRSDMGQSGEEAAIL-ELKLKALILDMIHNIDVVDQLMAHNTRRQEDWMWQKQLRFYLKPSDKCCEIRMVDAVFEYTYEYQGNAPKLVHTPLTDKCYLTMTQGMFMGLGANPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVQSMGRIFIGLVKSGAWGCFDEFNRLEEAVLSAVSMQIQVIQDGIKNRLPKIELLGRTIDVDPNSGIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNEQIAEVILFSEGFRSGKELGRKLVAIFNLSKELLTQQQHYDWGLRALKTVLRSAGGLVKTAKKALKE--NEKLE----PDAEARLVVQALRINTLSKLTFSDCFRFDSLVKDVFPTVDFKDIEYQVLAEKIREVVAEQKLVLNENQVKKCLEVYEQTSQRMGVVIVGPSGSGKSTLWKVLRQAMIKTGKMVKQYVMNPKAMPRTQLLGSIDLDTREWSDGVLTFAARQVVKEPQEVQSWIVCDGDIDPEWVESLNSVLDDNRLLTMPNGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEATDIRAVVQSWLSDQPEKDRELLSAYIEDYFYSAVDWVLKTNDYCVDTTLVGTVLNGLSHLKGVQNKAHFAISLIRGLGGNLPEATREKFATEVFAITSESPPDSKRP--LDCFFDSEFGRLQSYSNMMDTDFSPSSIISTK---PPVILTSAIQRNLDCFKDWLQAETRQPFIITGPDGCGKGMLLQYCFDQVRSLQVAVLHCSAQTTPTHILQKLGQCCMVISSNTGRVYRPKDCERLVLYLKDVNLPKPDKWGTSQLVAFLQQVLTYNGFYDSNLEFVGLEGVQIVCSMNASTTVGRHKLSTRFTSVVRICSMGYPDKEQLQTIYSSYLKVIFDKIVPRHPVWSSSSKMHALASTMVSIFDSVRGRFSPDERSHYLFTPRDLTRWVRNLLRYDLPAL--ESAEQMMEVVAYEAFRLFRDRLVDSDARGRFDNLLGSIIRSDWSSDAIDQLQSSWFVTWGSREPQAAGAPPPPQGKTLGKLSFEDLSAVVDKGLLQYSRENKDLEIVIFKEVLDHVARADRVLCQPGGSLLMAGKSGVGRRSTALLVAHMHLMTVMTPKIARGYTVKQFKTELKAAIQKAGIDGEQVLFLLEDFQLLELQFLEMINSLLSSGEVPGLYTPEELEPLLTPLRDLASESGFRGPLANFLASRVQANLHIVLIMDFDHPNFTIRCESNPALFKQCAVQWLSDWSRESMVRVAHLLLTRVAREEGSKLRKEEPKQR-HLSGGESLLKLFLHVHESVPAVSATPRRYINLLNTYKSLYSGKKSKIQEKKEHLKAGVSKLNEAKDLVDELKRKAADQQVLLTEKQTEADEALKEITQAMSDAGEQRAEMEKLSEQTAEENKLLQKRNAEIDLELKDVMPLVEEAKKAVGSIKTESLSEIRSLRAPPDTIRDILEGVLTLMGNLDTSWQSMKNFLARRGVTEEIKTFEARKITPELRSKVEDLLRRNKASFDPVNAKRASVAAAPLAEWTKANVQYSHVLQRIQPLESEQAKLKKNLDKSEARRTQLKNALAEVDNKVAGLKDKFQKFSTDAAKLKVDLDKANETIQAAENLVSKLDGEHQRWNQQMQSMDSELDELPVRSLLAAAFICYMPAAPEDQRLSQVKTWLSATEISDHFDLRRFLTSESEQLIWKSEGLPSDDLSVENGIVILQCSLRPFLIDPSSRATDWLKTHLKDQKLEAINQQDANFTTSLELAVRFGKTLIIQEVDGVEPVLYPLLRSELIAQGPRFVVQLGEKVIDYNPEFRLFLTTRNPNPDLPPDAAAIVTTVNFTTTRAGLTGQLLAATIQHEKPELEVKKSELLKQEEDLKIKLAELEESLLEELAKAKGNILENKELLESLNQTKASSTTIQESLSESVRLQVSLDEERSAFLPLAEDGSKLYFVICDLAKINNMYRFSLSAFLSLFHRALASEGESPTPSMRIQALLTRLKHLVYEYVCRSLFKADRLMFALHMSRGMRPDLFREQEWEAFAGLIVSDA--HAGTVPGWISEERRRDVQSLMQSLPELSQELRFEDANLWRDFSRSSECENAFP--LEKRLSAFQKVLAIQALRPDRLFTALNQFAMAALDLNEISPPNVNLKVLFEKETSATEPVLVLISAGSDPSQELQELAGQTIGSENYHQVAMGQGQSEIALKLLRDCSREGDWLCLKNLHLVTSWLPVLEKELNQLRPHAQFRLWLTAEPHPKFPPILLQTSLKVTYEAPPGVKRNLSRTYETWTPQFMSLQGSVVRSCTLFALAWFHAVLQERRNFIPQGWTKFYEFSNADLRAGADIIDRLVKKHQDAIPWEFVYGLFENAIYGGRVDNVFDLRVLKSYLHQCFDPNNLTKGNRRLGPIKVPGTTNHREFVDAVATLPEFDNPSYFGLPENIDRSSQRILSSQVIGQLRVLQRVDVKGVKFDKDLWAQELSPILNLWKKLNQGHQLIQAKANPPS--HSDSANPIKTFVLLERFNAIKLVQYVHSSLASLSKVIRGSQLLTSDIQKLAEALLLGETPLNWLSRWDGPEDPLLYLHGLVGRAVALDTWLDKVMNENLLNSPLDLSELFKPDTFLNALRQQTARQAGCSMDSLKFACSWGRGGIGQAKLTAQLVGFQLEGCTFDGNQLTENSRDSPSVSAVPAVTIAWIAKTSSDVYSPDQCISLPVYYDQNRDRVVARLDLPCNSGTQDQWIQCGAALFLK 4281          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23911161 (tr|K1PYA0|K1PYA0_CRAGI Cytoplasmic dynein 2 heavy chain 1 OS=Crassostrea gigas OX=29159 GN=CGI_10003816 PE=4 SV=1)

HSP 1 Score: 4974.07 bits (12901), Expect = 0.000e+0
Identity = 2480/4339 (57.16%), Postives = 3229/4339 (74.42%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFPNQNSKFV-----NEECLDKFFDNLDNNV-LVVKFIDNK-----FIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLG-IFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNL--NLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQ----GKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKS--VGSQSKTKNV-VQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMS-LSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTS-DNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSRE-----XXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTC--PVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQ-------GILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD-KSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFN-DSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RKD I   T ++F    S        +   L+ F D  D N+ L    I+ +       FSN+L   +     +VF K SP +ITPDN+++  IV+T+ ++P+S+LY+ +Q IY P++L D       DPK+Q LISELE GLGS IRK      K + D    LG I S  DE  +W D        ++  R ++ +   + +++E   + +  + +    +E     L+D+W+    +  YP+ RMK LM++I   L R +Q +L+ +  W  ++ +VKE L   + +C  W+ +C+ L  ++WK +  H W  +  +  NL  ++N   RL EI +LR VHEQ  ++L   E+++ +  EAF  F+ + PL YNPYT P+W  AV ++ + + P E  I  +L+  FK       PQQLLR FQRY +LI RP I   ++ ERETLL QL ++ ++  +DF  R+ Q      +P  KN  + ++ IV+ +QLEAK  E +     +L DL GF KF K+ +  L+E+  WRQEQF+ W +++T R+ D   + + L+  GRLMEL+ K G L VNY DRLV L+REVR LSG+G+ +   +    +  QKFY   V+LKQVA FYNT++ QMI CQQ MML++AI FEKLVK+   GS++K +NV + W++PEEL+++I KLQKA+  + ++NR LRK H  +CEK+  LMG+DLLRQQQKWKD L EIR ++  +  Q    ++  PWK H D QLYKALE+QY +GLEALNENLPEI+V+L YRQ +LQF P FEEIK+KYF+EMK+FI++PN FKG+ D +    LIFP++I+RNA GF+ CY+KA+ LF+RL    ++FK+W  LG+LDL++FV+ +  DL D+EKNFK +K +G++AEKLP++IK+DCITVN  P+K  +D  IQ +FDALLNSLRK I   ++S+D +L ++++ LSKRPQ+++EI EA   HAEF K +  I+    K+E  N LLR+VAGGG+D++S LQ  WDKFELMMES Q+M++EQ+EVMK N+ SR K F Q++ KF+ RW  LKPG D LD G  + C  AVQ IKDK+ E  EL   +  L  DCEHF ME  +  +  E+  D+   + MW  +E++  GLQ LAKEDW+SFRS+ Y+FEEFL+ W+EKL++ E TTMT+RLQK+ID YK+++P+LKW+RGE LSQDHW+E+FRLL+MPRG TLE L   H+L+A+ EIIR+A+A+KELNQ+AQGEVTIREAIREL+LWGAGAVF L EY DS  N I LIK+W+D+++QVGDNQ LLQSLKDSPYY+ F+DKA+VWE +LADLDEYL NLNQIQRKWVYLEPIFG+ ALPKE+ RF+RVD+DFR+IM DV R+NRVLSL S +G++NLL+TM+DQLQRCQK+LNE+LEEKRSLFPRFYFIGDDDLLEILGQSTNP VI++HLKKLF GI+ V+F+ + QHI+ MKSLDGEVV L  +V I  EVE WLG L +EMK TL + L   L+D +    S   ++  KYPSQILCL+E I FT  CE  +++  +    KEL  +L  YT+  +   S+D+   V DLKLK+LILDT+H ID++ QL+    +S  EW W KQLRFY   K   C I MVDAEF YTYEYQGNA KLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKA+G LFGRQVLVFNCDEGIDVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ+IQD IKN+     LL R V++D NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS+PDN+ IAEVIL S+GFK  KELGRKLVA+FNLS+ELLTPQQHYDWGLRALKTVL+G  NLL+  K K             DS FE KL+VQALR+NTLSKLT++D   F +L+KDVFP I+ K+IEY+ LA AI  V KE N+   + Q KK LE+YEQLRQR GVV+VGPSGSGK+T+W++LR  L+K+ + VK Y MNPKA+ RTQLLG IDIDTREW+DGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+K++VTSWL  Q E +QH+LS +++D FYK++DW+ K+N+F + TS +G V NGLS+L  ++NKAHF+VCLI GLGGNLNE SRE FA  V+  T E  P+  +   L+ +++E   RL+TY+ E   +LS D   +   +  P++ T D+QR LDYF  WL  D +QPFIL GPEGCGK ++L HCF++L+S QV  +HCSAQT P HVLQKL+Q+C+++N+NTGRVYRPK+ ERL+LYLKD+NLPK DKWGT QL++FLQQVITY GFYD NLE+VGL+GVQIV SMN+ + +GR  L+TRFTSIVR+C I YP K+QL  IY AYL P+L R + +HP+W   +KV  LA +M+++Y QL+S+FTVDDYSHYLFTP DLT W LSLLRYDL   + + ++  +LEI +YE+ R+F+DR+V ++ + + D IL +T+ ++WS  + D+L+  +FVTWG+R        AAGAP P  GK LGKL ++ L   I+RGL  YSRE RDLDI++F+EV DN+A++DRVLT PGGS+L+AG+SGVGRRT  LLV+HMH + L SPK+ R Y +KQFKNDLK+ +Q AG+EGE +VLLLEDHQF+EPQ+LE+INSLL+SGEVPGLY+ EELEP+L  L+D+A+E+G RG+L N+FA RIK  LHI +IMDCSN +F +NC+SNPA +K C+VQW+E WSRDSM+K+PYML+ K P+ EG+ + +   + + +L+G + L   FL +H++C      +T R YI F+  Y  +Y  KK  +E RQ+H+Q G+ K++EAK++V ELK KA EQS LL EKQ EAD AL++IT  MQ A+++K EME+L  +  EE+ +L  RK AID ELA +EP V+ A+ AV +IK+  LSEIR+LRAPPD IRDILEGVL +MG  DTSWVSM++FL KRG++EEIQTFDAR+IT E R  VE L+ + KDSF+P  AKRAS+AA PLAAWVKANV++SY LE+I PLENEQN+L RNL+ AE +M  L++ + +VD  VA  R  FE  T +AA+L+ +L   NETI AAE LV KLE E++RW++Q+ EL+ EL  L  ++LLA+A + Y+  +PED R+  M  W E  G++ FD R+FL+TE EQL WK EGL SDELSMENALVILQ           PFLIDPSS AT WLK H KD++LE++NQQD+NF+T LEL+VRFGKTLIIQEVDG+EP+LYPLLRGDL+SQGPR VVQ+G+K IDYN +F+LFL TRNP P++PPDA +IV+ VNFTTT+AGL GQLLA T+Q+ KP+LE RKT LL+ EE LKI+L+KMEESLL+ELANA GNIL NK+LL SLNKTK SSITIS SL ESV+LQ SLD+ER+ +LPLAE GS ++FVISDL+KINNMYRFSL +FLR+FQ+AL T +  + +  R  +L   L+ LVYEYVCRS+FK+DRLMFALHM H  +P+LF+  EWE FTGT +S+ K+D    +P WID +R  A++NL +  P+L+ VLN  D  LW  F++S+ECE+E P  ++ ++SLFQ++L++QA+RPDRLQ+A+  F C  L +K LSP S+NL ++ E+ET+ +EPILIIISPGADPSQ+LQ+L+ + IG ++Y+QVAMGQGQ+DI + LL +CSQNG+WLCLKNLHLVT+WLP LEKE+N+LKPH DFRLW+TAE H  F TILLQSSLKITYEAPPGVK NL+R+Y++W+ ++ISK+GS  RA ALF+LAWFHA++QERR +IPQGWTKFYEFS++DLRAG +I+D++I K+  + +WKF+HGL+E AI+GGRVDN FD+RV+ SY++++F+ +++  G     G ++LP++ + RDY+  I +L +++ PS+F LP+NI+RS+QRIIS+QVI QL++LQR      KFDK+IW+ EL P+LN WK LNQG  +I + +     ++  ++P+++F++LE+YN+IKLV+ +H SL SLSK+++G+ LLTKEVQNL+  LL  +TP  W  +W+GPE+P  Y+R L+ +A A++ W + ++   LL   LDL +LFHPDTFLNALRQ TAR +  SMD LKF   W G    AK  VK+G L +EGC FDG  ++E  RDS S+  +PP  V W+ K+ P+ Y  DD+IS+P+Y    RD IVT++D+PC  G Q  W+Q G ALFLKS
Sbjct:    5 DSRKDYILATTANYFGLGVSDAAITALQDSTALNSFLD--DGNIDLCAGRIETRGSTKRLGFSNKLEPNESKEKVIVFFKVSPEVITPDNLHTNTIVSTMIDSPLSTLYHAVQKIYAPLMLEDGKWSRTLDPKLQSLISELEAGLGSAIRKQ-DPSFKGKGDNADNLGSILSPVDEFQYWGDMA------RSDERASQFVDLFKPISKEFGGLDTMEMMDVMELVEIAQDTLDDVWKFVDFDA-YPEPRMKHLMDVIGGSLGRYVQRKLSEVDLWTGNFGMVKEDLRSGVAICERWVGVCETLTTQFWKSFRLHPWKGEKYVPENLKQLAN---RLEEILTLRIVHEQQIRLLSSSEQKDLRTAEAFHPFMGLNPLQYNPYTMPLWNAAVAQYDKIMAPVEQKIAGKLRSQFKGLEG--YPQQLLREFQRYKELIKRPSIKKEMVSERETLLGQLNVNLRETEDDFQKRTGQRAGNKGIPKGKNLPEIVNAIVFVRQLEAKTEETIKTAETLLGDLSGFSKFRKDAQELLDELRQWRQEQFDDWTRDITDRISDP-KEPLCLETNGRLMELNHKTGKLQVNYGDRLVTLMREVRQLSGMGFAVPAKIQHVCNTAQKFYRHGVVLKQVAHFYNTLDQQMISCQQPMMLNSAIAFEKLVKNPKTGSKAKGENVEITWDDPEELDKYIHKLQKAAERLTTENRKLRKCHLTVCEKVQTLMGVDLLRQQQKWKDGLMEIRHLMANLVQQGFSSDHMRPWKAHWDRQLYKALEHQYQMGLEALNENLPEIKVELTYRQQQLQFRPPFEEIKAKYFREMKRFISIPNNFKGVGDDT--TNLIFPAIIDRNAEGFITCYRKADALFKRLETAQHQFKQWCALGALDLDQFVEDNLKDLPDWEKNFKGLKARGRDAEKLPSQIKVDCITVNTNPVKAVIDDHIQRLFDALLNSLRKAISTEVNSIDGFLKDAMETLSKRPQSVEEIGEANGKHAEFLKKKKEIQPLFMKAEAKNKLLRSVAGGGVDSLSSLQAFWDKFELMMESHQLMVKEQVEVMKNNVDSRVKAFIQEVEKFSARWHQLKPGDDALD-GDKKKCEAAVQVIKDKRQEFAELEKTRETLVHDCEHFGMELPDLEVANELKADMSNFESMWGLYEQFNNGLQELAKEDWISFRSKAYMFEEFLSSWYEKLKSEEPTTMTVRLQKDIDKYKNVLPVLKWVRGEPLSQDHWMELFRLLHMPRGTTLEKLNFGHVLNASDEIIRNADALKELNQRAQGEVTIREAIRELDLWGAGAVFTLTEYEDSNKNGIMLIKDWKDLVNQVGDNQALLQSLKDSPYYKSFEDKASVWEQRLADLDEYLHNLNQIQRKWVYLEPIFGRGALPKEQGRFKRVDDDFRNIMMDVRRDNRVLSLVSKAGLRNLLTTMLDQLQRCQKSLNEFLEEKRSLFPRFYFIGDDDLLEILGQSTNPNVIQTHLKKLFAGIHSVEFDDNAQHILAMKSLDGEVVPLLRKVKIMPEVEIWLGKLADEMKETLQELLRECLKDAKGGKGS---LDPGKYPSQILCLAEQIRFTEMCEHAISKGTLPQYNKELASQLESYTDVDLGDSSSDTQTHVLDLKLKALILDTIHAIDVVHQLMQAGTRSPDEWMWNKQLRFYMNRKGL-CSINMVDAEFEYTYEYQGNAAKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKAMGGLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQVIQDAIKNRAPMAELLGRNVDIDHNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSKPDNEQIAEVILFSEGFKAGKELGRKLVAVFNLSKELLTPQQHYDWGLRALKTVLRGCGNLLQQAKKKGAK---------VDSKFEAKLVVQALRINTLSKLTFSDCARFNALMKDVFPGIEFKDIEYEELAEAIRSVCKEANLRVNEIQIKKALELYEQLRQRTGVVVVGPSGSGKTTLWRILRQGLHKLNKEVKKYTMNPKAMHRTQLLGQIDIDTREWTDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDTDIKAVVTSWLSSQPESEQHILSGWIEDHFYKAVDWVLKQNDFVVETSLIGVVLNGLSHLHNVRNKAHFAVCLIHGLGGNLNEGSREAFAKEVFAWTQEMPPDSRRP--LDTFYDENMGRLMTYNMEATRDLSADNFTTGGSL--PVVRTGDVQRGLDYFAPWLQPDNKQPFILVGPEGCGKGMLLKHCFEQLRSTQVAVVHCSAQTNPTHVLQKLSQSCMVLNTNTGRVYRPKDCERLVLYLKDLNLPKPDKWGTCQLVAFLQQVITYNGFYDHNLEWVGLEGVQIVASMNAGTGLGRHKLTTRFTSIVRICCIGYPDKEQLQAIYGAYLTPILNRQLGRHPVWGNPAKVYALAGSMVQLYEQLRSRFTVDDYSHYLFTPRDLTNWCLSLLRYDLNAGAKEGSSDHVLEIWAYEARRLFRDRVVGTEGQNKFDSILMSTVRADWSANIFDNLDTDYFVTWGARHEDGGPAVAAGAPLPSTGKPLGKLNTDDLTAVIERGLKLYSRENRDLDILIFREVLDNIARVDRVLTLPGGSLLMAGRSGVGRRTAVLLVAHMHQMHLFSPKVSRAYGMKQFKNDLKTVMQLAGIEGEQVVLLLEDHQFVEPQFLEMINSLLSSGEVPGLYSPEELEPLLSPLRDMASEAGFRGTLINFFASRIKTNLHIAMIMDCSNNSFTLNCESNPALYKECAVQWMESWSRDSMVKVPYMLLTKPPKIEGASIGEKK-RHQRKLSGGEELLKCFLHVHESCIQANMGATPRRYIAFLNTYQTVYSNKKAGVEKRQHHLQAGVSKLNEAKQLVDELKRKAGEQSVLLAEKQAEADTALREITISMQNASDQKNEMEELKRQAAEEDKVLQTRKKAIDRELAEVEPLVQAAKSAVGNIKTESLSEIRSLRAPPDTIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVKEEIQTFDARKITPEIRKGVEALIRKSKDSFEPAAAKRASVAAEPLAAWVKANVQFSYVLERIEPLENEQNELIRNLKKAESRMDKLKRALDEVDAKVASLRNRFETLTKEAAELKIKLDKENETIQAAETLVTKLEGEYQRWSRQVGELSDELKELPKRALLASAFITYLAQAPEDVRRNFMNTWSEALGVQHFDCRRFLSTESEQLIWKSEGLPSDELSMENALVILQINDIPAGSTQRPFLIDPSSRATDWLKIHLKDQRLEVINQQDANFTTALELAVRFGKTLIIQEVDGVEPILYPLLRGDLVSQGPRFVVQIGEKSIDYNEEFRLFLTTRNPNPEIPPDAFSIVTEVNFTTTRAGLTGQLLAATIQNEKPELEVRKTELLKTEEDLKIQLAKMEESLLEELANAKGNILENKELLDSLNKTKASSITISDSLTESVRLQASLDQERNTYLPLAESGSRMYFVISDLAKINNMYRFSLAAFLRIFQKALKTKQDGSGTDHRIKALTQRLQNLVYEYVCRSLFKADRLMFALHMVHGMKPELFEENEWEGFTGTLVSEMKADGGRGMPSWIDQERQTAVTNLKTNFPKLYQVLNFDDGSLWSSFSRSNECEKEFPSVIEKRISLFQQLLVVQAVRPDRLQTAMGLFACKALGMKELSPPSVNLKRLLETETLPSEPILIIISPGADPSQELQDLAEQTIGGDKYHQVAMGQGQSDIAMQLLRECSQNGEWLCLKNLHLVTAWLPQLEKEINTLKPHDDFRLWLTAEVHPKFPTILLQSSLKITYEAPPGVKRNLMRTYESWNPEYISKSGSVLRAQALFALAWFHAVVQERRMYIPQGWTKFYEFSLSDLRAGADIIDRLI-KTGTDQEWKFVHGLYEFAIYGGRVDNTFDLRVMVSYLRQFFDGNTLSQGRNKRLGPLRLPTSTNFRDYVEAIEELPEFDKPSYFGLPENIERSAQRIISNQVIGQLKVLQRADAKANKFDKEIWATELGPILNLWKKLNQGSQLINSKIKPPSDKTGQEAPIISFIKLEQYNAIKLVQSIHQSLASLSKIIRGTMLLTKEVQNLAAALLNQETPLDWQGKWDGPEDPMQYLRGLVTRATAIQTWVDKADHGNLLRDTLDLSDLFHPDTFLNALRQQTAREVGCSMDSLKFAVSWRGGVQGAKTQVKVGGLQLEGCSFDGARLSENQRDSPSVSAVPPCQVAWIPKDAPDPYGMDDVISIPVYTSSERDHIVTRMDLPC-GGNQSLWLQCGAALFLKS 4304          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15743966 (tr|R7UM87|R7UM87_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_174571 PE=4 SV=1)

HSP 1 Score: 4963.28 bits (12873), Expect = 0.000e+0
Identity = 2448/4335 (56.47%), Postives = 3231/4335 (74.53%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFPNQNSKFVNEEC-----LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTD--ETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGK---VPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKS--VGSQSKTKNV-VQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSA-------DSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTS-DNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXX-----XKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPV--EFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNIT---VPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRN-IQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVN--GSGN-FYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK+ I   T ++F  Q ++     C     L+ F D+    VLV    + K  FS Q++T+ K    +VF KT P  ITPDN++S + V+T+ ++P+++LY+ +Q +Y PILL D       DPK+Q L++ELE GLGS++RK  +      +D  E  + GI +  DE  +W +S  A +   ++ R       LQ +  E   + S++L E    +E     L+D+W+     P YPQ RMK L+ +IA    R +Q QL  L  W+  Y  VK+ L   + +C  WI  C  L  ++WK+Y P+ W  D       +   Q RL EI +LR+VHEQ+ ++L H+++Q+  +++AF  F  +LPL +NPYT+P+W  AV ++ R + PAE  I  +L+  F         QQLLR FQRY DL+ RP +S  L  ER  LL  L+   +Q R+DF+ R+  G    +P  KN  + ++ IVW +Q+EAK+ E +     +L DL GF+ F K+  + LEE+S+WRQ+ F++W++++  +++D  N+ I L+  GRLMEL+ +DG LYVNY DRLV L+REVR+L+ LGY I   ++ AA+ G KFY   VILKQVA FYN+I+ QMIP QQ+MML++A+ FE+++K+   G +SK   V V W+ P+EL  +I+K+Q A++ + S+NR LRK HF + EK+V +M IDLLRQQQKWKD+L +IRQI+  +  Q    EN  PWK H D QLYKALE+QY +GLE LNENLPEIRV+L +RQ RLQF P  EEIK+KYF+EMKKFI +PN FKG+ D++    LIFP++I+RN  GF+ CY+KA  LF+RL     KFK+W++LG LD+++FV QH  +L D+E+NFKA+K +G++AEKLPNEIK+DCI V+  P+K  +D  IQ +FDALL SLRK I    + ++ +LT +++ LS+RPQ++ EI EA   H EF K +  I    D +E  N LLR+VAG G+D ++ LQ +WDKFELMMES Q+M++EQI+VMK+N+ SR K ++Q + KF+ RW  LKPG D LD G  + CL AV+ I+++K E +EL   +  L+ DCEHF +E  EF L E++ +D+ + + MW  FEE+  GLQ+LAKEDW+SFRSRYY FEE+L+QW+EKL++ + TTMT+RLQ+EI+ YK+++P+LKW+RGE LSQDHW+E+FR+L+MP+  TLE LT   I+ A+  II +A  +K+LNQ+AQGEVTIREA+REL+LWGAGAVF L +Y DS  ++I LIK+W+++++QVGDNQCLLQSLKDSPYY+ F+DKA++WE +LADLDE   NLNQIQRKWVYLEPIFG+ ALPKE+ RF+RVD+DFR+IM+DV R+NRVLS+    G+K  L+ M+DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQ+TNP+VI++HLKKLF GI+ V F++  QHI+ MKS+DGE+V L+++V I  EVE WL  L +EMK TL + L   L+D +    S  G++ +KYPSQ+LCL EM+ FT RCEE +  N++ +   E+ ++L+ YTN  M   +       D   +V +LKLK+LILD +HNI++I+ L     + + +W W KQLR+Y   K    V++MVDAEF+YTYEYQGNAPKLVHTPLTDKCYLTLTQ M +GLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ+IQD IK +   I LL R ++VD NS IFIT+NPAGKGYGGR KLPDNLKQLFRPVAMS+PDN+LI EVIL S+GFK+A+ LGRKLVAIFNLS+ELLTPQQHYDWGLRALKT+LKG  +LL+   +K   QG      V  +D E +L+VQALR+NTLSKLT++D I F+SL+KDVFP +  K+IEY+ L   ++EV  E N++  + Q +K LE YEQ RQRMGVV+VGPSGSGKST+WK++R AL K+G+ V+ YVMNPKA+PRTQLLGHID+DTREWSDGVLTY+ARQVVKEP E+QSWI+CDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLS E TDVK+LV SWL K++E ++  LS +++D+FYK+L+W+ K+ +  + TS VGTV NGLS+   +KNK HF+VCL++G+GGNL+E+ RE FA  V+    E  P+  +   L+  ++++ +RL  YS +  ++ +I+          P+I TAD+QR ++ F  WL  + +QPFIL+GPEGCGK L+L HCF  L+S QV T+HCSAQT+P H+LQKL+Q C+ I++NTGRVY+PK+ ERLILYLKD+NLPK DKWGTSQL +FLQQ++TY GFYDSNLEFVGLDGVQIV SM++ SS+GR  L+TRFTS+VRLCSISYP +DQL  IY +YL PVL R + KHP+WS  SK+  LA+TM++VY Q+++KFTVDDY HYLFTP DLTQWVLSLLRYDL   + +NT+  +LEI SYE+ R+F+DR+V  +  +R D IL + + S+WS  + ++L   ++VTWG+R      A          GK+LGKL  E L+  I++GLLQYSRE RDLDI++F+EV +N+A++DRVLT PGGS+L+AG++GVGRRT   LV+HMH + L++PK+ RGY +K FKNDLK+ +Q  G+EGE  VLLLEDHQFLEP +LELINSLL++GEVPGLY+ EELEP+L  L+DLA+E+  RG+   +FA RI+  LHI LIM+C+N  F +NC+SNPAF+K C+V W++ WSR SM+K+P +L+ + P+ EG+ L +   + + +L+G D L   FL +H++C    + +T R Y+ F+  +  +Y   K  I+ RQ H+  G+ K++EAKE+VA+L SKAAEQS++L EKQ EAD++LK+IT  MQ A+++K EME L  +  EEN  L KRK  ID EL  I+P V +A  AV  IK+  L EIRALRAPPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+IQTF+AR+IT E R  VE++L++   SF+PKNAKRAS AAAPLAAWVKANVK+SY LE+I PLE+EQ +L++NL+ AE +M+ L + + +VD+ V G ++ FEK T +AAKL++EL+ A ETI+AAE+LV KL+ E+ERWN Q+ EL+ EL+ L +K+LLA+A + YM S+PED R + ++ W +  G+  FD+R+FL+TE EQL WK EGL SD+LSMENALVILQ  L PFLIDPSS AT WLK H K+ +LE++NQQD+NFST LEL+VRFGKTLIIQE+DG+EP+LYPLLRGDLI+QGPR VVQ+G+K IDYN +F+LFLATRNP P++PPDA ++V+ VNFTTT+AGL GQLLA T+QH KP+LE RKT LL++EE LKI+L+K+EESLL+ELANA GNIL NK+LL SLN TK SSITIS SL ESV+LQ SLD ER A+LPLAE+GS LFF+ISDL KINNMYRFSL +FLRLFQRAL   +  +    R  SL + L  LVYEYVCRS+FK+DRLMFALHM H   PD+F+  EWE FTG  +SD  +   +   VP WI+ DR  A+  + S  P+L+S LN++D   W QFA+SS+CE++ P  L+ +LS FQ++L++QA RPDRLQSA+S F C  L +K LSP ++NL ++++ ET ++EPILIIIS GADPSQ+L++L+   IGSE+Y QVAMGQGQA+I L LLH+CS+NG+WLCLKNLHLVT+WLP LEKE+NSL+PH+DFRLW+TAE H  F TILLQSSLKITYEAPPG+K NL+R+Y++WS +F+SK GS  R+ A+F+LAWFHA++QERRN+IPQGWTKFYEF ++DLR+G EI+D++  ++ R  IQW F+HGLFE AI+GGRVDNPFD RV+ SY+ ++F+ ++++    GN   G +Q+P++   RDY+  I  L +++ P++F LP+NI+RSSQRIISS V+  LRIL+R  V  +KFDKD+W+ EL P+LN WK LNQGLN+I++ +     +S TD PV +FL LER+N+I+ V+ +H+SL +LSKV++G++LLT EVQ L+  L+  +TP  WL +W GPE+P  Y+R LI +A AV +W E  E   LL+  LDLG LFHPDTFLNA+RQ TAR  K SMD LKFV  W GS   A  ++KIGNL +EGC FDGT ++E  RDS S+  +P  +V ++ KN P  YS +++IS+PIYY I RD IVT++D+PC  G   +W+Q G ALFLKS
Sbjct:    5 DSRKEFILATTGNYFGLQVNEPAVSACHNSKDLNCFLDDGGTGVLVGMLENKKIAFSTQISTSAKDDKLIVFFKTKPEAITPDNLHSTVFVSTMLDSPVTALYHAVQKVYAPILLKDEKWSKNFDPKLQSLLTELEAGLGSVMRKQDASFRGPASDGNEDSLGGILTPADEFQYWAESALAGAKS-SKERAQHFNEILQPITREFLALESQNLQEVLELVEVTQDTLDDLWKQTECEPTYPQPRMKHLLNVIAGAFGRYVQHQLADLDLWKGPYGQVKQRLRSGLMICERWISACHTLTSQFWKRYGPNPWKGDKCTPEGMVQLAQ-RLEEIITLRSVHEQLVRLLDHQDQQDLGVKQAFAPFGGLLPLQHNPYTQPLWNAAVAQYDRAMAPAEKRIANKLRNQFNALEGNS--QQLLREFQRYKDLVKRPSLSEELATERRVLLTVLL---RQTRDDFLQRTSSGAAKGIPKGKNLPESVNNIVWVRQMEAKVEETMKTAEALLGDLPGFKSFRKDASDLLEELSSWRQDTFDEWSRDVQSQMEDQ-NNAICLETNGRLMELNHRDGKLYVNYGDRLVTLLREVRSLTALGYSIPSKILRAAETGNKFYRHGVILKQVAHFYNSIDQQMIPSQQSMMLESALAFERIIKNPKAGHKSKGDGVQVTWDRPDELELYIEKVQSAANRLTSENRRLRKCHFTVAEKVVQMMAIDLLRQQQKWKDSLMDIRQIMANLVQQGFSAENMRPWKSHWDRQLYKALEHQYQMGLEGLNENLPEIRVELTFRQQRLQFRPPLEEIKAKYFREMKKFIAIPNHFKGVGDAT--ENLIFPAIIDRNGVGFITCYKKAGDLFRRLERAAEKFKDWVVLGGLDIDKFVSQHLQNLPDWERNFKALKVRGRDAEKLPNEIKVDCIVVSTTPVKAVIDDHIQRLFDALLTSLRKGITNDFNRIEGFLTQAMETLSQRPQSVQEIGEANAKHGEFTKQKKEILPLFDAAESKNKLLRSVAGAGVDQLNTLQGRWDKFELMMESHQLMVKEQIDVMKSNVESRIKNYEQTLEKFSARWHQLKPGDDALD-GDQEKCLQAVKSIRERKQEFDELDASREALKTDCEHFDLEFPEFELAEDLREDLSKYESMWGLFEEFNNGLQDLAKEDWISFRSRYYQFEEYLSQWYEKLKSDQPTTMTVRLQQEIEKYKNVLPVLKWVRGEPLSQDHWMELFRMLHMPKTTTLEKLTFGQIIAASDHIIANATQLKDLNQRAQGEVTIREALRELDLWGAGAVFALTDYEDSHKHTIMLIKDWKELVNQVGDNQCLLQSLKDSPYYKSFEDKASIWEVRLADLDEIFLNLNQIQRKWVYLEPIFGRGALPKEQGRFKRVDDDFRAIMADVRRDNRVLSIVGKHGLKGQLTQMLDQLQRCQKSLNEFLEEKRSQFPRFYFIGDDDLLEILGQATNPEVIQTHLKKLFAGIHSVQFDEGTQHIVAMKSVDGEIVPLKHKVQIQPEVEVWLSRLADEMKGTLKELLKDCLRDAK----STQGLDPNKYPSQVLCLGEMVQFTERCEEAMKTNSLNSFHGEMQQQLDSYTNVDMGGGSGAPGAEKDPAVVVLELKLKALILDCIHNIEVIEILEKNGVRDIIQWLWQKQLRYYM-GKGSSAVMRMVDAEFDYTYEYQGNAPKLVHTPLTDKCYLTLTQAMAIGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQVIQDAIKARAPSIDLLNRAIDVDPNSGIFITMNPAGKGYGGRSKLPDNLKQLFRPVAMSKPDNELIGEVILFSEGFKDARNLGRKLVAIFNLSKELLTPQQHYDWGLRALKTILKGCGSLLQ--NTKQSAQGK-----VSSTD-EARLVVQALRINTLSKLTFSDSIAFDSLVKDVFPGVPFKDIEYETLREKLKEVCAESNLMVNETQIRKCLEFYEQTRQRMGVVVVGPSGSGKSTLWKIMRQALAKVGKVVRQYVMNPKAMPRTQLLGHIDMDTREWSDGVLTYAARQVVKEPVEVQSWIVCDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSDEDTDVKALVNSWLMKKEERERDSLSGWIEDYFYKALEWVLKQGDLVVDTSLVGTVMNGLSHFHNVKNKTHFAVCLVRGIGGNLSESCRENFAKEVFSWVGEHLPDPRRP--LDVTYDDEYSRLTGYSNQMSDQPTIEDFTGSN---LPVIRTADVQRFIESFASWLQPENRQPFILNGPEGCGKGLLLQHCFDSLRSSQVATIHCSAQTSPSHILQKLSQTCMTISTNTGRVYKPKDCERLILYLKDLNLPKPDKWGTSQLTAFLQQLLTYNGFYDSNLEFVGLDGVQIVASMSAGSSLGRHKLTTRFTSVVRLCSISYPDRDQLQAIYASYLTPVLARQLSKHPVWSSASKINALASTMVQVYEQVRAKFTVDDYGHYLFTPRDLTQWVLSLLRYDLAAGANENTSDQVLEIWSYEAHRLFRDRIVGPENIERFDSILMSVVRSDWSGNIFEALQSAFYVTWGARADAGVSATGIGAPLPPHGKALGKLGGEDLQKVIEKGLLQYSRENRDLDIVVFREVLENIARVDRVLTMPGGSLLMAGRTGVGRRTAVTLVAHMHQMTLVTPKISRGYGVKNFKNDLKTAMQLTGIEGEQAVLLLEDHQFLEPSFLELINSLLSAGEVPGLYSPEELEPLLAPLRDLASEANFRGTTMQFFASRIRTNLHIALIMECTNTKFSMNCESNPAFYKQCAVLWMDSWSRQSMVKVPQLLLTRPPKVEGASLGEKKQRQR-KLSGGDELLKGFLHIHESCDTITDVATPRRYMAFVHAFNEVYNNNKKGIQDRQTHLNAGVAKLNEAKELVADLNSKAAEQSRVLAEKQEEADQSLKEITFTMQSASDQKSEMETLKKQAAEENKKLEKRKVEIDKELREIQPLVDEASAAVGAIKNETLGEIRALRAPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVKEDIQTFEARKITPEIRDGVEKMLSKNGASFEPKNAKRASQAAAPLAAWVKANVKFSYVLERIEPLESEQAKLQKNLQKAESRMEKLGRALDEVDRKVEGLKRKFEKTTTEAAKLKYELEKAQETIAAAENLVGKLQGEYERWNGQVGELSQELTELPLKALLASAFITYMSSAPEDVRHQCLEAWKDFVGVRTFDLRRFLSTESEQLIWKGEGLPSDDLSMENALVILQTSLRPFLIDPSSRATDWLKVHLKENRLEVINQQDANFSTALELAVRFGKTLIIQEMDGVEPILYPLLRGDLIAQGPRFVVQIGEKTIDYNEEFRLFLATRNPAPEIPPDAASVVTEVNFTTTRAGLSGQLLAQTIQHEKPQLEVRKTELLKQEEDLKIQLAKLEESLLEELANAKGNILENKELLASLNLTKASSITISDSLTESVRLQTSLDHERSAYLPLAENGSKLFFIISDLCKINNMYRFSLAAFLRLFQRALQGKQEGSSPEHRIKSLNSALLYLVYEYVCRSLFKADRLMFALHMVHSMFPDMFQENEWEAFTGMIVSDVKNEGRSAGQVPNWIEPDRAQAVLLIQSTFPKLFSDLNLQDSSQWSQFARSSQCEQDFPGPLQRQLSAFQQLLVVQATRPDRLQSAMSLFACQTLGMKELSPPNVNLKRLFQKETTASEPILIIISAGADPSQELEDLAKGTIGSEKYRQVAMGQGQAEIALQLLHECSRNGEWLCLKNLHLVTAWLPSLEKEINSLQPHEDFRLWMTAEVHPKFPTILLQSSLKITYEAPPGIKKNLMRTYESWSPEFVSKGGSVARSQAMFALAWFHAVMQERRNYIPQGWTKFYEFGMSDLRSGAEIIDRLCSRAGRGQIQWDFVHGLFEFAIYGGRVDNPFDNRVMVSYLTQFFDPTILSEQSRGNKRLGPLQVPNSTMSRDYIEAIEALPEFDKPAYFGLPENIERSSQRIISSAVVSTLRILKRADVKASKFDKDVWANELGPILNVWKKLNQGLNLIQSKVSPPSDKSGTDPPVKSFLLLERFNAIRTVQSIHASLAALSKVIRGTQLLTSEVQLLASALMNQETPQSWLSKWSGPEDPMLYLRGLIGRAVAVSRWVEKVESRSLLNETLDLGHLFHPDTFLNAVRQQTARESKCSMDSLKFVASWKGSIQGASLNIKIGNLQLEGCSFDGTRLSENQRDSPSVSEIPTCNVAFIPKNAPEPYSANEVISIPIYYSIERDNIVTRMDVPC-GGNHLQWLQCGAALFLKS 4308          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23853026 (tr|V4AES5|V4AES5_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_209197 PE=4 SV=1)

HSP 1 Score: 4955.96 bits (12854), Expect = 0.000e+0
Identity = 2449/4331 (56.55%), Postives = 3212/4331 (74.16%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHFP---NQN--SKFVNEECLDKFFDNLDNNVLVVKFIDNK----FIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHR--SRQGK-VPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKN---VVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPV-TSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXX-----KSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTC-PVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQ-------GILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNF--YGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RK  +     ++F    N N      N   L+ F D+ + +VL     DNK    F  SN++ + +   N +VF KT P ++ PDNI+  +IV+++ ++P+S+LY+ +Q +Y PILL D       DPK+Q L+SELE GLGS IR+           E  +  I S  DE  +W+D ++ S   +++ R    +   + ++++   + +    +    +E     L+DIW+    +P+YP++RMK LM++I   L R  Q +L+    W   ++ ++E+L   + +C  W+ +C+ L  ++W++Y PH W  +  +    I     RL EI SLRTVHE I ++L   E+++ ++ +AF  FL + PL YNPYT+P+W  AV ++ R + PAE  I  +L+  F+       PQQLLR FQRY  LI RP I   +  ERETLL QL ++ +Q+ EDF  R   R GK +P  KN  D ++ I++ +QLEAK+ E   +   +L DL GF+KF K   +  EE+ +WR++QF++W+++M   +DD     I L+  GRLMEL+ KDG L VNYS+RLV L+REVR LS +G+ +S  +   A+ GQKFY   V+LKQVA FYNTI+ QMI  QQAMMLD+A+ FEKLVK+  S +K K     V W+NPEEL  +I KLQ A+  + ++NR LRK HF++ +K+  LMGIDLLR Q KWKD L EIRQ++  +  Q    +N  PWK H DHQLYKALE+QY +GLEALNENLPEIRV+L YRQ RLQF P FEEIK+KY++EMKKFI++PN F+G+ +++    +I+ ++I+RNA GF+ CY+K   LF RL + +++FK+WIILGSLDL++FV+ +  D+  +EKNFKA+K +G++AEKLP++IK+DCITVN  P+K  +D  IQ +FDALLNSLR++I   + S+D +L  +++ LSKRPQ ++EI EA   HAEFN  +  I+    K+E  N LLR+VAGGG++T+SQLQ +WDKFELMMES Q+M++EQ+EVMK N+ SR K + QDI KF+ RW  LKPG D LD G    C  A+  IK+K+ E  EL   +  L  DC+HF +E  +F  +EE+  DI   + MW  +E +  GLQ LAKEDW+SFRS+ YLFEEFL  W+EKL+N E TTMT++L K+I+ YK ++P+LKW+RGE LSQDHWLE+FRLL+MP+G TLE L    I+  + +II +A+A+KELNQ+AQGEVTIREAIRELELWGA A F L EY DS  N+I LIK+W+D+++QVGDNQ LLQSLKDSPY++ F+DKA+VWE +LADLDEYL NLNQIQRKWVYLEPIFG+ ALPKE+ RF+RVD+DFRSIM DV R+ RVLSL + SG++NLLSTM+DQLQRCQK+LNE+LEEKRSLFPRFYFIGDDDLLEILGQSTNP VI++HLKKLF GI+ V+F++  +HI+ MKSLDGEVV L  ++ I  EVE+WL  L +EMK TL + L   L+D   +  S  G++ +KYPSQILCL+E I FT  CEE +  NN+    +EL  +L  YT+  MS   D    V +LKLK+LILDT+H+ID++ +L+  N +  +EW W+KQLR   + KD  CV++MVDAEF YTYEYQGNA KLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKA+G LFGRQVLVFNCDEGIDVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ+IQD IKNKV  I LL + ++++ NS IFIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS+PDN+ IAEVIL S+GFK AK +G KLVAIFNLSRELLTPQQHYDWGLRALKTVL+G  NLL+  K  +         N  D   E KL+VQALR+NTLSKLT++DGI F+SL++DVFP I+ K+IEY++LA A+ EV KE N+   + Q KK LE+YEQLRQRMGVV+VGPSGSGK+T+W++LR ALNK GQ VK YVMNPKA+PRTQLLGHID+DTREW+DGVLTYSARQV+KEPQE+QSWI+CDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E  DVK+LV SWL  Q E +QHL+S +++D+FY++LDW+ K+N+F + TS VG V NGLS+L  IKNKAHF++CLI GLG N++E+ RE FA  V+    E  PE  +   L+ Y++E   RL+TYS E  E L+ D       +  P+I T+D+QR+LDYF  WL+ D +QPFIL GPEGCGK L+L H F+ L+S Q+  +HCSAQT P H+LQKL+Q C+ I+SNTGR+ RPK+ ERL+LYLKDINLPK DKWGT Q+ISFLQQVI Y GFY S LE+VGL+ +QIV SMN+ +++GR  L+TRFTSIVR+C + YP  +QL  IY++YLKP+L + +  HP+W  +SK+  LA TM++ Y QL+SKFTVDDY HYLF P DLT WVL+LLRYDL    ++NT  ++L I +YE+ R+F+D++V  + R R D +L + + ++WS  + D L   ++VTWG+R    A A           K LG L+S+ LK  I++G+  Y RE R+LD+++FKEV +N+A++DRVLTKPGGS+L+AG+SGVGRR+   +V++MH ++  SPK  RGY LKQFKNDLK+ +Q++G++G  +V++LEDHQF+EPQ+LELINSLL++GEVPGLY+ EELEP+L  L+D+A+E G RG++ NYFA RI   LHI+L+MD +N  F +NC+SNPAF+K CSVQW++ WSR+SM+K+PYML+ + P+ EG  + +   + + +L+G + L   FL +H++C PV   T R ++ F+  Y ++Y +KK+ IE RQ+H+Q G+ K+++AK +V ELKSKAAEQS  L EKQ EADKAL +IT  MQ A ++K EME L  +  EEN  L KRK AID EL+ IEP V++ R AV +IK+  LSEIR+LRAPPDVIRDILEGVL +MG  DTSWVSM++FL KRG++EEIQTFDAR+I+ E R  VE+LL +   SFDPKNA+RAS+ A PLAAWV+ANVKYSY LEKI PLE+EQ  L++NLE AE KM+ L + + +VD  VA  R  FE FT +AA+L+ +L   NETI AAE LV KL+ E++RWN Q+ EL+ EL+AL   +LLAA  + Y+ S+PED R+  ++ WM+  G+E F++R+FL+TE EQL WK EGL SDELSMENALVILQ         L PFL+DPSS AT WLKNH KD +LE+VNQQD+NF+T LEL+VRFGKTLIIQE+D +EPVLYPLLRGDL +QGPR VVQ+G+K IDYN +F+LFL TRNP P++PPDA ++++ VNFTTT+AGL GQLLA+T+QH KP+LE +KT+LL++EE LKI+L+K+E+SLL+ELANA GNIL NK+LL SLN TK SSITIS SL ESV+LQ SLD+ER+ +LPLAE+GS L+FVISDL+KINNMYRFSL SFLR+FQRAL+T    + + MR  +L   L+ ++YEYVC+S+FK+DRLMFA+HM H  +P++F   EWE FTG  ++D        P W+D +R  A++   +  P+L++ +N+ D   W  FA+SS+CE E P S++ +++ FQ++L+IQA+RPDRLQ+A+S F C +LE+K LS  ++NL ++Y+ E+IS EPIL+IISPG DPSQ+LQEL+ + +G +RY+QVAMGQGQ+++ + LLH+C+  G+WLCLKN+HLVT+WL  LEKELNSLKPH DFRLW+T E H  F TILLQSS K+TYEAPPGVK NLLRSY+ W+ ++IS+ GS  R+ ALF+L WFHA++QERR +IPQGWTKFYEFS++DLRAG  I+D++   +  ++QW+FIHGLFE AI+GGRVDNPFDMRV+ SY+K++F+ SV++  G     G +++PS+ S +DY+  I  L +++ PS+F LP+NI+RS+QRIISS VI QLRILQR  V  +KFDK++W+ EL P+LN WK LNQG N+I+  L     ++   SP+V+F+ LERYNSI+LV+ VH+SL  LSKV++GS+LLT + QNL+  LL  +TP  WL+ W+GPE+P  Y+R L+ +A++++ W E +E   LL   LDL ELFHPDTFLNALRQ TAR I  SMD LKF C W GS   A YS+K+G L +EGC FDG+ ++E  RDS S+  +P   V W+    P+ YS DD +S+PIYY   RD IV K+D+PC  G Q  W+Q G ALFLK+
Sbjct:    4 DSRKQFLLATAANYFSLPINDNVLGSLQNSSALNSFLDDGNCSVLSAS-KDNKSGQSFQLSNKVESGESKDNVIVFFKTKPDVLNPDNIHKNVIVSSMVDSPLSTLYHAVQKVYAPILLEDGRWSRGLDPKLQSLLSELEAGLGSTIRRTDPSFRGKDGSEDNLGNILSPMDEFNYWSD-VAHSGRGESKDRAQCFLDLFKPISKDYGGLETMPFQDVMELVEITQDTLDDIWKQGDYDPSYPENRMKHLMDVIGGSLARYCQKKLSEEDLWNGVFSPIREALRSGLTICERWVSVCETLTLQFWRRYAPHSWKGEKFVP-ENIKKLGERLEEILSLRTVHEHILRLLSSSEQKDLQVTDAFTPFLGLNPLQYNPYTKPLWDAAVAQYERAMGPAEQKIAAKLRGQFRGLDG--YPQQLLREFQRYKALIKRPTIRREMASERETLLGQLTVYVRQISEDFNARIGGRGGKSIPKGKNLPDIVNNIIYVRQLEAKIEETNLVAEMLLGDLTGFQKFRKSASDLSEELQSWRRDQFDEWSRDMQSMIDDPKQP-ISLETNGRLMELNHKDGKLRVNYSERLVTLLREVRQLSAIGFAVSAKIQHVANVGQKFYRHGVVLKQVAHFYNTIDNQMIASQQAMMLDSAMAFEKLVKNPKSGNKAKGDDVQVTWDNPEELESYIKKLQAAADRLTTENRRLRKSHFVVSDKVQQLMGIDLLRHQSKWKDGLMEIRQLMANLVQQGFSADNMRPWKLHWDHQLYKALEHQYQMGLEALNENLPEIRVELTYRQQRLQFRPPFEEIKAKYYREMKKFISIPNNFRGVTETT--GSVIYTAIIDRNAEGFITCYKKGNQLFDRLGSVIHQFKDWIILGSLDLDKFVEDNLTDIHQWEKNFKALKVRGRDAEKLPSQIKVDCITVNTTPVKAVIDDHIQRLFDALLNSLRRSIVSEVGSIDTFLNTAMETLSKRPQTVEEIGEANAKHAEFNATKKEIQPLFQKAEAKNKLLRSVAGGGVETISQLQGRWDKFELMMESHQLMVKEQVEVMKKNVDSRVKTYHQDIEKFSARWHQLKPGDDALD-GDKAKCDHAMNVIKEKREEFAELEATRATLLSDCQHFGLEEPDFGAVEELRNDIKNYESMWGLYENFNNGLQELAKEDWISFRSKAYLFEEFLGGWYEKLKNEETTTMTVKLHKDIEKYKTVLPVLKWVRGEPLSQDHWLELFRLLHMPKGTTLEKLNFGQIIAVSDQIIINADALKELNQRAQGEVTIREAIRELELWGADATFSLTEYEDSNKNNIMLIKDWKDLVNQVGDNQSLLQSLKDSPYFKSFEDKASVWEQRLADLDEYLHNLNQIQRKWVYLEPIFGRGALPKEQGRFKRVDDDFRSIMQDVRRDTRVLSLVNQSGLRNLLSTMLDQLQRCQKSLNEFLEEKRSLFPRFYFIGDDDLLEILGQSTNPNVIQTHLKKLFAGIHSVEFDEASEHILAMKSLDGEVVPLIRKIKIVPEVESWLSKLADEMKDTLKELLLNCLKD---AKSSRGGLDPNKYPSQILCLAEAIRFTQNCEEAIQSNNLRVYLQELEGQLESYTSVDMSAGQDVEAKVLELKLKALILDTIHSIDVVRELMTANIRKTSEWLWMKQLRVNMR-KDGVCVLRMVDAEFEYTYEYQGNAQKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKAMGGLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQVIQDAIKNKVSRIDLLGKNIDINHNSGIFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSKPDNEQIAEVILFSEGFKQAKSVGSKLVAIFNLSRELLTPQQHYDWGLRALKTVLRGCGNLLQTTKKAL---------NGVDGKTEAKLVVQALRINTLSKLTFSDGIRFDSLLRDVFPGIEFKDIEYEDLAEAMREVCKETNLSINEKQIKKALELYEQLRQRMGVVVVGPSGSGKTTLWRMLRQALNKRGQVVKQYVMNPKAMPRTQLLGHIDMDTREWTDGVLTYSARQVIKEPQEVQSWIVCDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDVDVKALVKSWLSTQPESEQHLISGWIEDYFYRALDWVLKQNDFVVETSLVGCVLNGLSHLHNIKNKAHFAICLIHGLGSNISEHHREKFAQEVFSWVGEAPPESRRP--LDAYYDESVGRLMTYSTEVPENLTADHFTISSNL--PVIRTSDVQRSLDYFTPWLDPDNKQPFILVGPEGCGKGLLLRHSFEHLRSTQIAVVHCSAQTNPSHILQKLSQTCMEISSNTGRLLRPKDCERLVLYLKDINLPKPDKWGTCQMISFLQQVIIYNGFYSSTLEWVGLENIQIVASMNAVTTLGRHKLTTRFTSIVRICVVGYPDHEQLQTIYSSYLKPILHKQLAHHPVWGSSSKINTLAGTMVQFYEQLRSKFTVDDYGHYLFAPRDLTSWVLNLLRYDLSSGANENTCDTVLRIWAYEAQRLFRDKIVGLEGRNRFDNMLMSAVRADWSTNIFDELASTFYVTWGARTDSGAPAVAAGAPLPIFGKPLGLLSSDDLKQVIEKGIRIYGRENRELDLLIFKEVLENMARVDRVLTKPGGSLLMAGRSGVGRRSAVAVVANMHQMEFFSPKTSRGYGLKQFKNDLKTVMQSSGIDGNQVVMVLEDHQFVEPQFLELINSLLSAGEVPGLYSPEELEPLLAPLRDMASEVGFRGTMVNYFASRIMSNLHIVLVMDNTNTLFTLNCESNPAFYKQCSVQWMDGWSRESMVKVPYMLLTRPPKIEGGSIGEQKQRQR-KLSGGEELLKSFLHVHESCDPVNL-TPRRFMVFLNTYQQVYNEKKSSIEKRQHHLQAGVSKLNDAKHLVDELKSKAAEQSIQLAEKQREADKALSEITVSMQNAGDQKNEMEVLKQQAAEENKKLEKRKVAIDQELSEIEPLVQETRKAVGNIKTESLSEIRSLRAPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVKEEIQTFDARKISSEIRKSVEDLLRKNGASFDPKNARRASVVAEPLAAWVRANVKYSYVLEKIEPLESEQAMLRKNLEKAESKMERLGRDLDEVDNKVAQLRARFENFTKEAAELKIKLDKENETIQAAETLVSKLDVEYDRWNAQVGELSNELNALPKLALLAAGFITYLSSAPEDVRRSTIKGWMDAIGVESFEIRRFLSTESEQLIWKSEGLPSDELSMENALVILQVNNLPVGSSLRPFLVDPSSRATEWLKNHLKDSRLEVVNQQDANFNTALELAVRFGKTLIIQEIDQIEPVLYPLLRGDLTAQGPRFVVQIGEKTIDYNEEFRLFLTTRNPSPEIPPDAASVITEVNFTTTRAGLTGQLLAVTIQHEKPELEVKKTDLLKQEEDLKIKLAKLEDSLLEELANAKGNILENKELLDSLNMTKASSITISDSLTESVRLQSSLDQERNTYLPLAENGSCLYFVISDLAKINNMYRFSLASFLRIFQRALHTQHDGSGTEMRIKNLSYRLQLMIYEYVCQSLFKADRLMFAMHMVHGMKPNMFAENEWEAFTGILVADVKAEG-GRPNWVDEERGQAVAAFKTNFPQLYNQMNLDDGSTWSNFARSSQCELEFPSSIEKRITPFQQVLLIQAVRPDRLQTAMSHFACSLLEMKELSLPTVNLKKLYQ-ESISTEPILVIISPGVDPSQELQELAVETVGMDRYHQVAMGQGQSEVAMQLLHECAVKGEWLCLKNIHLVTAWLQTLEKELNSLKPHDDFRLWLTTEVHPRFPTILLQSSHKVTYEAPPGVKKNLLRSYETWTPEYISRGGSVIRSQALFALTWFHAVVQERRMYIPQGWTKFYEFSLSDLRAGANIIDRLCSGAGHDVQWQFIHGLFEFAIYGGRVDNPFDMRVMVSYLKQFFDASVLSSQGKSKRVGPLKIPSSTSYKDYIEAIEALPEFDKPSYFGLPENIERSAQRIISSAVISQLRILQRADVKASKFDKEVWANELGPILNLWKKLNQGSNLIQQKLTPPSDKTGKQSPIVSFILLERYNSIRLVQTVHTSLSGLSKVIRGSQLLTSDTQNLAAALLNQETPISWLKSWDGPEDPVQYLRGLVNRAQSMQSWVERAEGGSLLRDTLDLSELFHPDTFLNALRQQTAREIGCSMDSLKFACSWKGSIQGANYSIKLGGLQLEGCSFDGSRMSENQRDSPSVSAIPSCQVAWIPAELPDPYSVDDTMSIPIYYSSTRDHIVAKLDLPC-GGNQSTWLQCGAALFLKN 4303          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20303897 (tr|A0A1S3JIZ4|A0A1S3JIZ4_LINUN cytoplasmic dynein 2 heavy chain 1 OS=Lingula unguis OX=7574 GN=LOC106173688 PE=4 SV=1)

HSP 1 Score: 4948.64 bits (12835), Expect = 0.000e+0
Identity = 2463/4337 (56.79%), Postives = 3220/4337 (74.24%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF---PNQNS--KFVNEECLDKFFDNLDNNVLVVKFIDNK-----FIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQ--TDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPT-KNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKN---VVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLS-ADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXX-----XKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPV-EFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQ-------GILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFI----SDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGS---GNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RKD I   T ++F   P   S     N   L+ F D+ + N+L  + I+ K       F N++  +D     +VF K  P +ITPDNI+  + V+++ ++P+S+LY+ +Q ++ P+LL D       DPK+Q L+SELE GLGS+IRK  +  S  Q  TDE  + GI +  DE  FW++   + +    + R        Q ++++   + S +L E    +E     L+++W+    +P Y +SRM+ LM++I   L R IQ +L     W+  ++ VKE L   + VC  W   C+ L  ++WK+Y PH W  D  +    ++    RL EI++LRTVHEQ+ ++L  +E++E +   AF  F  + PL YNPYT+P+WK AV ++ R + PAE  I  +L+  F+   +    QQLLR FQRY +LI RP IS  ++ ERETLL QL +  KQ+R+DF  R+   K PP  KN  + ++ IVW +QLEAK+ E   I   +L DL GF  F K+  + L+E+ +WRQ+QF++W+++M  +++DS    + L+  G+LMELS  DG L+VNYS+RLV L+REVR LS LG+ I   +   A   QKFY  AVILKQVA FYNTI+ QMIP QQ+MML++A+ FEK++K+  S +K K     + W+NPEEL  +I KLQ A+  + S+NR LRK H ++CEK+V LM  DLLR QQ+WKD L +IR ++  +  Q     N  PWK H D QLYKALE+QY +GLEALNENLPEI V+L YRQ RLQF P FEEIK+KYF+EMKKFI +PN FKG+ D++    LIFP++I+RNA GF+ CY+KA  LF+RL+A    FK+W++ G +DL++FV  + ++L D+E+NFKA+K +G++AEKLP++IK+DCITVN  P+K S+D  IQ +FDALL+SLRK I   I ++D +LT +++ L++RPQ ++EI  A   H+EF K +  I+    K E  N LLRTVAGGG++    LQ +WDKFELMMESFQ+M++EQ+EVMK+N+ SR K F+Q++ KF  RW  LKPG D LD G  Q C+ AV+ IK++K+E  EL      L+ DCEHF ME  EF    EI +D+++ + MW  +EE+  GLQ L KEDW+SFRS+ Y+FEEFL  W+EKL++ E TTMT+RLQK+ID YK+++P+LKW+RGE LSQDHWLE+FR+L MP+G TLE L    IL ++  II +A A+KELNQ+AQGEVTIREAIREL+LWGAGAVF L +Y DS +N I LIK+W+D+++ VGDNQCLLQSLKDSPYY+ F+DKA VWE +LADLDEYL NLNQIQRKWVYLEPIFG+ ALPKE+ RF+RVD+DFR+IM DV R+NRVLSL    G++N L TM+DQLQRCQK+LNE+LEEKRS+FPRFYFIGDDDLLEILGQ+TNP+VI++HLKKLF GI+ V+F+   +HI+ MKSL+GEVV L+ +V IT EVE WLG L  EMK TL   L+  L+D +   Q   G++ +KYPSQILC +E I+FT +CEE +  +++     E+  KL  YT   +S + +D    V +LKLK+LILDT+H+ID+I QL++   +++ +W+W KQLR+Y + +D  CV++MVDAEF YTYEYQGNA KLVHTPLTDKCYLTLTQGMH+GLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSA+S+QIQIIQD IK K     LL R V++D NS IFITLNPAGKGYGGRQKLPDNLKQLFRPVAM+RPDN+LIAEVIL S+GFK+AK LGRKLVA+FNLS+ELLTPQQHYDWGLRALKT+LKG  NLL+  K  ++       E + D+  E KL+VQALR+NTLSKLT++D I F SL+KDVFP  + K+IEY+NLA AI EV KE+N+V  + Q KK LE+YEQLRQRMGVV+VGPSGSGKST+W++L+ A+ K GQ VK Y MNPKAIPRTQLLGHID+DTREW+DGVLTYSARQVV+EPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TD+K+ +TSW+    E +Q  L+ +++D+FYK +DW+ K+ +F + T+ VG V NGLS+L  +++K HF+V LI+GLGGNL+E +RE FA  V+  T E  P+  +   L+ Y++    RL++YS E  ++L+ D   S   +  P+I T DIQR LDYF  WL+++ +QPFIL GPEGCGK ++L +CF++L+S Q+ T+HCSAQT P HVLQKLNQ+C++I++NTGRVYRPK+ ERL+L+LKD+NLPK DKWGTSQLI+FLQQV+TY GFYDSNLE+VGL+GVQIV SMN  S++GR  LSTRFTS+VR+C+I YP ++QL  IY+AYLKPVL + + +HP+W   +KV  LA +M++VY QL+ KF+VDDYSHYLFTP DLT+WVL LLRYD+ + SD +   +LE+   E+ R+F+D++V  D   R D IL + +  +W V   + +   ++VTWG     +A A  P       GK LGKL+ +  K  I +GLLQYSRE RDL++++FKEV D++A+LDR L+ PGGS+L+AG+SGVGRR+   L+S MH ++L SPK+ RGY LKQFK DLK+ +Q  G++ E +VLLLED+Q + P +LELINSLL++GEVPGLYT EEL+P+L  L+D A+E+G+RG L  YFA RI+  LH++LIMDC+N NF +NCQSNPAF+K CSVQW++ WSR+SM+K+P++L+ + P+ EGS +++   + K +L+G D L   FL +H++C V   +T R Y++F+  Y+++Y  KKN I  RQ+H+Q G+ K++EAK MV +LK KAAEQSKLL EK  EAD ALK+IT  M  A+E+K EME++  +  EEN+ L +RK AID EL+ IEP V++A+ AV  IK+  LSEIRALRAPPDVIRDILEGVL +MG  D SW SM++FL KRG++EEIQ FDAR+IT + R  VEELL + K+SFDPKNAKRAS AAAPLA+WV+ANVK+SY LEKI PLE EQ  L++NLE AE K+  L+K +S+VD+ V   R  FEKFT +A  L+ EL+   +TI  AE+LV KL+ E+ RWN Q+ EL AEL  L +++LLA+A + Y+ + PED R+  +Q WM+  G++ FDMR+FL+TE EQL WK EGL SD+LSMENALVILQ         L PFL+DPSS AT WLK H K+ KLE+VNQQD NF T LEL+VRFGKTL+IQE+DG+EP+LYPLLRGDL+SQGPR VVQLG+K IDYN DF+LF+ TRNP P++PPDA +I+S VNFTTT+AGL GQLLA T+QH KP+LE RKT LL++EE  KIEL+K+EESLL+ LAN+ GNIL +K+LL SLNKTK+SS+TI +SL ESV+LQ SLD+ER A+LPLAE+GS L+FVISDL+KINNMYRFSL +F RLFQRAL T +      M+  +L   L+ LVYEYVCRS+FK+DRLMFALHM H  +P  FK  EWELFTG  +    +D S ++  +P W+D +R  A+  L S  P+L+  LN +D DLW  FA+SSECE+E P ++  K+SLFQ++L +QA RPDRLQSA+S F    L    LSP S+NL ++Y++ET+  EPILI+ISPGADPSQ+L+E++++VIG ++Y+QVAMGQGQADI L LLH C++NG+WLCLKNLHLVTSWLPVLEKE+N++ PH+DFRLW+TAE H  F TILLQSSLKITYEAPPGVK NLLR+Y+NWS +FI++  +  RA ALF+LAWFHA+ QERRN+IPQGWTKFYEFS +DLRAG++I+D++  K    + W F+HGLFE AI+GGRVDN FD RV+ SY+K++F   V++GS   G   G I+LPS    RDYL  I  L +Y+ PS+F LP+NI+RS+Q+ +SS VI QL++++R +V G KFDK++W+ EL+PVLN W+ LNQG  +I+  +    ++S    P+ +F+ LERYN+IKLV+ +H SL +LSKV++G++LLT +VQ L+E LL  +TP  W ++WEGPE+P  Y+  L+ +A A+++W +  E   LL+  LDL ELFHPDTFLNALRQ TAR IK SMD LKF   W GS   A+ S K+G L +EGC FDG  ++E  RDS S+  +PP  V W+ K+ P+ Y  +++I LPIY+   R+KIV  ++IPC  G Q +W+ SG ALFLK+
Sbjct:    5 DSRKDFILATTGNYFGISPADGSIADLHNSSELNSFLDDGNVNILAAR-IETKAGGKEVNFCNRVEPSDTNEKVIVFFKIKPDVITPDNIHRDVFVSSMLDSPVSALYHAVQKVFAPLLLKDEKWSKSFDPKLQSLLSELEAGLGSVIRKQDASYSGRQGDTDEDNLGGILTPSDEFQFWSEVAMSGAKLVIKERAQGFQEMFQPISKDFASLDSMALPECLELVELTQDTLDEVWKQTEHDPPYKESRMRHLMDVIGGALGRYIQRKLAQEDIWKGQFSKVKEKLRAGLSVCERWTSACETLTVQFWKRYGPHPWKGDKFVP-ENLTQLAARLEEITTLRTVHEQLVRLLSPQEQEELRTAAAFSSFAGLNPLQYNPYTQPLWKAAVAQYERAMAPAEQRIAGKLRSQFRSMQANS--QQLLREFQRYKELIKRPSISKEMVAERETLLGQLTVFIKQIRDDFTQRTSGDKAPPKGKNMPEVVNCIVWVRQLEAKVEETNIIAEALLGDLSGFHNFRKDLCDLLDELRSWRQDQFDEWSRDMQSQIEDSGKP-LSLETSGQLMELSHSDGKLHVNYSERLVTLLREVRQLSSLGFAIPAKIQHTAATAQKFYHHAVILKQVAHFYNTIDQQMIPSQQSMMLESALAFEKIIKNPKSGAKVKGDSVQITWDNPEELESYIQKLQAAADRLTSENRRLRKSHNIVCEKVVQLMSTDLLRHQQRWKDGLMDIRHLMANLVQQGFSASNMTPWKAHWDRQLYKALEHQYQMGLEALNENLPEIVVELTYRQQRLQFKPPFEEIKAKYFREMKKFIGIPNHFKGVGDAT--EHLIFPTIIDRNADGFITCYKKAGLLFKRLAAVQEMFKDWVVCGGVDLDQFVYDNLVELRDWEQNFKALKIRGRDAEKLPSQIKVDCITVNTNPVKSSIDDHIQRLFDALLSSLRKAIHNDISTIDTFLTTAMETLAQRPQTVEEIGTANAKHSEFAKQKKEIQPLFSKGESKNKLLRTVAGGGVEQFGNLQARWDKFELMMESFQLMVKEQVEVMKSNVESRIKAFEQELEKFGSRWHQLKPGDDALD-GDQQKCMAAVESIKERKVEFTELENTMKTLQTDCEHFDMEMPEFPYAAEIAEDVNKYESMWGLYEEFNNGLQELCKEDWISFRSKAYMFEEFLAGWYEKLKSEEPTTMTVRLQKDIDKYKNVLPVLKWVRGEPLSQDHWLELFRMLGMPKGTTLEKLNFGDILSSSDAIIINATALKELNQRAQGEVTIREAIRELDLWGAGAVFALTDYQDSGSNKIMLIKDWKDLVNAVGDNQCLLQSLKDSPYYKSFEDKATVWETRLADLDEYLHNLNQIQRKWVYLEPIFGRGALPKEQGRFKRVDDDFRAIMYDVARDNRVLSLVGKVGLRNQLVTMLDQLQRCQKSLNEFLEEKRSIFPRFYFIGDDDLLEILGQATNPEVIQTHLKKLFAGIHSVNFDDGCKHIVAMKSLEGEVVPLKKKVQITPEVEVWLGYLAEEMKNTLKQLLTECLKDSKAGGQG--GLDPNKYPSQILCAAEQINFTEQCEEAIKTSSLQEFNIEMENKLESYTGVDLSAAGSDVGVYVLELKLKALILDTIHSIDVIQQLVEAKTRNLEDWQWQKQLRYYTR-RDGICVMRMVDAEFEYTYEYQGNAAKLVHTPLTDKCYLTLTQGMHLGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAISIQIQIIQDAIKEKKPTAELLGRNVDIDFNSGIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMARPDNELIAEVILFSEGFKHAKSLGRKLVAVFNLSKELLTPQQHYDWGLRALKTILKGCGNLLQTAKKNLQEG-----EKITDA-IEAKLVVQALRINTLSKLTFSDSIRFNSLLKDVFPGTEFKDIEYENLAQAIREVCKERNLVVNESQVKKALELYEQLRQRMGVVVVGPSGSGKSTLWRVLKEAMLKCGQVVKQYTMNPKAIPRTQLLGHIDMDTREWTDGVLTYSARQVVREPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDTDIKAFITSWMNTLPEAEQKTLAAWIEDYFYKGMDWVLKQGDFVVETTLVGVVMNGLSHLHGVQDKTHFAVSLIRGLGGNLSEATREAFAKEVFAWTHETPPDPRRP--LDTYYDPSSGRLMSYSVELRDDLTADNFTSSANL--PVIKTGDIQRGLDYFAPWLSAENKQPFILVGPEGCGKGMLLKYCFEQLRSTQIATVHCSAQTNPTHVLQKLNQSCMVISTNTGRVYRPKDCERLVLFLKDLNLPKPDKWGTSQLIAFLQQVLTYNGFYDSNLEWVGLEGVQIVASMNGGSTLGRHQLSTRFTSVVRICAIGYPEREQLQAIYSAYLKPVLHKQLSRHPVWGNPAKVHALAGSMVQVYEQLRGKFSVDDYSHYLFTPRDLTRWVLGLLRYDM-IASDTSVNPVLEVWVNEARRLFRDKIVGVDGLSRFDNILMSAVQGDWGVSGMEGIEGNYYVTWGGHHDASAPAVAPGAPLPPTGKPLGKLSGDDFKSVIQKGLLQYSRENRDLNVIIFKEVLDHMARLDRALSTPGGSLLMAGRSGVGRRSAVTLISFMHQLELFSPKVARGYGLKQFKTDLKTVMQKTGIDDEQVVLLLEDNQLVHPAFLELINSLLSAGEVPGLYTPEELDPLLAPLRDTASEAGYRGPLHGYFASRIQANLHVVLIMDCTNANFSMNCQSNPAFYKQCSVQWMDGWSRESMVKLPHLLLTQGPKMEGSSMSEPKER-KRKLSGGDELLKSFLHIHESCEVFGTATPRRYVSFLHTYMQVYNNKKNVIAERQHHVQAGVSKLNEAKSMVDDLKHKAAEQSKLLAEKTTEADAALKEITERMSNASEQKTEMEQIKAQVAEENIKLEQRKKAIDIELSEIEPLVREAKAAVGSIKTEQLSEIRALRAPPDVIRDILEGVLKLMGINDMSWNSMKSFLAKRGVKEEIQQFDARKITPDYRKLVEELLDKRKESFDPKNAKRASAAAAPLASWVRANVKFSYVLEKIEPLETEQRHLQKNLEKAEAKLAKLQKALSEVDQEVERLRNRFEKFTREAEHLKIELEKEEKTIEDAENLVGKLDGEYRRWNDQVGELTAELGELPMRALLASAFISYLSAEPEDVRRNMLQQWMDMAGVKGFDMRRFLSTESEQLIWKGEGLPSDDLSMENALVILQINNIAAGSSLRPFLVDPSSRATEWLKVHLKEHKLEVVNQQDGNFITALELAVRFGKTLLIQEMDGIEPILYPLLRGDLLSQGPRFVVQLGEKTIDYNEDFRLFMTTRNPAPEIPPDAASIISEVNFTTTRAGLTGQLLAQTIQHEKPELEVRKTELLKQEEDFKIELAKLEESLLENLANSKGNILEDKELLDSLNKTKQSSMTIVESLSESVRLQASLDQERGAYLPLAENGSRLYFVISDLAKINNMYRFSLAAFFRLFQRALKTGQPGASPEMKVKTLNDSLQTLVYEYVCRSLFKADRLMFALHMVHGMKPQEFKENEWELFTGLLVADVKADHSKQSRDIPAWVDQERPQALLLLKSTFPDLYQQLNFQDTDLWSNFARSSECEKEFPSAIAKKISLFQQVLAVQATRPDRLQSAMSLFAVKALSRTELSPPSVNLKRLYQNETLPAEPILIVISPGADPSQELEEMASEVIGKDKYHQVAMGQGQADIALQLLHDCARNGEWLCLKNLHLVTSWLPVLEKEINTMTPHQDFRLWMTAEVHPKFPTILLQSSLKITYEAPPGVKKNLLRTYENWSPEFITRGNNTVRAQALFALAWFHAVCQERRNYIPQGWTKFYEFSSSDLRAGSDIIDRLCNKGKGEVAWNFVHGLFEFAIYGGRVDNQFDNRVMVSYLKQFFEGGVLSGSSSKGKKLGPIKLPSTTHYRDYLDAIEGLPEYDKPSYFGLPENIERSAQKQVSSLVISQLKVVKRATVKGNKFDKEVWAHELSPVLNLWRKLNQGSQLIQMKITAPSEKSDHAMPISSFILLERYNAIKLVQSIHQSLAALSKVIRGTQLLTTDVQKLAEALLNQETPMEWQKKWEGPEDPIQYLHSLVARAMAIQEWVQKVETKMLLNETLDLSELFHPDTFLNALRQQTAREIKCSMDSLKFAASWKGSVQGARLSAKLGGLLLEGCTFDGQRLSENQRDSPSVSSVPPCVVAWIPKDSPDPYPPNEVIPLPIYFSSDREKIVINMNIPC-GGNQSQWLLSGAALFLKA 4317          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2962])

HSP 1 Score: 4319.23 bits (11201), Expect = 0.000e+0
Identity = 2219/4281 (51.83%), Postives = 3015/4281 (70.43%), Query Frame = 3
Query:  240 FID--NKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWND---SLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQS-KTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKS--LMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDL-PVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWG-SREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPK-WIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVN--GSGNFYGKIQL------PSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            F+D  N+FI     +  D++   LVF K  P +IT +N++  ++V+T+ E+P+ +LY  ++ ++ P LL D       DP++Q L+SELE GLGS++R  L K S          GI +  DE  +W +   ++  SS  +  +  +EL   +   N E     S SL ++    EN   +L+D+W+     P YP+ RM+ LM+II + L R +Q +L  L  WED Y  V+E+L + + +C  W+  C+ L  + WK+Y PH W  D  L+   + N   RL E+  +R V E++  +L  R+ Q+      F+ F  + P+ YNPYTEP+W+ AV +F R I PAE     +LK+  ++    E PQQ L++FQ++ ++I RP +S  L  ERE LL +L    K LR DF    H +   K  P   +N  + ++ IVW +QL  K+   L +   +L  L GF  F +   +  E++  + QEQFE W++++   L D  +      +  R+MEL   DG L ++YS+RLV+L+REVR LS LG+ I   +  AA+  +KFY +A+ILKQVA FYNTI+ QMI  Q+ M+L+ A+ FE+++K +     + K  + W N +EL  +I +LQ A+  + ++NR LRK H    +K+  LMG+DLLRQQQ+WKD L E+R     +E+Q     +   W++H +HQLYKALEYQY +GLEALN+NLPEI +DL+++QGRLQF P FEE+++KY++E+K+FI++PNQF+G+  S PG + IF  +IERNA GF+  Y KAE LF RL +  + FKEW++LG +D+E   ++H     D+E+NFK +K KGKE+E+LP+  K+DCITVNC P+K  +D LIQ +FD LL +LRK+I+G I ++D+++T +++ LS RP++IDEI +A   H++    +  +  Q  ++E+ N LLR+VAGGG+D++S L+ KWDKFELMMES Q+M++EQ+EVMK ++L+R + + QD+ KF+ RW+ L+P  D+++SG   A   +++ I++KK E  EL   +  L +DCEHF +EP + +L  +  KD+ +   MW+ +EE+Q GL  +A++DW++FRS+ + FEE L  W ++LR   E  TM++ LQKE+D YK  +P+LK++RGE LSQDHWL++FRLL +P+G TLE L  R +L+    II  A  +K+LN +A  EV+IREA+RELELWGAGA F L+EY DS    ++LI++WR++ SQVGDN+CLLQSLKDSPYY+ F DK ++WE +L+DLD++L +LN IQRKWVYLEPIFG+ ALP+E++RF+RVD+DFR+IM DV R++R+ SL + +GM+N L T+ DQLQRCQK+LN++LEEKRS F RFYFIGDDDLLEILGQ+TNP VI++HLKKLF GI+ VDF+     I  MKSL+GE V LRN + I+S+VE WL  L+ EMK TL   L   ++ ++       G++ ++YPSQILCL+E I FT   E  + + N+  L+ EL+ KL+ YTN   S  +  T  V  LKLK+L+LD +HN+ ++ +LL+    +  +W W KQLRFY  S +Q C I MVDA         GNA KLVHTPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIF+GL+KCG+WGCFDEFNRLEEAVLSAVSMQIQ IQ+ +KN      LL + V +D NS +FITLNPAGKGYGGRQKLPDNLKQLFRPVAM+ PDN+LIAEVIL S+GFK  KELG KLVAIFNL+RELLTPQQHYDWGLRALKTVL+G  +LL++ K +   Q N           E+ L+VQALR+NT+SKLT+AD   F++L++DVFP +D K++EY+ L +A+    +E  +  +  Q KK LE+YEQL+QRMGVV+VGPSG+GKST+WKLLR AL ++   VK + +NPKA+ R QLLGHID+DTREW+DGVLT SARQVV+EPQE+ SWI+CDGD+DPEW+ESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E TDV SL+ +WL++++E ++  L  +++D+F+++LD + K+N+F + TS VGTV NGLS+L+ +  +  F V LI+GLGGNL+  SR+ FA  V     E  P+  K   L+ Y++   +RL  Y  +  + L ++   +   +  P+I TAD+QR L  F  WL     QPF+L GPEGCGK   ++L + F KL+S QV  LHCSAQT+ + VLQKL+  C+ ++S+TGRVYRP++SE L+LYLKDINLP+ DKWGTS +I+FLQQV+TY GFYD NLE+VGL+ +QIV SM++  ++GR +L++RFTSI      +    +QL  IY+AYL PVL+R +  HP WS   +V  LA +++++Y Q+K+KFTVDDYSHYLFTP  LTQWVLSLLRYDL P      A S+LE+++YE+ R+F+DR+VSS      D IL + I  +W  +V D+++D +FVTWG S E +    P P  GK LG+L +  L + I +G++ Y RE R+LD++ F EV D ++++DR L+ P GS+LLAG+SGVGRRT   +VSHMH   + +PK+ R Y LK FK DLK+ +Q AG+EG+  VLLLED+QF+ P +LE++NSLL+SGEVPGLY+ EELEP+L SLKD A++ G  G + NYF++R++  LH++LIMDC+N NF INC+SNPA ++ CSVQW+E WS  SM KIP ML++    +E           KT L  +D   S FL +H++C    +T   Y++F+++Y  IY  K+ E+  RQ H+Q G+ K++EAK +V ELK +AAEQS LL  KQ EAD AL++IT  MQ A+++K EMEKL  K  +E   + +RK  I+DEL  ++P V +A+ AV +IKS  LSEIR+LR PPDVIRDILEGVL +MG  DTSWVSM++FL KRG++E+I TFDAR IT E R  VEELL R K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LEKI PLE+EQ  L  NL   E +   LE  ++ V + V   ++ F+  T +AAKLE ++  A ETISAAE L+ +L+ E  RW  Q+ E++ EL+ L  +  LAAA + Y+ ++PED R+ K+  WME +GL+KFD+R FL +E EQL WK EGL SD+LSMENALVILQ +  PFLIDPSS AT WL+ H K+ +LE++NQQDS+F TVLEL+VRFGKTLIIQEVDG+EPVLYPLLR DLI+QGPR VVQ+GDK++DYN DF+LFLATRNP P +PPDA ++++ VNFTTT+AGL+GQLLALT+QH KP+LE  KT LLQ+EE+ KI+L+ +EESLL+ LA A GNIL NK+L+ SLN+TK SS  I  SL ES +LQ +LD+ERDA+LPLAE  S ++FVI+DL +INNMYRFSL SFLR+F RAL T + S  + +R  +L A L+ +VYEYVCRS+FK+D+LMFALH      P+LF+  EW+ FTG  + D       +P  +I    ++         P L+  L + D  LW  F++SS CE+EIP S+  KLSLFQ++L++QALRPDRLQSA++ F    L +K LSP  +NL ++Y  ET+  EP+L+IISPGADPSQ+L EL++  +G + Y+++AMGQGQAD+ L +L +C ++G+WLCLKNLHLVT+WLP+LEKELNS++P   FRLW+TAE H  F+ ILLQSSLKITYEAPPG+K NLLR+Y++W+ + ISK G   RA +LF LAWFHA+ QERRN+IPQGWTKFYEFS++DLRAG +I+D++  +  +  QW+ +HGL E+AI+GGRVDN  D+R +  ++  Y+  SV+       +  K ++             DY +++  L + + PSFF LP NI+RS+QRI S+QVI QLRIL R    G+KFD+++WS  L+PVLN WK LNQG ++I+  +  S    +  SPV++F+QLE++N+I+LV+ +H SL SLSKV++G+ LLT +V  L+  LL  + P  W  +WEGPE+P  Y+R ++ +A AV+ W +  EK+ L S  LDL ELFHPDTFLNALRQ TAR +  SMD LKFV  W G    +K  VK+G L +EGC FDG  ++E   DS S+  +P   + W+ ++ P  YSE++ + LP+Y    R ++VT + +PC  G  D+WIQSG ALFLK
Sbjct:   38 FLDDANQFILVTS-SDGDQLQRVLVFFKLHPCVITEENVSRAVLVSTMLESPVHTLYQTLRQVFNPALLQDEKWSQAFDPRLQSLLSELEEGLGSVLRHTLPKDS----------GIVTPSDEFQYWAELGQTVEKSSKRERAAHFSELFKPIDYSNLE-----SLSLLDALELAENSRDVLDDVWRQNEHTP-YPEIRMRRLMDIIGSSLGRFVQKKLCVLHLWEDPYLTVRENLREGVTLCEQWVTACEHLTGQLWKRYSPHLWEGDK-LHPHGLKNLIQRLEEVLQIRAVQEKLQHLLSERQ-QQVSASRVFEPFSGLNPVLYNPYTEPLWRAAVSQFERLIAPAEEEAARKLKIYIRDVQ--ESPQQCLQVFQKHREIIKRPTVSKELQSEREILLTRLQDFCKGLRADFESRCHGAPGEKTGPLAGRNLPEVVNNIVWVRQLLMKVENSLKMGEALLTGLLGFGGFARFCADLQEQLKVYEQEQFEDWSRDLLSGLADPKSG-----ISNRVMELDHMDGKLKIHYSERLVSLLREVRQLSALGFSIPTKIQQAANTAEKFYRQALILKQVAHFYNTIDQQMILSQRPMLLNYALAFEQVIKVLQHHYYRGKMQITWENTKELELYISRLQNAAEKLSAENRKLRKWHTNFIDKVGVLMGVDLLRQQQRWKDGLQELRTGFATLESQGIRVSDMRAWRQHWNHQLYKALEYQYQVGLEALNKNLPEIHIDLIFKQGRLQFRPPFEEVRAKYYRELKRFISIPNQFRGV--SEPGEEPIFSHMIERNANGFLTVYSKAEVLFSRLLSVQDTFKEWVVLGQVDMEALAEKHLHSAQDWERNFKTLKAKGKESERLPSVEKVDCITVNCEPVKTVIDDLIQKLFDTLLATLRKSIQGHIQAIDSFVTGAMETLSTRPESIDEIGDANAKHSQLQAKKPEVVPQFQQAEEKNRLLRSVAGGGVDSISSLRAKWDKFELMMESHQLMIKEQVEVMKESVLTRVQVYLQDLQKFHLRWEQLRPSDDVIESGDHAALQRSLESIQEKKEEFNELEETRKKLLEDCEHFNLEPPDVSLAYDTMKDLQECSEMWALYEEFQNGLNQIAQQDWITFRSKTHEFEELLFAWHDRLRKLQEHNTMSVMLQKEVDKYKAAVPVLKYVRGEHLSQDHWLDLFRLLGLPKGTTLEKLLFRDLLNVTHTIIDKALELKDLNSRAHAEVSIREALRELELWGAGACFSLLEYRDSSGVQLNLIRDWREVFSQVGDNRCLLQSLKDSPYYQSFHDKVSLWETRLSDLDDFLHSLNAIQRKWVYLEPIFGRGALPREQARFQRVDQDFRAIMGDVQRDSRMTSLTARAGMRNTLVTLQDQLQRCQKSLNDFLEEKRSAFSRFYFIGDDDLLEILGQATNPTVIQTHLKKLFAGIHSVDFDTSFSKITAMKSLEGETVPLRNTITISSDVEVWLSGLSTEMKETLKSLLCECVRAVKRG-----GVDPNRYPSQILCLAEQIQFTEDVENAIRQQNLHQLELELIAKLDHYTNTDTSSESGGTSSVLQLKLKALVLDVIHNLSVVRELLETQVHNTDDWLWKKQLRFYLNS-EQHCTIHMVDA---------GNAAKLVHTPLTDKCYLTLTQAMRMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLMKCGAWGCFDEFNRLEEAVLSAVSMQIQAIQNSLKNHTATCQLLGKEVELDPNSGVFITLNPAGKGYGGRQKLPDNLKQLFRPVAMTTPDNELIAEVILYSEGFKEGKELGCKLVAIFNLARELLTPQQHYDWGLRALKTVLRGCGSLLQLQKKQQNNQNNIK---------ESGLVVQALRLNTMSKLTFADSSRFDALVRDVFPGVDFKDVEYEALNAALLAAYEEARLEVIPSQIKKALELYEQLKQRMGVVVVGPSGAGKSTLWKLLRAALGRLDLQVKQHTLNPKAMQRHQLLGHIDMDTREWTDGVLTASARQVVREPQEVSSWIVCDGDVDPEWVESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDTDVGSLLKAWLRREEEQNRVNLENWINDYFHRALDLVFKQNDFVVETSLVGTVLNGLSHLRGVCERGQFVVGLIRGLGGNLHLKSRQEFAKEVLSWARESPPDPRKP--LDVYYDSDSSRLRAYELQRGDGLCVEDFSNPYTL--PVIHTADMQRALHVFTHWLRPGHTQPFLLVGPEGCGKGYWMLLRYAFSKLRSTQVAVLHCSAQTSSLQVLQKLSHTCVCLSSSTGRVYRPRDSETLVLYLKDINLPRPDKWGTSNIITFLQQVLTYHGFYDENLEWVGLENIQIVASMSAGGALGRHTLTSRFTSI----RGAIAPLEQLQTIYSAYLSPVLQRTLGNHPTWSSAGRVHQLAGSLVQIYEQVKAKFTVDDYSHYLFTPCVLTQWVLSLLRYDLTPGKCVTPADSVLEVIAYEARRLFRDRIVSSKDLNAFDNILSSVIRGDWGSDVLDNMSDTFFVTWGASHEGRNPNQPLPPYGKPLGRLNTSDLTEVIRKGVVMYGRENRELDLLFFPEVLDFMSRVDRALSSPAGSLLLAGRSGVGRRTAVCVVSHMHGATIYTPKISRSYSLKHFKTDLKTVMQFAGIEGQQTVLLLEDYQFVHPSFLEMVNSLLSSGEVPGLYSAEELEPLLSSLKDQASQDGFTGPIFNYFSNRVQQNLHVVLIMDCTNENFTINCESNPALYRKCSVQWMEGWSESSMKKIPEMLLSGAGEQE----------EKTSLN-ADFFRS-FLRIHESCREFGATPSQYLSFLRVYQSIYSTKQKELTQRQQHLQAGVAKLNEAKSLVDELKRRAAEQSVLLKTKQAEADAALQEITLSMQNASDQKTEMEKLKGKMAQEVAKIEERKEKIEDELKEVQPLVDEAKQAVGNIKSESLSEIRSLRMPPDVIRDILEGVLRLMGIFDTSWVSMKSFLAKRGVREDIATFDARNITHEIRQSVEELLHRNKASFDPKNAKRASAAAAPLAAWVKANVQYSHVLEKIQPLESEQAGLMENLRKTESRKNKLEGQLNSVGEKVLELKEKFQCRTTEAAKLEADVSRAQETISAAEKLIHQLDGEHTRWTTQVDEISEELATLPKRVQLAAAFITYLSAAPEDHRRAKLHTWMENSGLQKFDLRHFLCSESEQLIWKSEGLPSDDLSMENALVILQSVACPFLIDPSSRATEWLRIHLKEHRLEVINQQDSSFMTVLELAVRFGKTLIIQEVDGVEPVLYPLLRRDLIAQGPRYVVQIGDKVVDYNEDFRLFLATRNPSPFIPPDAASVITEVNFTTTRAGLRGQLLALTIQHEKPELESEKTKLLQQEEEKKIQLALLEESLLETLATAQGNILENKELIESLNQTKASSALIHDSLSESHRLQTALDQERDAYLPLAERASMMYFVITDLCRINNMYRFSLASFLRIFHRALQTKQESDSTEVRIAALEASLKSMVYEYVCRSLFKADQLMFALHFVKGMHPELFQENEWDAFTGLIVGDMERAEEKLPANFI----SIHFHYRTPRSPSLYQSLCLNDSGLWMSFSRSSTCEQEIPSSIAKKLSLFQQVLVVQALRPDRLQSAMAAFASRALGMKELSPPPLNLRRVY-GETVETEPVLLIISPGADPSQELLELASDTVGRDNYHELAMGQGQADVALQVLRECVRSGEWLCLKNLHLVTAWLPLLEKELNSMQPKAGFRLWLTAEVHANFTPILLQSSLKITYEAPPGLKKNLLRTYESWTSNQISKGGQTARAQSLFCLAWFHAVCQERRNYIPQGWTKFYEFSLSDLRAGFDIIDRLF-EGGKVFQWECVHGLLESAIYGGRVDNVCDLRAV--FVLTYYLSSVLKILCQCKYLIKREMLKYSVCVCVVCVCDYRSVVESLPEDDRPSFFGLPANIERSAQRITSTQVISQLRILSRSVAAGSKFDREVWSSGLSPVLNLWKRLNQGSSLIQQKV--SPPAEAVGSPVLSFVQLEQFNAIRLVQSIHQSLASLSKVIRGTCLLTADVHKLATALLNQECPLSWQSKWEGPEDPMQYLRAVVARALAVQSWVDRVEKNTLRSDTLDLSELFHPDTFLNALRQETARAMGCSMDSLKFVASWKGQITGSKLQVKVGGLQVEGCTFDGNRLSENQHDSPSVCAVPACYMAWIPQSVPGCYSEEECVWLPVYTSAERVRVVTNVQLPC-GGNPDQWIQSGAALFLK 4235          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1246.49 bits (3224), Expect = 0.000e+0
Identity = 964/3539 (27.24%), Postives = 1712/3539 (48.38%), Query Frame = 3
Query: 2772 IKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR----TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMW-------SQFEEYQTG-LQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK---DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSNYGINADKYPSQILCLSEMIHFTA---RC----EELLNENNIITLKKELVKKLNIYTNA-KMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQT-------VKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTV------YNGLSNLKAIKNKAH-----------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDT--QQPFILSGPEGCGKSLMLNHCFQKLKSVQVT--TLHCSAQTTPVHVLQKLNQACI--IINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKD-TIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFS-------------TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAP----LENEQNQLKRN---LENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM-QLWMEK-TGLE-----KFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF-TGTFISDKSDR-NITVPKWI---DADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSG-TRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRD-----YLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSST-----DSP----VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDEL--KFVCRWGGSN---VSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRD------KIVTKIDIPCQSGQQDKWIQSGVALFL 12986
            + +  + ++C+P+K S+       Q  F  LL+ +       +  + ++L ++   LS+ PQ + E+ E          D ++I SQI    +   +L     +V     D +  L  +W  F+ ++    +M+++  +  K+ +    ++F++ +      +    P       GS  +   A+++I   + +LE L   +  +      F+ E      ++ + KDID    +W       + ++E++ G   +L  E+  S     Y   + L +   +L++ +   +    +  I+ +K  IP++  +R   +   HW ++ + +           TL  I+    E  +HAE I E++  A+ E++I +++  +          +  Y D         K   ++   + DNQ  L ++K S + R F+ +   WE  L+ + E ++ +  +QR+W+YLE IF     +  LP E + F  ++  +++IM  +N++N  L      G+   LS M  +L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP  ++ HLKK F  I  +  NK   +      M S DGE VE  + VL+   VE WL ++   M+ TL D L      L+ M+ + +  +    +P Q+L  +  I +T    +C    +E  +++ + ++KK+ V  L+ Y++A + +LS      +  LK+ +L+   VH  D+ID+L    C  V  ++WL QLR Y +     C+I+  +  F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC +G+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +   +       R + +  +  IFIT+NP   GY GR +LPDNLK +FRP++M  PD+ LIAE+ L  +GF N K L +K+  ++ L+ + L+ Q HYD+GLRAL ++L+ A       K +++    D            ++++ +++   ++KLT  D   F  +I+D+FP ++   I+Y  L   IEE + +  +        K++++YE    R   +IVG +GS KS  W++L+ AL+ + +        V  Y +NPKA+   +L G  D+ T EW+DGVL+   R    + +  + WI+ DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  DL+ ASPAT+SR GM++        K  V SW+ K+ + +   L    D +  K++ +     +  +  + +  V      Y+ L++ +   N A            F   LI  +  +++E+ R+    ++ E+ +   P  NK  +  YY + K     ++  +  +           KI+ P   T D  R    +   +NS    Q P +L+GP G GK+ +     Q L   + T  T++ S+QTT  +V     QA I   +   T   Y P   ++++ +L D+N+P +D +G+   +  L+  I Y  +YD  ++   +D    + +       GR+ +S R  S   L ++++P++ Q+  I+   +   L+    +  PI S      +L    +E+Y  + ++F       HYLF   D+++    LLR          +++ L I  +E  R+F DRLV     +    +L   + S + +   +   +     +G    +       +  K+L       L+D  +  G++  S       ++LF++  ++V ++ RV+++P G++LL G  G GR++ S L +++    +   ++ + Y  ++F+ D+K   +  GV+ +  V L  D Q ++  +LE IN++L+SGEVP LY ++E E +  +L D A +        ++ NY  +R+++ LHI+L M      F    +  PA     ++ W  +W +D++L++    ++ +       +  N  K +T++         F+ +H +   +FS             T  +Y+  +  Y ++  +K+ E+  + + ++ G+ KI + +  V  +  +  +  K + E Q + ++ L  I    + A E++  +   + K G E +           +L    P +++A  A+  +   D++EI++   PP ++  +++ V+++ G  + +W   +  LG+    +++  FD   I+     ++ +  T  +  F P+   R S+AA  L  WV+A   Y      + P    L     QL      L  AE K +++E+ +  +           E     +  +E +L  A + +S        L  E  RW + +  L  ++  L    LLAAA + YM     + R+E +  +WM++   LE      F+   FL+      +W  +GL SD  S EN +++ +G   P ++DP   A  W+KN    R L++++ Q  +F  +LE +V+FG  +++Q V + L+P L P+L       G R +++LGDK ++YNPDF+ ++ T+   P   P+     + VNF   + GL+ QLL + ++  +P+LEE+K +L+      K +L ++E+ +L+ L  ATG++L++  L+ +L  +K ++  +S  LE S + ++ +D  R+A+ P A+  S LFFV++D+ +I+ MY+FSL +++ LF  ++  S+ S     R  +L       VY Y CR +F+  +L+F+ HM  C +           E+  F  G  + DK  + +     W+   + D    +  LA+    + S      D  WHQ+  SSE E   +P   +   +  QK+LI+++LR DR+   ++ F  + L  + + P  +++  + E  T +  P++ ++SPG DP+  L +L+        ++ +++GQGQA I   ++ +  +NG W+ L N HL  SW+P L+K +  L+    H DFRLW+++ PH  F   +LQ+ +K+T E P GVK+N+ R Y   +E   S+          LFSL +FH+I+ ER+ F+  GW   Y F+ +D    +E L  +       I W  +  L     +GG V + +D R+L++YI  YF +  VN    F+    LP+    RD     Y   I QL     P  F    N D +SQ   +  +   L  LQ   V  T       SRE        K+L    + ++  +P+ +   ST     D P    VV   +++RYN+  L+  + +SL  L K +KG  +++  ++ + +C+   + P +W + +   +    + R L  + +    WAE +    L      L     P  FL A+ Q +AR   +S+D L  +F+      N      K  V I  L++EG  +D      C  ++  + L+ P+        +       +M S P YY  +R         V  +D+   +   + WI+ G AL +
Sbjct:  999 LSVQFVLLDCSPLKFSLVQHCNEWQGKFTQLLSLMAST---RLKELHSFLQDNAHRLSQPPQTLVELVEGLKLLETLQGDLNKIESQIPPIHEQFAILEKYEVSVEREVQDLLEALNGEWQGFQQVVIDSDIMLKKHKDKFKSGLFFSAEEFKKKMQTTMQDFNSTGP------FGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMY---KNLNKLSRELKDKQWEIVEFS-KNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFDHNSAEFTLEKIVALGLE--QHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKD---------KGTEEVFQALEDNQVTLSTMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGEFVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVK--DWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSK-----ILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNP---GYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGK-----KRRVRPDIAD-----------EEILLMSMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQKMEVDHLKRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSLASPENGVNPADNENYGRMVELWFIFSLIWSICASVDEDGRKKIDNFLREM-EGTFP--NKDTIYEYYVDTKNKTWASFEDKLPKGWRYPSNAPFYKIMVP---TVDTVR----YHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNV-----QAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMK---MD--MFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQEFQEEVKPIGS------ILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWI--HECFRVFSDRLVDQADTEAFVALLAEKLGSLFDLTYHNICPNKQQPIFGDFLKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMS-------LVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGL-------ILGNVEKIQTKVA------RIFVTMHQSV-AQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGC-EPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCT--QPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSG-------LAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHM--CAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKD--WHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDST-TKTPLIFVLSPGVDPTGALVQLAEASGMGPSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEV-SENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTP--FFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQP-QVTSTTATGAGPSRED-------KVLEISAD-VRQKVPELVDYESTQKLLQDDPSPLNVVLLQEIQRYNA--LLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFW----LSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDNNLLFPPKDGVFIRGLYLEGAGWDKK--NSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLM 4403          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1127.08 bits (2914), Expect = 0.000e+0
Identity = 886/3170 (27.95%), Postives = 1536/3170 (48.45%), Query Frame = 3
Query: 3888 FQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSL---DGEVVELRNQVLITSEVENWLGNLNNEMKTT----LSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTF--IVHDLK------LKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEP-QEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWI---------AKRNEFTISTSNVGTVYNGLSNLKAI---------KNKAHFSVCLIKGLGGNLNENSRETFALWVYELT------DEKTPEMNKQ------NVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSD---TQQPFILSGPEGCGKSLMLNHCFQKLKS--VQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQI----VCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKL----LANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDN---TAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLND-VWFVTWGS--REXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANE--SGH-RGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEEN-VILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK-------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDG-LEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS-HCCRPDLFKPQ-EWELF-TGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVL------NIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKV-IGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSL-KPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNR----NIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYG------KIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSR--ELNPV-------LNRWKILNQGLNIIKASLPDSL------KRSSTD-SP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIG------NLHIEGCLFD---GTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDK-----IVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            F +  Y         ++    +I   + DN   LQS+  S +   F +    WE  L+ + E ++    +QRKW+YLE IF     ++ LP+E  +F  +D+ F+ IMSD  R+  +   C +    + L  + D L+RCQK+LN+YL+ KR+ FPRF+FI DD+LL ILG S+ P  ++ H+ K++  I  + F+          +L   +GEV+EL+  V     VE+W+  +  EM+ T      + + Y  Q     ++ ++ ++   Y   ++     + +T   E++  +  + + +K+ +K+       KM    D+    I   LK      L ++++  VH  DI+D  +  +     E+EW  QLRFY   K     ++   AEF+Y YEY G   +LV TPLTD+ YLTLTQ + M LGG P GPAGTGKTES K L    G   +V NC EG+D  ++G+IF GL +CG+WGCFDEFNR++ +VLS +S QIQ I++ +  +++      + +++D    IFIT+NP   GY GR +LP+++K LFRPV +  PD   I E++L S+GF  AK L +K+  ++ L+RE L+ Q HYD+GLRALK+VL  A  L        K    D  E+V        ++++ALR   L K  + D   F  LI D+FP +D   + Y N   A+E +++E     L  Q  K++++YE +  R   ++VGP+G GKS +   L  A  ++G   K Y +NPKA+   +L G +D  TR+W+DG+L+   R + +   ++ + +I+ DGD+D  W+E++NSV+DDN+LLT+ +GERI+   +   +FE  DL  ASPAT+SR GM+F+  +          W+  +   +Q  L    + +    ++ +          ++ +  +  +++  V      L A+         + +  F   L   LG  L E  R+ F   V +L+      DEKT     +       + +++F+    + + +S    + +       D K +  L+ T D  R       WL       ++P +L G  G  K+    +    L      V T++ S++TT + + + L  +   +   T   Y P   + L++++ D+N+P++D++GT Q I+ L+ ++   G YD   E   L+  Q+      +    +  GR+ + +RF S+  + +I +P ++ L+ IY++ LK   +    +  I +   K+      L  T+I+      SKF      HY+F   DL++     +   L +T+     T    + +   E +R+F DRL++   +    G + + I   +  E+  ++ D + F  + +   E +           +   L  E L+        +Y+     ++++LF +  D++ ++ R++    G  LL G  G G+++ + L +      +    + RGY    F+ DLK+     G+E +  V L  D    E  +LELIN++L SG VP L+  +E E +L  ++D A +  SGH + S+  YF ++    LHI+L M          C++ P       + W   W   ++  +    + + P    +  ++        + GS    S            + T ++Y++FI  Y  +   K   I  +   ++ G+ K+ EA   +A+L  K AEQ  +L EK    +  L++I++    A E+K   E+   +  E+N VIL ++K A +  LA   P ++ AR A+ D+  SD++EIR+   PP  ++ + E +L++ G  + +W + +  + +      +   D   I+      V   L     S +   A   S A + +  +V+A + Y     +I P   +  +L++N   ++++++ ++  +  + K +    + +     +   L+ E +     + AA+ L+  L +E +RW + + EL  +   L    L++AA + Y  +   D R E +    +K  LE+       F +   LT E E   W  E L  DELS++N ++  +    P  IDP   A  W+K   +   L+I +  D +F   LE+++++G   + Q+VD  ++PV+  +L  ++     RQV+ LGDK +DY+P+FKL+L T+   P+  P        +N+T T  GL+ QLL++ +   + +LEE++  L+QE  + K  L  +E+SLL+ELA +TGN+L+N +L+ +L +TK  +  + + L+ +      +D+ RD + P A+ G+ LFFV+++++ +N+MY++SL SFL +F  +L  S  ++    R ++++  L   VY Y C  +F+  +L+F+ +M+    + +   PQ E E F  G    +KS R      W+       I  L    P  +  L      N K+   W  F   S  +   P   ++ L++FQK+L+++  R DR+  A+S +    +  K++ P  ++   I+E  T  N PI+ I+SPG +P+ DL +L+ +   G+ R   +AMGQGQ  + L LL      G WL L+N HL+  WL  LEK L  + KPH DFRLW+T +P   F   +LQ SLK+  E P G+K N+  +Y     + +         + ++ LA+FHA++QERR +   GW   Y+F+ +D     EIL+  + K++     +I W  +  L    ++GGR  + FD R+L+ Y+  Y  D + +    F+         ++P   SK  Y+  I  L   N+P  F L  N +                       + T+  +D+W+   EL P        ++R + + Q    I+  LP +       K+   D SP  VV   +LER+N  +LV  +  SL  L + L G   ++ E+  ++  L  GQ P +W +      +   ++M     + +    W E+ E       ++ L  L  P+++L AL Q T R     +D               + + K G       L++EG  +D   G ++   ++    +V LP + V  ++ ++       + +  P+Y   +R       +V + D+   +     W+  GV L+L S
Sbjct: 1281 FSVQRYFKGTQERGYILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSDLQNLSDGLERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQPVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQK---KSRVDWMLD---YQGMVVLAGNQVWWTWEVEDVFQK--MSSGEKQAMKQYA----KKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNP---GYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGEL--------KRGSPDLNEDV--------VLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYALNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPPKEQADLRKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEPEDLSSEELECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEKTLAGPGEIPGYLPTLFDFHFDGTTKKWMPWSSLVAKYIH----NPDTKFIDILVPTVDTTR-----VNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEAS---VEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKE---LNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGHTRPF--EECIRNMCDKLTFCTLELYKTIIKDLPPTPSKF------HYIFNLRDLSR-----VYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILE--------EYNENKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAH-SETVIGHVCMVHGSVGEFSTLFQ-QKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDA-ESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQA--ISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPC-DWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNW--FDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQST-PNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIG---------------------YYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVSPTSVVLLQELERFN--RLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGE-----PAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVR--SKPKELVVQLPILKVIPIEAHR---LRLQNTLRTPVYTTSMRRNAMGVGLVFEADL-FTTEHHSHWVLQGVCLYLNS 4339          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1125.92 bits (2911), Expect = 0.000e+0
Identity = 870/3189 (27.28%), Postives = 1541/3189 (48.32%), Query Frame = 3
Query: 3801 IKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG-----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDI-----QHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTA-------RCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDL------KLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVK----FYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQD-EHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAH-------------FSVCLIKGLGGNLNENS----RETFA-LWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYS-----YECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVT--TLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIV-CXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGK------LTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLAN---YFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMG-----TMDTSWVSMRNFLGK-RGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKM---------QLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSH--CCRPDLFKPQEWELFTGTFISDKSDRNITVP-KWIDADRTVAISNLASAMPELWSVLNIKDDDL------WHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIG----SERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKEL--NSLKPHKDFRLWVTAEP------HIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXV---ILQLRILQRFSVHGTKFDKDIWSRELNPVLNR-WKILNQGLNIIKASLPDSLKRSSTDSP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILIL-------KAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSN-----VSAKYSVKIGNLHIEGCLFD---GTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKI-VTKIDIPCQSGQQDKWIQSGVALFLK 12989
            ++ +  +A  E+ + + + EL+       F    Y      S+ L+K   D++  + DNQ  LQ+L  S +  FF ++ + W+ +L+  D  +    ++QR W +LE IF      ++ LP++  RF  +D DF+ +  D ++   V+   +  G+ + L  +  +L  C+KAL EYL+ KR  FPRFYFI   DLL+IL   T+P  ++ HL KLF     + F  D      +  I M S + E V        T +VE WL  + + M+ T+  +++ A+       +  +  +   YP+Q+      I +T+       R EE   EN +    K+ V +LN             T ++  L      K+ ++    VH  D++ +++ Q  ++   + WL QLR     +++ C   + DA+F Y+YEY GN P+LV TPLTD+CY+TLTQ +H+ + G P GPAGTGKTE+ K LG   G  V VFNC E +D KS G I+ GL + G+WGCFDEFNR+   VLS V++Q++ IQD I++K +    +   +N+  +  IFIT+NP   GY GR +LP+NLK LFRP AM  PD +LI E++L ++GF  A+ L RK + ++ L +ELL+ Q HYDWGLRA+K+VL  A +L      + + Q                ++++ALR   + K+   D   F  LI D+FP +D+      +    + E + +  + +      K++++ E L  R  V +VG +G+GKS + K    +LNK  Q +K    +  +NPKA+   +L G I+  TREW DG+ +   R++         WI+ DGDIDP WIESLN+V+DDN++LT+ S ERI   P +  +FE   L  A+PAT+SR G+++++         V+SW+ K++ + ++  L+   D +    LD +  R +  I       V      L+ +    H             F    I   GG L ++     R  F+  WV E    K P  ++  V +YY + +  +   +S     +E + E+ +            L+ T +  R + YF   L  + ++P +L G  G GKS+++      L   + T   +  +  TT   +   L +    +    GR Y P  S+RLI ++ D+N+P++D +GT Q  + ++Q + Y  +YD S L+   +  VQ V C   +S S   +    R  S+    ++S+P  D LN IY + L   L R      +     ++  LA   ++ + ++ + F       HY+F   DL+     +L          T   L+++  +ES R+++D++V        D   F+ + SE   +  + + +       + E              +G+       + E L  T+   L  Y+     ++++LF +   ++ +++R+L  P G+ LL G  G G+++ + L + + ++++    + +GY +   K+DL +    AGV+    V L+ D Q  + ++L L+N LLASGE+P LY  +E+E I+ S+++     G   S  N   +F +R++  L + L          +  +  PA      + W  +W ++++  +    + ++   E  ++  + +K    +  S N  S    L +     ++T + ++  IK+Y  +   K+ ++  +   ++ G++K++     V +LK+K A Q   L +K  +AD+ ++ +    +  +  K   ++   K     V++ +++   +++LA  EP +  A++A++ +  ++L+E+++  +P   + ++   V+++M        D SW + +  + K     + +  F+   I       ++  L      F P+     S AAA L +WV   VK+     ++ P     N+    L +A++K+  ++  ++ +++ +A     FEK TAD  K + E +    TIS A  LV  L +E  RW + +     +   L    LL  A V Y+    +  R E M         QL +        D    L  + +   W+ EGL +D +S ENA ++      P ++DP      W+KN + D  L+++      +   +E ++  G+ ++I+ + + ++PVL PLL  + I +G  + +++GDK  +YNP F+L L T+   P   P+  A  + +NFT T+ GL+ QLLA  +   +P LEE K+NL +++   KI L  +E++LL  L++A+GN L + +L+ +L  TK ++  I + ++E+   +  ++E R+ + P A   S L+F+++DL+KI+ MY+FSL +F  +FQ+A+  +        R  +LI  +   V++Y  R +F+ D+L +   ++           P E +      +       +T P  ++       I  L S M E  ++    D D+      W +F +    E+E  PQ  KNK SL QK+ +++ALRPDR+  A+  F  + L  K++   S++    +E E+ +  P+  I+SPG DP +D+ E   + +G    ++ ++ V++GQGQ  +    L   ++ G W+ L+N+HLV  WL  LEK+L  +     ++FR++++AEP      HI     +L++S+KIT E P G+  NL ++ DN+++D +          + LFSL +FHA++ ERR F PQGW + Y F+  DL     +L   + ++N  + +  +  LF   ++GG + + +D R+  +Y++ +    ++ G         LP       Y   I+      SP  + L  N +       S ++   +L+++     S  G+   +D    ++  VL    + L +  N+++      + +    SP  VVA  + ER N   L + +  SL  L+  LKG   +T +++NL   +   Q P+ W ++       +  M  L L       + + +E W+     D  L   + L   F+P +FL A+ Q TAR  +  +D++   C     N        +    +  L +EG  +D   G ++     D+    L P + V ++     +     ++   P+Y    R    V   ++  +     KW  +GVAL L+
Sbjct: 1259 VRAIVDRAVKEMGMEKVLTELDATWTAMEFG---YESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNEPCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFD---YPAQVALTCTQIWWTSDVGLAFSRLEEGY-ENAMKEYYKKQVSQLNTLI----------TMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNP---GYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQ----------------VLMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLDFEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLK----SLNKTYQNMKRRPVWADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWIDKREIQSEKANLTILFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCHKELYELYFVFAAIWAFGGALFQDQLVDYRVEFSKWWVTEFKTIKFP--SQGTVFDYYIDPETKKFEPWSKMVPRFEMDPEIPLQAC---------LVHTTETIR-VSYFMERL-LERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKP---LEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFTINPRLQRHFSVF---ALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLA---LDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECM--KTPQDLVKVYLHESNRVYRDKMVED-----KDFSTFDKLQSEMVGKFYEDMEE-------ALEEAKVMNMYCHFALGIGEPRYMPVQSWESLNKTLLEALDSYNEVNAAMNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIE-PEVKDSVSKFMAYVHVSVNKTSKDY-LANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQ--DPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGD-NLQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKG--RYIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQP----GVTSPVDFLSHHSWGGIKALCS-MDEFRNL----DRDIESSAKRWKKFVECECPEKEKFPQEWKNKTSL-QKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFE-ESGAATPMFFILSPGVDPLKDV-EKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGSSQNFRVFISAEPSSSPEGHI-IPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYL-EANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELYLAPGFPLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRD---EKVKAVLEETLEKLPEEFNMVEL-----MGKVEERSPYVVVALQECERMNI--LTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKR------AYPSMCGLALWFTDLLNRIRELESWS----SDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLKKNREDFSSPPREGAYVHGLFMEGARWDTQAGVIV-----DARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQRGPTYVWTFNLKTKENPS-KWTLAGVALLLQ 4324          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 1081.24 bits (2795), Expect = 0.000e+0
Identity = 869/3172 (27.40%), Postives = 1540/3172 (48.55%), Query Frame = 3
Query: 3597 MTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEA-LTLRHILDA-ASEIIRHAEAIKELNQKAQGEVTIREAIREL-ELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKN----ALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDF--NKDIQHIITMKSLDGEVVELRNQVLITSE----VENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHD-------LKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKD-QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQ--EITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLAL---NKIG----QTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKK-----QDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNL---------------KAIKN--KAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYY---FNEKQNRLVTYSYECE--------EELSIDQLMSDK--KILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNH-CFQKLKSVQVTT--LHCSAQTTPVHVLQKLNQACIIINSNTGR----VYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQ-LKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKS---LGKLTS-EYLKDTIDRGLLQYSRECRD-LDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPI---LMSLKDLANESGHRG------SLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALK--KITSVMQGATER--KGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLI-----------MGTMDT---SWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVE-ELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT------GLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWE------LFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELST-KVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKP---HKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSY--DNWSE-DFISKTGSGTRA--NALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFY---GKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGL----NIIKASLPDSLKRSST--DSPV--------VAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF 12671
            M I++ ++I  +K+ IP++  +   G+   HW +M  ++N    LT  +  TLR +L    S  + H E I   +  A  E ++ +A++ + E W   +      +   + + +S++    +I + + D     Q+++ SP+ + F+ +   WE +L  + + +    ++Q +W+YLEPIF        +P+E   F+ VD+ +R +M    ++ +VL   S++G+   L    + L++  K LN YLE+KR  FPRF+F+ +D++LEIL ++ +P  ++ HLKK F+GI  +DF  N DIQ    M S +GE VEL  Q++ TSE    VE WL  + + M +++ D ++ +      + +S +     ++P Q++  +  +++T    E +            V  L  Y N   S   D   +V           L +L+   VH  D++ +++++     T+++WL QLR+Y  + + + C+I   + +  Y YEY GN+P+LV TPLTD+CY TL    ++ LGG P GPAGTGKTE+ K L      Q +VFNC +G+D  +MG+ F GL   G+W CFDEFNR+E  VLS V+ QI  IQ  I+ K++  +    E R+N +C  A  IT+NP   GY GR +LPDNLK LFR VAM  P+  LIAE+ L S GF NAK L  K+V  + L  E L+ Q HYD+G+RA+K VL  A NL    K K   +  D             L++++++     K    D   F  +  D+FP I +   +Y       +E  K+ N+  +K    KM++ YE +  R G ++VG   +GK+ +  +L   L   N+ G    + V++  +NPK+I   QL G  D  + EW+DG++  + R+        + W++ DG ID  WIES+N+VLDDN+ L + SGE IQ    ++ IFE  DLS ASPAT+SR GMI++         LVTSWL       Q + +  LL    +     +L  + K     +ST+N  TV + L+ L               K I+    A F+  L+  +GG+ + +SRE F  ++ E+   K  E      ++ +   FN+K   +  YSYE +         E   +  + DK  K+   ++ T D      +  + +     +P +  GP G GKS+ +       L   +     ++ SA+T+        NQ+  II +   +    V+ P   ++ I+++ D+N+P ++ +G    I  L+Q   +  +YD  +   + L  VQ++ S       GR++++ RF     +CS++  S D ++ I++  +   L+     +  +S  +++  +A T+ EVY + +++       SHY F   D ++ V   L   L   S     +++ +  +E  R+F DRLV    R     ++ N +   +          +       R         P    S     ++ S E     ++  L +Y++  ++ +++++F+ V ++++++ RVL +PGG+ LL G  G GR++ + L + M ++ L  P++ + Y + +++ DLK  L+ AGV+G+  V LL D Q  E  +LE ++S+L +GEVP L+  +E + I   + +++ +A ++G++       +L  +F +R +  LH+++        F    +  P+    C++ W + W  +++ ++    +  +   +  +  +     KT  T + +L+  FL   +     + T   Y+  I  +  +   K++ +   +     G+ K++ A+  V E+K +  +    L + +++  K ++  ++ SV   A  +  + E E  + K  E   +    K   + +LA   P ++ A  A+  +K SD++ +++++ PP  ++ ++  V ++            GT       W   +  LG      +++ +D   I      ++  E +T     FDP    +AS AA  L  W+ A   Y    + +AP +      +++L      +      + +V+  +A  +K  E+ T + A+L+F++      +  AE L+  L  E  RW+K   +L      LT   L++A  + Y+ +     R+   + W +          + F + K L    +   W   GL +D  S++N +++      P +IDP   A  W+KN  ++  L ++   D+++   LE  ++FG  L+++ V + L+P L PLL   +  QG    ++LG+ +I+++ DF+ ++ T+   P   P+    VS +NF  T  GL+ QLL + +   +P+LEE +  L+ +    K +L ++E+ +L+ L ++ GNIL ++  +  L+  K  S  IS+  + + K ++ + E R+ + P+A+H S LFF I+DL+ I+ MY++SL  F+ L+  ++  S  S     R   LI      +Y  VCRS+F+ D+L+F+  +   C   L   +E E      L TG  +  +++     P W+  D++      AS +P L  +           +         +P+   +KLS FQK++I + LRPD+++ A+S +    L  K + P   +L + Y +++ S  P++ ++SPGADP   L + +  K +G   +  +++GQGQ  I + ++    + G W+CL+N HL  SW+  LEK      P   H DFRLW+T+ P   F   +LQ+ +K+T E P G++ NLL+SY  D  S+  F S   +        L+ + +FHA++QER+ F P GW   Y F+ +DLR     L Q+   S   + ++ I  L     +GGRV + +D R+L + +  ++N  ++      +   GK   P  +   DY+  I  L     P  F + +N+D S         + Q ++L         FD  I ++            +  L    N I+  LP++    S     PV        V   ++ERYN+  L   +  SL +L K +KG  ++  E++ ++  LL G+ P  W ++     +P   Y+   + + K ++ W + ++ +     +  L   F    FL    Q  AR   I +D L F
Sbjct:  716 MCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVN--HDLTPNSGTTLRKVLKQNLSAYMEHFETI---SAAASKEFSLEKALQNMVETWDIISF----SHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQ---AMYSSEGERVELI-QLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQW---VREWPGQVVLCTSQMYWTQEVHEAIRSG---------VGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCII---NCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVA--ITMNP---GYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNL----KLKFPDENEDI------------LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLNTLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVS-LTRLFEMLLTEPVTEEPGNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWECPFNDK-GLVYDYSYEFKGKGCWIHWNESIKNVTLGDKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSA-------NQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLI-SAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQI--VAATL-EVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLL--LKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIA-QAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHER-QEVMLICKTFHTSAIHLSEKFLS--ELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQAL----KNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMT--NPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLL---CSNLLLAKKEIEYAEFMFLLTGG-VGLQNNVPNPDPNWLQ-DKSWDEICRASDLPGLQGLRYPPFCHFLPIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSY-NDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQL-QLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKD-------LQQTKLL---------FDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNN--LCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPN-----VFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSF 3783          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000600.1 (pep scaffold:Pmarinus_7.0:GL477903:500:65413:-1 gene:ENSPMAG00000000525.1 transcript:ENSPMAT00000000600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2566.19 bits (6650), Expect = 0.000e+0
Identity = 1255/2533 (49.55%), Postives = 1749/2533 (69.05%), Query Frame = 3
Query: 1815 VRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQ--WNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLL-----DQNCQSVTEWEWLKQ--LRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQN----RLVTYSYECEEELSIDQLMSDKKIL----TPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSD---NTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXX--XXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLAS------GEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPK 9329
            VR LS LGY I   V+ AA    KFY  A  LKQVA FYNTI+ QMIP Q+ M+L+AA+ FEK++K  GS+++  + VQ  W++PE+L  +I +LQ+A+ ++  QNR LR+ H  +C+K+V LM +DLLRQQQ+WK  + EIR  +   E      +N  PW  H DHQLYKALE QY  GLE L+ +LP+I  +L + QGRLQ  P  EE++S+Y++E+++F+  P  F G+   + G   IFP+++ERN   F+  Y +AE LF RL+     F+EW++LG +D+E  +++H   + D+E+NF+++KT+GK+AE+LP ++K+DCI VNC P++ S+DT IQ +F+ LL+SLR +I+  +  ++A+++   + LS +PQ ++EI +A   HA+      ++     + E  N LLR+V G G++ +S L+ +WD F+L + + +++++EQ++ M+  +++R     +D+ +F+ RW  L+P    L+S    A L  ++ +++++ EL EL+  +  L  DC HF +E     L++E+  D+ Q + MW Q+EE+ T L ++ KEDW+SFRSR ++FEEFL  W E+LR A  T + IRLQ ++D Y+ ++P+LK++RGE LS DHWLE+FRLL +PRG TLE LT  HIL++   I++HA  +KELN +AQGEV++REA+RELELWGA A F L E+ + +  S+ ++ EWRD++ Q+ D + LLQSL+DSPYYR F+DK  VWE++L+DLDE L NLN IQRKW+YLEPIFG+ ALP+E +RF RV  DF  IM +V+R+ R+L+L +  G+K  LS M+DQLQRCQKALN++LEEKRS FPRFYFIGDDDLLEILGQ+TNP VI++HLKKLF GI+ V+F+    HI+ M+SLDGE+V LR QV +T++VE WLG L  EM+ TL   L   L+     N  +  I+  +YPSQ+LCL+E + FT   E  L    +  L+ EL +K+  YT    + +A  T         S  +     + + D +L     D +   V    W +Q  ++    SKD  C + ++D    Y +  +GNA +LVHTPLTDKCYLTLTQGM MGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDV+++GRIF+GLVKCG+WGCFDEFNRLEE VLSAVS QI  IQD +K +    TLL  +V +D NS IFITLNPAGKGYGGRQKLPDNLKQLFRPVAM+RPDN+LIA VIL+S+GF +A  LG KL AIF+L++E+L+PQQHYDWGLRALKTVL+G  +LL+  + +   +  D          E+ L+V+ALRVNTLSKL +AD   F++L++DVFP  D+  +E+  L +A+ E      +  +  Q +K LE++EQLRQR GVV+VGPSG+GKST+W LLR+AL ++G+TV  + +NPKA+PR QLLGH+D+DTREW+DGVLT SAR VV++PQ++QSW++CDGD+DPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLS ASPAT+SRMGMIFLS E TDV++LV SWL +QDE  +  L   +++ FY++L W+ K++E  +  S VG V +GLS+L +  ++ HF+V L++GLG NL   +R  FA  V+    E  P+  +   L+ + +   +    RL  Y  +    ++     +          P++LTA  +R LD F  WL+    QPF+L GPEGCGKS +L   F +L+SV+V T+HCSAQT P HVLQ L QAC +++S +GR  RP++ ERL+L+LKD+NLP+ DKWGTSQL +FLQQV+TY+GFYD  LE+VGL+GVQ+V SM +  S GR  LS R +SI+R+  I YP  ++L  +  AYL  VL  + P HP+W   + VK LA +M+ +Y Q+++KFT DD++HYLFTP +LTQW L LLRYD P + D   ++A ++LE+ +YES R F+DRLV S AR   D  L + +HS+W       L D ++VTWG+     +      P  G+ LG+L+S  LK  I +GL+ ++RE R L ++LF E+   VA+ +RVL++PGGS+LLAG SGVGRRT + L + MH + L+SP++ R Y  KQF+ D+K  +Q AGVEG  + LLLED Q L P++LE++NSLL+S      GEVPGL++ EELEP+L  L++ A++ G  G + NYF  R++  LH++L+MD ++ +F + C SNPA  K C+V W++ WS+ +MLKIP M++++       + T+       +L G   L   FL +H++C    +T R Y+ F++ Y  +       +  R+ H+Q G+ K++EA+ +V ELK +AAEQS LL EK+ +AD+AL+ IT+ MQ  + +K EME+L     +E V++ +RK AID ELA ++P V +A+ AV  I+   LSEIR+LR PPD+IRDILEGVL +MGT DTSWVSM++FL +RG++++I TFD+R ITRE R  VEELL R   SFDPK
Sbjct:    1 VRQLSALGYTIPPKVLQAATTALKFYRHANTLKQVAHFYNTIDQQMIPSQRPMLLEAALAFEKIIKKSGSRAEGGSTVQVTWDSPEQLESYIAELQRAAETLTGQNRRLRRTHLDLCDKVVALMSVDLLRQQQRWKSAVQEIRHSICTKEQGGVRVDNMAPWLLHWDHQLYKALELQYQAGLERLHLHLPDIHTELTFTQGRLQLRPPIEELRSRYYREVRRFLGAPAAFLGVRGIT-GPTAIFPAMVERNEMRFLAVYMRAEALFARLADACTAFQEWVVLGQVDVEALIEKHLHTVADWERNFRSLKTRGKDAERLPTQLKVDCIVVNCGPVRTSIDTHIQQLFEGLLHSLRGSIQAHVQEMEAFISEGSRSLSTQPQTVEEIGDARRQHADLVARTPQLEPLFMEMEAKNRLLRSVGGAGVERLSVLRGEWDGFQLRLHNHELVLKEQVDRMRGAVMARVTSIARDVERFHARWMQLRPNASALESSDRGAGLRCLESLREQRSELHELLATRAVLVSDCHHFDVEEPNSELIDEVTADVAQYEAMWGQYEEFVTALSDMEKEDWISFRSRCHVFEEFLLTWHERLRKAAPTPVMIRLQSDVDRYRLVVPVLKFVRGEHLSADHWLELFRLLALPRGTTLERLTFSHILNSTDVILQHATELKELNSRAQGEVSVREALRELELWGASAAFSLAEHTEVEGGSVPIVCEWRDLLGQLADQRSLLQSLRDSPYYRGFEDKVQVWESRLSDLDESLHNLNLIQRKWLYLEPIFGRGALPREHARFLRVHNDFCDIMREVSRDMRLLTLVARPGIKRTLSAMLDQLQRCQKALNDFLEEKRSTFPRFYFIGDDDLLEILGQATNPTVIQAHLKKLFAGIHSVEFDDGCHHIMAMRSLDGELVPLRQQVEVTADVEVWLGMLAEEMRQTLKQLLVQCLK-----NGKSGDIDPSQYPSQVLCLAERVRFTGDVERALPALGLSQLEVELREKIQAYTRFTGTHTAVLTPPSSGSVRMSPSVCMSLCVPVTDPVLAKLVNDASKHLVITGLWQQQGVVKCLLTSKDI-CRVMLLDL-IQYNFNIEGNAQQLVHTPLTDKCYLTLTQGMRMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVRAIGRIFVGLVKCGAWGCFDEFNRLEETVLSAVSTQIHTIQDALKCRAHSCTLLGSQVVLDHNSGIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMTRPDNELIAAVILHSEGFTDAHALGAKLCAIFSLAKEVLSPQQHYDWGLRALKTVLRGCGSLLQSSRQEGADKKID----------ESGLVVRALRVNTLSKLAFADVALFDALVRDVFPGTDLGGVEHGELHNALLEACTHAGLAVVDAQVRKALELHEQLRQRTGVVVVGPSGAGKSTLWSLLRMALARLGRTVVQHTLNPKALPRAQLLGHLDMDTREWTDGVLTASARAVVRQPQDVQSWVVCDGDVDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSSASPATVSRMGMIFLSDEDTDVRALVGSWLSRQDEAVRDDLGELINEHFYRALSWVTKQSEQVVPCSLVGVVMSGLSHLHSCSHRTHFAVGLVRGLGANLPPRTRLDFAKEVFGWVGESLPDPRRP--LDVFVSSPASSEPPRLCCYDSDTASAVANATATATDAEEAWGPPPVVLTAHARRALDTFGPWLDERHPQPFLLVGPEGCGKSTLLRQAFSRLRSVRVATVHCSAQTAPHHVLQTLAQACALVSSGSGRALRPRDCERLVLHLKDVNLPRPDKWGTSQLSAFLQQVLTYRGFYDEALEWVGLEGVQVVASMTAGGSSGRHPLSPRLSSILRIACIDYPEAEELQAVCCAYLGSVLHAVAPAHPLWVATASVKKLAGSMLTLYQQVRAKFTPDDHNHYLFTPRNLTQWALGLLRYD-PSSGDRASSSADAVLEVWAYESCREFRDRLVGSRARDTFDAALASVLHSDWGSNPLPQLADAYYVTWGAHHMSVSAPGQPLPQHGQPLGRLSSTDLKSVIKKGLVHFAREYRPLRLLLFPELLAAVARAERVLSRPGGSLLLAGPSGVGRRTAATLAASMHGLSLLSPRVSRTYGSKQFRGDVKGLMQQAGVEGLQVGLLLEDFQMLSPEFLEIVNSLLSSGVFASIGEVPGLFSPEELEPLLAPLRESASQDGFTGPIYNYFTRRVQQNLHVVLVMDYTHPDFTLKCDSNPALVKRCAVLWMDGWSKQTMLKIPEMMLSEEEEVGSEEKTKERLG---KLPGGAELIRAFLHVHESCAALGATPRRYLAFVQRYQHVLTHTSTALIHRKGHLQAGVSKLTEARTLVDELKGRAAEQSTLLAEKRADADQALRDITTSMQNVSVQKAEMERLQETILQEAVLIEQRKCAIDLELAEVQPLVDEAKQAVGSIRPESLSEIRSLRMPPDIIRDILEGVLRLMGTFDTSWVSMKSFLARRGVRDDIVTFDSRSITREIRDSVEELLMRNATSFDPK 2509          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1186.02 bits (3067), Expect = 0.000e+0
Identity = 891/3385 (26.32%), Postives = 1624/3385 (47.98%), Query Frame = 3
Query: 3378 EHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLS----------FRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDF----------NKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFT---ARCEELLNENN---IITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLAL-----------NKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWL-----KKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYN------------GLSNLKAIKNK------AHFSVCLIKGLGGNLNENSRETFALWVY----ELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKI--LTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLK-SVQVTTLHC--SAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEF--------VGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVD-----DYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTS-EYLKDTIDRGLLQYS-RECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANES----GHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGS-QLTQNSAK--PKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATE-RKGEMEK---LTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT---GL---EKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS------HCCRPDLFKPQEWELF-TGTFISDKSDRNITVPKWIDADRTVAISNLASAMP-------ELWSV--------LNIK-DDDLWHQFAK------SSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKP-----HKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTR-ANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKR---DYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQ-LRILQRFSVHGTKFDKDIWSREL-NPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF------VCRWGGSNVSAKYSVKIG-----NLHI----EGCLFDGTMITECNRDSNSIVLL--------PPVSVGWVDKNQPNSYSEDDMISLPIYYDILR----------DKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            ++F++E   F  L E+  ++ + Q+MW   +E++     +  ++WL             S    + + + Q  + L    +  +   L+K+++  ++ +P++ ++R   L   HW  +  ++  P       LTL  +++   E+  +AE I++++ +A GE ++   ++++E     A F ++ + DS++  + ++    +I   + D+   + ++  S Y    + +   W+ +L   ++ L+     QR W+YLE IF     +  LP E   F +VD+ ++ IM  + R    L   +  G+ +        L++ QK L  YLE KR +FPRFYF+ +D+LLEIL Q+ NPQ ++ HL+K F  I  ++F                I+ M S +GE V L   +     VE+WLG +   M  +L      A+ + +   ++ + ++    PSQ++     + +     +C E  + ++   +   +KE  ++LN    +   L   +   +H   + +LI   VH  DI+  ++ +  ++   +EW +QLR+Y   +   CV +M  +++ Y YEY G  P+LV TPLTD+CYL L   + + LGG P GPAGTGKTE+ K L      Q +VFNC +G+D K MGR F GL + G+W CFDEFNR++  VLS ++ Q+  I++    KV       R + +    A FIT+NP   GY GR +LPDNLK LFRP+AM  P+  LIAEVIL S+GF++++ L RK+  ++ L  E L+ Q HYD+G+RA+K+VL  A +L        K +     E+V        ++++ALR + L K    D + F  ++ D+FP ++I   +Y +L S+IE  +K + + ++     K++++YE +  R GV++VGP+G GK+T++  L  AL           N   Q V   V+NPK+I   +L G ++  T EW DG++  S R  V +  E   WI+CDG +D  WIE+LN+VLDDN++L + + ERI+  P ++ IFE  DL  ASPAT+SR GM+++ SE       V +W+     K  ++  Q++++ + +++    L ++ K+    +   ++  V              G  +LK   ++        F  C +  +GGNL EN  + F  +V     E  D K P  +  ++ +YY +    RL  +      E  +     +K++     L+ T D  R   Y    L +  +   + +G  G GKS++      K++   Q   L+   SAQT+     + +      +      +      +R+I+++ D+N+PKLD++G+   I  L+Q   + GFYD    F             +Q  C+         +    R  S++ L S   PS+  L  I+ A    +L   +   P+      VK +A  ++E   ++  + + +       SHY+F   DL++ +  +L+ D     D   +    +  +E  R+F DRL++++ +   + +L      ++ V+V+      +FV                  +    LT  E LK  +   L  Y+    +++ ++ F++  ++V ++ R++ +  G+ LL G  G G+++ + L  HM   +    ++ RGY    F  DL+     AGVE +  V L  D Q +  ++LE IN++L SGEVP L+  +ELE +L + +  A E+    G+R  +  +F +R++  LHI+L M      F   C+  P+    C++ W  QW R+++L +        P + GS +L +N ++   +  ++ ++    Y+ +L       ++T   Y+  I +Y+ +  +K++++   ++ I+ G+ K+ E  E+V +L+ + +    +L +K  + +  ++K+ +  + A + R+  ME      VK  E   + A  +  +D+ L    P ++ A  A+  +  SD+SE+R    PP+ +R ++E + +++ +    W S +  LG     + +  +D   I+ E  IQ  ++    KD F P+  +R S A   +  WV+A   YS  L+ + P        +  L+     + D ++ +  V+  +   +  F+   A+   L   +      +S A  L   L +E  RW + + +   E++ +     +A+A V Y  +     R+  +  W+ +    G+     F +   L    E  +W  +GL  D +S EN +++ +G   P +IDP   A  W++N      L+I+   D NF   LE ++R G  ++++E+ + L+P L P+L       G R +++LGD  +DY+ +F+ ++ T+   P   P+    V+ +NFT TK+GL+ QLL+  ++  KP+LEE++  L+      K +L  +E+ +L+ L  + GNIL+N++L+ +L ++K +S  I   L+E+   +  ++  R+ + P+A  GS ++FVI+ LS+I+ MY++SL  F +LF   + TSE  +D   R   L+       Y  + R +F+  +L+F+  +       H    D     EW LF  G    DK         W+         +L   +P       E+ ++        L I+ + + W    K          E EI      +LS FQK++++++   +++  A++ F  + L    +    ++L  +Y+  + S  P++ ++S G+DP    Q  + ++  SER + +++GQGQ  I   L+ +  ++GDW+ L+N HL  SW+  +E+ + +L       H ++RL++++ P   F   +LQ+S+K+T E P G++ N+ R++   +  F  K   G      +F + +FHAIIQER+ F P GW   YEF+ +D      +L+  +   +  I W  +  +     +GGRV + +D R L + +KR+F+   +   G  Y    +  A+ ++   D+   I  L   + P  F + +N + + QR  +  ++   L +  R S  G     D   +EL + +L +  +IL+    +      D   R ++ + V+   +++R+N+  L++ + SSL +L K + G  ++++E++ +    L  Q P +W        +P   +++ L L+   ++ W +             +   F P  FL    Q  AR   + +DEL F      V R   S   A  + + G     ++ +    +G L  G  +     D   +V+         PP+ V   +  Q N   +  +   P+Y    R             V  + IP +    D WI  G AL  +
Sbjct:  823 KNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWE-----VFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPNNVVPL---LKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIEL--EVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKD--VFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGLKARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSG--LPSQVVLTVAQLMWCRDLTQCLEGGDHDHLQSVANFEKENFERLN----SLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNP---GYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSL--------KRENPHLREDV--------VLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVRVAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDKFGEDTGQYIMALF-ENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLGKGGPDLKMEHSRLTSIVCQTFVFCYLWAVGGNLVENCWDQFDTFVKHQFEENHDAKLP--SSGDLWSYYMDYDSKRLDPW------ERIVPNFRYNKEVPFFEMLVPTTDTMR-FGYLMEKLLA-VKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESK---LEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPS---PSEHSLKQIFQA----ILTGFLVDFPV-----AVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQI--FRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAE----YFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFT--PVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRY---YTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEAL----PALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVL-SKKPDWASAKQLLGDSNFLKRLTDYDKENIS-EDVIQKLKVYINNKD-FVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSD----AEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSAST-PLVFVLSTGSDPMGAFQRFAREMGYSERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECA--LLNLNLFCQDGRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLE-PGYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLE-QEVDRFNT--LLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFW-----ISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQ-NYQPDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKR-DSDYWISKGAALLCQ 4108          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006497.1 (pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 gene:ENSPMAG00000005847.1 transcript:ENSPMAT00000006497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 610/2399 (25.43%), Postives = 1092/2399 (45.52%), Query Frame = 3
Query: 2745 KEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLR----TVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSG-STQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDW------------LSFRSRYYLFEEFLTQW--FEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF--GKNA--LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLC-SMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFN-KDIQHIITMKSLDGEVVELRNQVLIT----SEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERR-VNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAH--------------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEK------QNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKS-VQVT-TLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY--DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAY--------------LKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLN-DVWFVTWGSREXXXXXXXXXXXXKSLGKL-----TSEYLKDTIDRGLLQYSRECR--DLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSL-----KDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN--SAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVI--LAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIM-------------GTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCK-DSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLEN-----------EQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISA 9611
            ++ + LP    +  +     P+K+++    +    A   +L +    + D V A+     K L++    ++++  A    AE      ++ S I   E+   +L     T      D V  L   W          Q  +      MK ++L+   +F +D+  F   +    PG    ++G + Q   D +Q  + +  +L       +  E   E F +   ++  L+ I +++   Q ++  +      +    +  W            L F+++     + L +W  FE L+            K+ID + +  P+L+ +  + +   HW  +  +      +  +   L++I++A   ++   + I+++   A  E  I   ++ +    +   F    +  S+   +    +  + ++ + D+  +L SL  + Y   F+     W  KL++  E ++N   +Q  W+YLE +F  G  A  LP+E  RF+ +D+ ++ IM   +    ++  C     +  LL  +++QL+ CQK+L  YLE+KR +FPRF+F+ D  LLEILGQ+++P  I++HL  LF  +  V F+ K+ + I++++S +GE V L   V+        VE WLG+L   +++T+   +  A   +       +      +P+Q+  L++MI        L N  N   +     +K     N  + ++         +K ++LI   VH  DI D L+  N +S  ++EWLKQ RFY   +   C+IQ+ D +F+Y  EY G   +LV TPLTD+CY+TL+Q + M +GG P GPAGTGKTE+ K +G   G+ V+VFNC + +D + +GRI+ GL + G+WGCFDEFNR+E  VLS  + QI I+    KNK  +    +   V +D    IF+T+NP   GY GRQ+LP+NLK  FR VAM  PD  +I  V L S GF++ + L RK   ++ L  E L+ Q HYD+GLR + +VL+              T G     N ++   E  ++++ LR   LSKL   D   F SLI D+FP I + +  Y  L  AI    K   +V       K++++YE  R R G++ +GPSG+GK+    +L  A+   G+  +   MNPKAI   Q+ G +D+ T +W+DG+ +   R+ +K  +    WI+ DG +D  WIE+LNSVLDDN+ LT+ +G+RI   PN   +FE H++  ASPAT+SR GM+F+SS   D + +V +WL+        +L + +D  F   ++++       +       +   +  LK +  +A               FS+    G    L + +R    L  +    +     N  ++  Y   +         R+  ++Y        D +     IL P     ++      F +      ++  +L G +G  K++M+     K  + + +T +L+ S+ TTP ++ Q+  ++   ++   G  Y P    ++ +++ DIN+P +++WG       ++Q++   GFY  +   EF  +  VQ V +M             R      + + + PS   ++ I+  +              +  +   L+P      Q +KVK+L            +KF      HY+F   DL++    +L  +  V   +    LL +  +E +R+  DR  +   +   +G +   +  +       S+  +V+FV +    P+  G  P        K+     +   L + +   L+QY+   R  ++D++ F +   ++ K+ R++  P G+ LL G  G G+++ + L S +         + R Y +     DLK   +  G +G+ +  +  D++  +  +LE +N++LASGEV  L+  +E++ I   L     K+         +L +YF  R++  LH++L        F       PA    C++ W + W RD++  +    + +   E   ++ +    A    Q   ++    YF          + T + Y++FI  Y  IY +K + +      ++ G+ K+ EA++ V++L  +   + K L      AD+ L ++TS  Q A   K +++K  VK   + ++  +A  KA  + +L   +P +++A  A+  IK +D+  +R L  PP +I  I++ VLL+                M  SW   +  +   G    + TF    I  E    V+ L+   + + ++ + A+      A L +W KA V +    +++ PL+             Q +L R     ++K ++L+   +  D AV    ++ +    DA     ++ NA   I  
Sbjct: 1151 QQVQDLPAHFAVGPVLAMTEPLKLALVQECRTWKRAFGAALNRKASASTDEVLAFSEAMAKHLARPICDLEDVRAAMAALAELRAAEIQMESAIGPVEEAFAMLAKYDLTFRDSSADRVDGLAYCWKNLMTQSVQVQNTLVILQPTMKADLLTGVAEFHKDLSSFQLDYDTQGPG----EAGIAPQEASDRLQMCQMQFDDLWRKFTTYSGGE---ELFGLPVTDYPELQRIRRELALLQKLYGLYNTVIESVDGYYEILWSDLDIEKINNELLDFQNKCRKLPKALKEWQAFEDLK------------KKIDNFNETCPLLEMMANKAMMSRHWERITNVTGHTFDIESDHFALKNIMEAP--LLTFKDDIEDICISATKERDIDAKLKAVVSEWSSQCFTFAPF-KSRGELLLKGSDTAEKVALMEDSLMVLASLMSNRYNVPFKPTIQQWVQKLSNTTEIIENWMMVQNLWIYLEAVFVGGDIAKQLPQEAKRFQNIDKSWQKIMQRAHEIPGIVVCCVGDETLAQLLPHLLEQLEMCQKSLTGYLEKKRLVFPRFFFVSDPALLEILGQASDPHTIQAHLLGLFDNVNQVGFHEKNYEQILSIESQEGESVTLVEPVMAQRGWQGNVETWLGSLLTGVRSTVHAVIRQAAAIIEDGAFKLHEFQTS-FPAQVGLLAQMIWTRDSEVALNNAKNDRKIMPATNQKFLDLLNELIDMTTRDLTKRERVKYETLITIHVHQKDIFDDLVRMNIKSTADFEWLKQSRFYFVEETDKCLIQITDVDFHYCNEYLGCTDRLVITPLTDRCYITLSQALGMSMGGAPAGPAGTGKTETTKDMGKCLGKYVVVFNCSDQMDYRGLGRIYKGLAQSGAWGCFDEFNRIELPVLSVAAQQIYIVLQCKKNKRTQFVFTDGDIVEMDREFGIFLTMNP---GYAGRQELPENLKIQFRTVAMMVPDRAIIMRVKLASAGFRDNQILSRKFYTLYKLCEEQLSKQVHYDFGLRNILSVLR--------------TLGAVKRSNPEEP--EKTVVMRVLRDMNLSKLVDEDEPLFMSLINDLFPGITLDKAGYPELEEAILAQTKAAGLVHHPPWVLKIIQLYETQRVRHGMMALGPSGAGKTCCIHMLMKAMTDCGEPHREMRMNPKAITAPQMFGTLDVATNDWTDGIFSTLWRKTLKAKKGEHIWILLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWRPIVQAWLQGLPTEQAQVLWSTMDSVFQDLINFVFTAVNPKMDILECMYIKQAIELLKGLLPEADERRLEHSHLQRLLVFSLMWSVGALLELEDRARMEAFLRAHPSHLDLPGSANDDSIFEYVVGDSGGWEHWNTRVPEFAY------PRDTVPEYSAILVP-----NVDNVRTDFLMQCIMKQEKAVLLIGEQGTAKTVMIKGYMNKYDAELHLTKSLNFSSATTP-NMFQRTVES--YVDKRMGTTYGPPAGRKMTIFIDDINMPIINEWGDQITNEIVRQLMENNGFYNLEKPGEFTTIVDVQFVAAMIHPGGGRNDIPQ-RLKRQFCIFNCTLPSNASIDKIFRTFAEGHFCPERGFPEEVNQLAVALVPTTRRLWQATKVKMLPT---------PAKF------HYIFNLRDLSRIWQGMLIMNSEVCRSSDM--LLALFGHECVRVIADRFTAQQDKDWFNGTMSKIMLDDHGTAAAASMEAEVYFVDFMRDAPEPTGEEPDDADLEAPKVYEPIPSFPQLAERLQAFLVQYNESVRGANMDLVFFADAMVHLIKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYSSFQITLSRTYNMSNLMEDLKQLYRKTGQQGKGVTFIFTDNEIKDEAFLEYMNNVLASGEVSNLFARDEIDEITQELIPVLKKEHPRRPPTNENLYDYFLSRVRANLHVVLCFSPVGEKFRARALKFPALISGCTMDWFQSWPRDALTAVAGHFLAEYRVECTPEVKRGVVDAMAVFQDMVAERCVEYFERFRRQT---YVTPKSYLSFIGGYKSIYSEKLSNVALLSERMRTGLSKLQEAEKSVSQLSRELEVKEKELAVASRRADEVLCEVTSKAQAAESVKQQVQK--VKDKAQAIVDEIAADKAVAEKKLEAAKPALEEAEAALQTIKPADIGTVRKLSKPPHLIMRIMDCVLLLFRRRVDTVVPEPERPCMRPSWSEAQKLMNFAGFLNSLLTFSKDTINEE---MVDLLMPYMEMEDYNLETARNVCGNVAGLCSWTKAMVTFFGINKEVLPLKANLIIQESRLAVAQGELDRAQAQLDEKQRELDAVQAMYDTAV----REKQILVDDAEACRRKMNNATALIDG 3463          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 591/2164 (27.31%), Postives = 1023/2164 (47.27%), Query Frame = 3
Query: 3606 RLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGK----NALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK--DIQHIITMKSLDGEVVELRNQVLIT---SEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQ-ILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQ-------TVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQ----DEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTV-------------YNGLSNLKAIKNK-------AHFSVCLIKGLGGNLNENSRETFALWVYELTDE-----------------------KTPEMNKQNVLNYYF-NEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKL---KSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLND--IYTAYLKPVLKRLIPKHPIWSQNSKV-KLLANTMIEVY-SQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHS----------------EWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANE-------SGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQL--TGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSK-AAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGE----ENVILAKR-KAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGT--------------MDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVE-ELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYM 9740
            +L+  ++ ++  +P+ + +   GL   HW  +  ++  P  LT E + L   L+   E         +++  A  E ++ +A+ ++        F L+ Y DS  + +S +    DI   + D+    Q+++ SP+ + F+     WE KL  L E L    ++Q  W+YLEPIF        +P+E  RF  VD+ +R ++     +  VL++ S+  M   L    + L+   K LN+YLE+KR  FPRF+F+ +D+LLEIL ++ +P  ++ HLKK F+GI  V+F +  DI H   MKS +GEVV+L   +  +    +VE WL  L   M  ++ + +  A++    + ++ +      +P Q +LC+S+   +T+   E +     +   +  + + N   +  + L          + L +L++  VH  D++  LL       ++++WL QLR+Y +  D     +M++A   Y YEY GN P+LV TPLTD+CY TL   +++ LGG P GPAGTGKTE+ K L     +Q +VFNC +G+D  ++G+ F GL+ CG+W CFDEFNR++  VLS V+ QI  IQ GI      +      + ++   A+FIT+NP   GY GR +LPDNLK LFR VAM  PD  +IAE++L S GF +A+ L  K+VA + L  E L+ Q HYD+G+RA+K+VL  A NL    K K  ++  D             L+++++    L K    D   FE +  D+FP + + + +Y  L  AI+E  ++ N+       +K+L++YE +  R G +IVG    GK+  +++L  AL  I +        V+  V+NPKAI   QL G  D  + EWSDGVL  S R         + W++ DG +D  WIE++N+VLDDN+ L + SGE IQ     N IFE  DL  ASPAT+SR GMI++       + L+TSWL  +        + L+    +      L ++ K  +    TS+   V             ++  + +KA+ ++         F   L+  +G + + + +  F   + EL                            P     +V  Y F  E + R   ++        I + M+   I+ P   T D  R     ++ +    Q+P +  GP G GKS+ + +   K     + +  T++ SAQTT     Q  N     ++     VY P + +R++L++ D+N+P  +++G    +  L+Q + +  +YD  +   + L+ VQI+         GR++++ RF       +I     ++ +D  ++T + + +      +    +  S + + L  + +EVY +  ++       SHYLF   D ++ V+  +   LP T    A S+  +  +E +R+F DRLV    R      +  TIH+                +  VE  D L  + F  +   +  A         + L  +   +L++         S+  + ++++LF+   ++V ++ R+L +P    LL G  G GR++ + L +HM + +L   ++ +GY   +++ DLK  L+ +    ++ V L  D Q  +  +LE IN+LL SGE+P L+  +E + I   ++ +  +        G   +L N F DR +  LH++L M      F    +  P+    C++ W + W  D++  +    +  +   E S+ T  S     +L  T +  L+  F          + T   Y+  I  +  +  KK+ E+   +   +VG++K+  A   VA ++++ AA Q +L     LEA   +    +V++  +E     E++ VK  E    E  + AK  K   D +LA   P ++ A  A+  +   D++ ++ +++PP  ++ ++E + ++ G               ++  W   +  LG     + +  FD   I       +  + +T  +  FDP   + AS AA  L  WV A   Y    + +AP + + NQ +  L  A   ++  ++ + +V   +AG ++  E      A LE ++    + +  AE L+  L  E  RW +    L    + LT  +L+++  V Y+
Sbjct:  705 QLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPL-LTQEQVCLEKFLEMNLE--SFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVD---DIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITH---MKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEW---VRAWPGQTVLCVSQAF-WTSEVHEAIRGGQQVL--ERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWE--DGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNP---GYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL----KLKYPSENEDI------------LMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNARPPPLSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDFHDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSGPLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWTEALSLAPPIPRDMNFNDIIVP---TLDTIRFTALMEMLVTH--QKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAA---QTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQIL-GAMGPPGGGRNAVTARFLRHFNTVTI-----NEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSR-VIQGVCLSLPETCP-VAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVE-DDDLRSLMFCDFSDSKDDAKRYVEVSDVERLRLVVEGHLEE-----FNNLSK--KPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDV---EVSEETLASCIDMCKLFHTSTIALSQKFQAEQQR--YNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQL-----LEAGIQVVNTMAVIERESEEVSRTERV-VKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLE--FDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYL 2795          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001370.1 (pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 gene:ENSPMAG00000001214.1 transcript:ENSPMAT00000001370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 565/2028 (27.86%), Postives = 953/2028 (46.99%), Query Frame = 3
Query: 3951 DIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF--GKNA--LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLC-SMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDI-QHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELL-NENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERR-VNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKA-IKNKAH------------FSVCLIKGLGGNLNENSRETFALWV--YELTDEKTPEMNK--QNVLNYYFNEKQNRLVTYSYECEE-ELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKL--KSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY--DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDI--------------YTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSS------DARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEY--LKDTIDRGLLQYSRECRD--LDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHN-------IKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRG-----SLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQN--SAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVI--LAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIM-------------GTMDTSW------VSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKD--SFDPKNAKRASIAAAPLAAWVKANVKYSYALEK-IAPLEN----EQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDF---EKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIY 9737
            +II+ + D+  +L SL  + Y   F+ +   W + L++  + ++N   +Q  WVYLE +F  G  A  LPKE  RF  +D+ +  IM+  +  N V+  C     M  LL  +++QL+ CQK+L  YLE+KR LFPRF+F+ D  LLEILGQ+++   I++HL  +F  I  V+F++ +   I+ + S +GE V+L   V+    VE WL  L  E + +L   +  A   ++ S  S      D YP+Q+  L   + +T   EE L N         +  +   +  N  +S++      V  +K ++LI   VH  DI D L   + +S T++EWLKQ RFY K      ++ + D  F Y  E+ G   +LV TPLTD+CY+TL Q + M +GG P GPAGTGKTE+ K +G   G+ V+VFNC + +D + +GRIF GL + GSWGCFDEFNR++  VLS  + QI I+    K +  + T  +   V ++    IF+T+NP   GY GRQ+LP+NLK  FR VAM  PD  +I  V L S GF +   L RK   ++ L  E L+ Q ++ +G+  +   LK    + + H S                       +++ R  ++ K+   D   F SLI D+FP I + +  Y  L +AI   +++  +V       K++++YE    R G++ +GPSG+GK+T    L  A+ + G   +   MNPKAI   Q+ G +D+ T +W+DG+ +   R+  +  +    WI+ DG +D  WIE+LNSVLDDN+ LT+ +G+RI   PN   +FE H++  ASPAT+SR GM+F+SS   D   ++  WLK++   ++  L +     F +   + A    F + T     +   L+ L+  I +K H            +   L+  +   L  + R    LW+  +E      P ++   ++ +  Y      + V +S   EE     D       IL P     ++      F I   +   +  +L G +G  K++ML     K   ++     L+ S+ TTP+   + +      ++   G  Y P   ++L +++ DIN+P +++WG       ++Q++  +GFY  +   EF  +  VQ V +M             R    + + + + PS   ++ I              +T  ++ +  +L+P      Q +K+K+L            +KF      HY+F   DL++    LL     V S  +   LL +  +E  R+  DR   +      + R  A         +  ++ V +    V F+                    + +  + Y  L+D ++  L QY+   R   +D++ F +   ++ K   VL    G   L   +  G     +L + +           +++P   R Y       DLK   + AG +G+ I  L  D++  +  +LE +N++L+SGEV  L+  +E++ IL  L  +  +   R      +L  +F  R++  LH++L        F       PA    C++ W  +W +D+++ +    ++    +   ++ Q   +     Q   ++    YF     +  V   T + Y++F++ Y  +Y +K  E++T  N +Q+G++K+ EA E VA L  +   + K L     +ADK LK++T   Q A + K E++K  VK   E ++  ++  KA  + +L   +P +++A  A+  IK SD++ +R L  PP +I  I++ VLL+              G +  SW      ++  NFLG       ++ F    IT E    + ELL    D   ++   A++     A L +W KA + Y + + K + PL++    +Q +L   + + +    +L+   +++D   AGY K     ++   DA +   +++ A+  IS        L  E ERW     E  A++  L    L+A A + Y
Sbjct:   49 EIIATMEDSLMVLGSLMSNRYNAPFKSQIQKWVSNLSNTTDIIENWMTVQNLWVYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMNNVVQCCVGDETMGQLLPHLLEQLELCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKTVEFHEKVYDRILAVCSREGETVQLDKPVMADGNVEVWLNALLKESQQSLHGVIRSAALAVQDSAFSLIEF-LDSYPAQVGLLGIQLLWTRDSEEALANARYNRKAMPQTNQAFLVLLNRLISMTTQDLSAVERIKYETLITIHVHQRDIFDDLCRMHIKSPTDFEWLKQCRFYFKEDVDKLIVWITDVSFIYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIDLPVLSVAAQQIAIVLTCKKERRSQFTFTDGDLVEMNPEFGIFLTMNP---GYAGRQELPENLKINFRSVAMMVPDRQIIIRVKLASCGFLDNIVLARKFYTLYKLCEEQLSKQVYWVYGILEVMYSLKTCKAMGKAHTSSTAQL----------------FCIRSYRRVSMMKVIDEDEPLFLSLIDDLFPGIALDKAGYPQLEAAINRQVEQAGLVIHAPWKLKVIQLYETQCVRHGMMALGPSGAGKTTCIHTLMRAMTECGSPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTTRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLDWSPILEGWLKQRSPQERETLRSLYAKSFLELYRYAAHSLSFKMDTLEAFVIVQSLNMLQGLIPSKDHGGEVTPEHLGRLYVFALMWSVCAYLELDDRRRMELWLRSHESMRLDLPAVSPHGEDSMFDYMVGADGQWVHWSSRVEEYAYPGDHTPEYNSILVP-----NVDNVRTDFLIHNIAKQGKSVLLMGEQGTAKTVMLKGYLSKYDPETHLAKNLNFSSATTPLMFQRTIES---YVDKKMGTTYGPPAGKKLTVFIDDINMPIINEWGDQVTNEIVRQLMEQRGFYNLEKPGEFTNIVDVQFVAAMIHPGGGRNDIPQ-RLKRQLSIFNCTLPSNASIDKIFGVIGTGHYSAARGFTEGVRALAAQLVPATRRLWQLTKIKMLPT---------PAKF------HYVFNLRDLSRIWQGLLNTTADVVS--SPELLLRLFKHECERVIADRFTCAEDTDWFEERLAAVASEELGAAAGEALAVGERAFFVDFLRDAPEATGDEPEDADFDMPKIYEPIASYDELRDRLNFFLQQYNESVRGARMDLVFFTDAMLHLVKFIPVL----GVTNLTLMTFDGHSLQDILSASLRTDSDPAVLTPVVTPA-SRSYSTSNLLEDLKVLYRVAGQQGKGITFLFTDNEIKDEAFLEYMNNVLSSGEVSNLFARDEMDEILSELAPVMKKQHPRRPPTQENLHEFFMTRVRLNLHVVLCFSPVGERFRTRALRFPALISGCTMDWFSRWPKDALVAVSEHFLSSYTMDCTVEVKQEVVACMGSFQDGVAEKCTDYFQRFRRSTHV---TPKSYLSFVQGYKTVYKEKHTEVQTLANRMQMGLQKLKEASESVAGLSVELEMKEKELQVANEKADKVLKEVTVKAQAAEKVKMEVQK--VKETAERIVDSISVDKAVAEKKLVAAKPALEEAEAALQTIKQSDIATVRTLGRPPHLIMRIMDCVLLLFQRRVNPVRMDPERGCVTPSWQESLKLMTAGNFLGS------LKQFPKDTITEE----MVELLHPYFDMPDYNIDTARKVCGNVAGLCSWTKA-MAYFFGINKEVLPLKSNLVVQQGRLNIAMGDLQSAQAELDAKQAELDLVQAGYEKALREKQELMDDAERCRRKMQTASGLISG-------LAGEKERWTNMSKEFAAQIKRLVGDVLMATAFLSY 2002          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 854.744 bits (2207), Expect = 0.000e+0
Identity = 688/2561 (26.86%), Postives = 1261/2561 (49.24%), Query Frame = 3
Query: 3549 FLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFR----------LLNMP----RGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCL-LQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVE--NWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWE--WLKQLRFYQKSKD----QGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEP----QEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTY----LDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLG---GNLNENS-RETFALWV-----YELTDEKTPEMNKQNV--LNYYFNEKQNRLVTYS--YECEEELSIDQLMSD--------KKILTP--LILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKES-ERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDS-NLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIIL-IMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKP-------KTQLTGSDNLNSYF-LDLHDTCPVEFS--TSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEME---KLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQV-----EELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQL-------KRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMR--------KFLTTEREQLEWKKEGLSSDELSMENALVILQGI-LIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRA-LNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPK 10925
            FL +  E  R  +   M   L  +++M   +  IL  ++   L   HW  +FR          LL+      + + +  LTL  IL            + ++ ++AQ E  I +++  ++ +   A ++++E+    ++ + L++EW D++ Q        L S+K S YY+ F+      E+KL  L E   N  ++Q  W+ L  I G+N      LP E S+F+ +  +++ I +   + +  + +  +      L   ID L+  + +L+ +LE +R  FPRFYF+G+DDLL+I+G   +   +   +KK+F  I  + F +D   I  ++S++GEV+ L  ++ +   ++   WL  L+ E+K ++  Q    L  L+  + ++  +   KY  Q + LS  + +T   E+ L  N      KE+  K+    + K++ S+D+       K+++L+++ +H  ++I QL  +NC +  E    W K  +FYQK+          I        Y +EY G   +L++TPL    + TLT  +H   GG  +GPAGTGKTE+VKA G   GR V+VFNCD+  D + + R+ +G+ + G+WGCFDEFNRL+E VLSAVS  IQ IQ+G++     ITLLE    +  ++A+FITLNP   GY GR +LP+NLK+ FR  +M  P +  IAE+IL   GF+++K L  K+V    L     +   HY +GLR LK VL+  + L+       KT                  +V++L+   L  L   D + F+  +  +F +     +    +   +++  +       +   KK ++ Y   + +  +++VG +G GK+  WK +  A+    G     YV++ K + +  L G +   T EW DG+ T   R+V  +     +  + W++ D D+DPE++E++NSVLDDN++LT+P+GER+   PN   +FET +L   +PATI+R G+++ S++   + S +   L K  E   + LS +    L D    S D  +  N FT S   V  +  G+     ++     +V LI        NL++ S ++   L +     Y L  + T E  +  +  +N YF      L  YS      ++LS     S+         +++ P  +I T D  ++   F   LNS  ++  IL GP G GK++++N+  +      V  ++ S  TT  H+L  L++    + ++ G    PK   + L+L+  +INLPKLDK+G+  ++ FL+Q++  +GF+ +   ++V ++ + IV + N  +  GR  +S RFT    +  + YPS   L+ IY  Y K + K L+P+   +++       A   + +Y++ K++++    SHYLF+P +LT+ V  +    +      T  SL+ + +YE+ RIF DRLV    +   + +L+ T+     +  QD L ++            +     +      ++    L + I+     +  E  ++ +++ + + D++ ++DR L +  G ++L G S  G+   +  V+ ++ +K++ PK+HR   L  F   LK  +    ++     L++++   LE  +LE +N+LLA+ ++P L+  EE + +L +L++     G        L ++F   I   LH++  I D +N N      S+PA F  C + W+  W   +M ++   +++ IP E    +     K        +T      N+  +F  + +    V  +  +  ++I+ ++  +++   K  +++  Q  + VG++K++E+   V EL    +++S  LTEK+ EA   L K+  + Q  +ERK E     K  +K  EE++   KRK  +   +  IEP + +A+  V +IK   L+EIR++  PP  ++ ++E V  I+G   ++W  ++ F+ K      I  +D    T   + Q+     EE L+    +++  N  RAS A  PL  WV A + +S  LE + PL  E  ++       K NL  AE+  +DLE  +    +  +   +D E    + + ++    N + +IS  + L F    E ERW     + +     L    ++++    Y     E +R +   L + K  L KF ++         +L T  E+++W + GL  ++  +EN  +++     +PFL+DPSS+    + N++ ++ + +++  +  F   LE ++RFG  +IIQ+ +  +P++  L+  +    G R  V++GD  +D + DFKLF+ + +P   +P    + V  V+F T K  ++ ++  +T+     +++ ++ +L++   + K++L  +E+ LL+EL N+ GN+L N +L+++LN  K+ ++ I + L ES +     D   + +  + +H   +F ++    + +  Y  S+  FL  F+R  +  S  +  +  R   ++  L + VY     ++ K  +++ A+ M    + D+ + ++++    T I   S+ +  VPK
Sbjct: 1268 FLRRADELPRAVKQFEMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEIL------------LTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEH----SSGLKLVREW-DVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDF--ITGVRSVEGEVLNLNEKIELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQLK--DGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGLLD-KLNKSSDNV----KKKIEALLVEYLHFNNVIGQL--KNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNP---GYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKT------------------VVESLKRVILPSLGDTDELVFKDELSKIFDSAGTP-LNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLSMFELDKLKDLISDSFDMASLTNIFTCSNDLVHIL--GVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKIFYDLLNS--KRGIILCGPPGSGKTMIMNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIYEIYYKAIFK-LVPEFRSYTEP-----FARASVHLYNECKARYSTGLQSHYLFSPRELTRLVRGVYT-AINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDK--YLPNQD-LGNI---------SSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTFCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTN-NKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKML-MEQNESERKQEATEEIKKILKVQEEDI--RKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDT---TLHMKPQIRKYMEEEFLSDPNFTYETIN--RASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQ---ANLDRSISLVKSLTF----EKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERAD--MLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTV-LLSFLEEGFVKRLENAIRFGSVVIIQDGEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCLYKFDI-ESEQYKEAVLTMIGVLSESSDGVPK 3735          

HSP 2 Score: 82.0333 bits (201), Expect = 2.162e-15
Identity = 52/195 (26.67%), Postives = 91/195 (46.67%), Query Frame = 3
Query: 11379 LHKCSQNGDWLCLKNLHLVTSWLPV-LEKELNSLKP---HKDFRLWVTAEPHIGFSTI---LLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGT-RANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIK-KSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDS 11936
            + K    G W+ L+N+ +  SW+   L K +   K    H+ F++++T   H+    +   LLQ + +  YE  PG+ + +    D W   F +   SG       F L+WFHA+I  R   +P G++K Y F+  D +  +  L+ ++   S  NI W  +       ++GG++D   D+ V++      F  S
Sbjct: 3829 ISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTC--HLTGDKLPAPLLQRTDRFVYEDIPGILDTV---KDLWGSQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFCGS 4018          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Match: EDO38992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBE7])

HSP 1 Score: 4618.53 bits (11978), Expect = 0.000e+0
Identity = 2341/4381 (53.44%), Postives = 3137/4381 (71.60%), Query Frame = 3
Query:  111 DQRKDTIFLITKSHF--PNQNSKFV---NEECLDKFFDNLDNNVLVVKF---IDNKFI-FSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSK--KSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQ------VNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRS-------RQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSV--GSQ--SKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSAD-STFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDL-PVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKS------------------LGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLK----------------------IPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISD-----KSDRNI--TVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNR-NIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSV-VNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            D RKD +     ++F  P  +S F    +   L+ F D+ ++ +L  +F     NK +   + +  +D     +VF K  P +ITPDN++  + V+++ ++PI++LY+ +Q I+ P+LL D       DPK+Q L+SELE GLGS++RK  +   ++    DE+ + GI +  DE  +W DS S S +D ++    E   F Q+      V+++   +    L+++   +E+    L+++W+ E   P YP+ RM  L+ +I   L R +Q +L+ L  W+  +  VKE++ + + VC  W+  C+ L  +YWK++  H W  +  +    +S    RL E+ +LRTVHEQ+ ++L   ERQ+ +  EAF  F  + PL  NPYTEP+W+ AV ++ R + PAE  I  +L+  F++ ++     QLLR FQRY +L+ RP IS  L  ERETLL QL ++ K +R+DF+ ++       + G  P  KN  + ++ IVW +QL++K+ E+L    ++L DL GF  F +E  +  EE+S++  +QFE W+ EM   ++D  +  + L   GRLMEL  +DG L V+Y DRLV L+REVR L+ LG+ +   +   +    KFY   ++LKQVA FYNTI+ QMIP QQ+MMLD+A+ FE+LVK+   GS   S  +  V W+ P EL  +I+KLQ A+  + S+NR LRK H+ I +K+VNLM IDLLRQQ +WK+ L ++R+I+  +       EN   WK H D QLYKALE+QY +GLE LNENLPEI+V+L +RQ RLQF P  EEI++KYF+EM+KFI++PN F+G+ + +   QL+    ++ NA GF   Y KAE LF+RL A    FK+W++LGS+DL+  VD+H  D+ D+E+NF+A+K +G++AEKLP  +K+DCITV+  P+K ++D  IQ +FDAL++SLR++I   + ++D +LT+ ++ LS RPQ ++EI EA L H E    + +I+   +K+E  N LLR VAGGG++ + QLQ +WDKFELM+ES ++M++EQ+EVMK+N+ SR + FQQ++ KF  RW  LKP +DI      QAC+ AV  +K++K E  EL      L  +C HF +    F + +++ +DI   + MW  FEE+ TGL+ LAKEDW+SFRSR +LF++FLT W E LR  E T MT+RLQK+++ YK+++P+LK++RGE LSQDHWLE+FRLL MP+G TLE LT   +L++A +I+ HA+ +KELN +AQGEV+IREA+RELELWGAGAVF L  Y DS    +S+IK+W+++++QVGDNQCLLQSLKDSPYY+ F+DKA++WE +LADLDEYL NLNQIQRKWVYLEPIFG+ ALP+E+ RF+RVD+DFRSIM DV+++NRVLSL    G++N L T++DQLQRCQK+LNE+LEEKRSLFPRFYFIGDDDLLEILGQ+TNP VI+SHLKKLF GI+ V F++  + II +KS++GEVV L+  V IT EVE WLG+L  EMK TL + L+  L   R    S  G++  K+PSQIL L+E + FT RCE  +   ++     E+  +L  YT+A +  S +     V +LKLK+LILDT+H+I+++  L+    +S+ EW W KQLRFY    +  C+I+M DAEF+YTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIFIGLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQ  +K+K+    LL R++++D NS IFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDN+LIAE I+ S+GFK AK LGRKLVAIFNLS+ELL+ QQHYDWGLRALKT+LKG  NLL+ HK         + E V  S  E +++VQALRVNTLSKLT+AD   F++L++DVFP +D+K +EY  LA A+    KE N+V ++ Q KK LE+YEQLRQRMGVV++GPSGSGKSTIW+LLRLAL KIGQTVK Y MNPKA+PRTQLLG ID+DTREWSDGVLT +ARQVV+EP +IQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FE+HDLSCASPATISRMGMIFLS E TDVK+LV SWL  + E ++ LL T+L+D+FYK+L+W+ K+ +  + T+ VG V NGLS++  ++ K  F   LI+GLG NL+  ++  FA  V+  T E  P+  +   L+ +++  + RL ++  E  + LS+D L+S      P+I T+D++R LD F  WL++D ++PF+L GPEGCGK ++L HCF++L+S QV  +HCSAQ++P HVLQKL Q C++I++NTGRVYRPK+ ERL+LYLKD+NLPK DKWGTSQLI+FLQQV+TYKGFYD NLE+VGL+GVQ+V SM++ + MGR S++TRFTSIVR+CSI YP   QL  IY+AYL+PVL + +  HP+W     ++ LA +M+ VY Q+++KFTVDDYSHYLFTP DLT WVLSLLRYDL P +SD++A  LLE+ +YE+ R+F+DRLV      R D IL + + S+WSV   D L   +FVTWG+     A   P  +GK+                  LGKL +   K  I +GL  Y+RE R+LDI++FKEV DN+A++DR LT PGGS+LLAG+SGVGRRT   LV+HMHNI+L++PK+ R Y LKQFKNDLK+ +Q AG++GE +  +LEDHQ ++   LELINSLL++GE+PGLY+ EELEP+L  L+D A++ G RG++ +YFA R++  LHI+LIMD S+ +F++NC+SNPAFFK C+VQW+EQWS++SM++                      IP ML+     +EG  +T + AK K   +  D L   F+ +H+ C  + +  R Y+ F++ Y  IY +KK  +  RQ H+Q GI K+++AK +V  LK KA EQS+ L EKQ EAD AL++IT+ MQ A+E K EME L  K GEE+V L KRK AI+ EL+ IEP V++A+DAV +IK   LSEIR+LR PP+VIRDILE VL +MG  DTSWVSM++FL KRG+++EI +FDAR+IT + R  VEELLT+  +SFDPK AKRAS+AAAPLAAWV+ANVK+S  LEKI PLENEQ QL+RNL+ ++++++ L + +  VD  VA  R  FE  T +A +L+ EL  A ETI+AAE LV KL+ EF RW  Q                     V Y+ S+PED R++ M+ W +   LE F++R+FL+TE EQL WK EGL SD+LSMENALVI++  + PFL+DPSS AT WLK + KD++LE++NQQDSNFST LEL+VRFGKTL+IQE+DG++PVLYP+LRGDLISQGPR VVQ+G+K+IDYN DFKLF+ATRNP P LPPDA AI+S VNFTTT+AGL GQLL +T+QH KP+LE +KT LL++EE+LK++L++ME+SLL+ LA+A GNIL NKDLL SLNKTK SS+TI++SL+++ ++Q +LD+ERDA+LPLA+ GS++FFVISDL+K+NNMYRFSL+SFLRLFQR+L T++ S+ + +R  +L + L+ LV+EYVCRS+FK+DRLMFALH+ H   P+LF+ +EWE F G  ++D     +S +N+  ++P W+++DR     +L +    L+  L+++  D W  FA+SS+CE+E P  +  K+ LFQ++L++QA RPDRLQSA++ F    L +K LSP ++NL ++ + ET+  EPILI+ISPGADPSQ+LQEL+ +++G +RY+QVAMGQGQADI +  LH C++NG+WLCLKNLHLVTSWLP LEKELNSL+PH+ FRLW+TAE H  F TILLQSSLK+TYEAPPG+K N+LR+YD+WS +F+ +  + TRA ALF L+WFHAI+QERRN+IPQGWTKFYEFS  DLRAG EI+D++   S   +++W+F+HGLF NAI+GGR+DN FDM+VL SY+ +YF  +V   GS  F            +DYL IIN L D + PSFF LP NI+RSSQRIISSQVI QL++L R  V   KFDK+ WS EL+P+LN WK LNQG  +I  K S P     + +DSPV +F+ LERY+++ LV+ VH+SL +LSKV++G++LL+ EVQ L+  LL  + P  W   WEGP +P  ++R L+ K  A+  W E SE   LL   LDL                    +K +MD LK    W G    AKY VK+G L IEGC FDG  +TE   DS S+  +P  ++ WV K+ P+ Y E + IS+PIYY+  RD IVT  ++PC  G Q+ W+Q G ALFLKS
Sbjct:    5 DSRKDFVLTTAANYFGVPISDSAFAEVSDSRELNAFLDDGNSPILAARFDTHQGNKTVELFDHVEPSDSAEKVIVFFKLQPEVITPDNLHQNVFVSSMLDSPINTLYHSVQKIFAPLLLKDEKWSRNFDPKLQSLLSELEAGLGSVVRKQNTSLARAVQPGDESSLGGILTPQDEFQYWADS-SVSGYDLSE---RERAGFFQECFQKGNVSQDFSNLDGLDLDDTLELVESTQDSLDEVWKQEDHKP-YPEHRMCHLLSVIGGALARYVQRKLSALDIWQGPFQNVKEAMRKGVSVCERWVSTCETLTAQYWKRFPAHPWKGEKFVP-ENLSQLAARLEEVLTLRTVHEQLVRLLSSSERQQLRTAEAFHPFSGLNPLHQNPYTEPLWRAAVGQYERGMAPAEQKIAGKLRQQFRDLSAQS--HQLLREFQRYKELVKRPSISKELAPERETLLGQLTVYVKSIRDDFLAKTQSSYSGDKDGGPPKGKNMPEIVNNIVWVRQLDSKVKEVLVTAESLLGDLAGFRGFRREASDLAEELSSYCTDQFESWSSEMLSAIEDPKHP-LGLQTSGRLMELGHQDGKLRVHYGDRLVTLMREVRHLAALGFVVPAKIQHTSQTASKFYRHGMVLKQVAHFYNTIDQQMIPSQQSMMLDSALAFERLVKNPKQGSNDASGHRTQVTWDKPSELEAYINKLQAAAERLTSENRRLRKCHYNISDKVVNLMSIDLLRQQPRWKEALVDLREIMTSLVQHGFKAENMRTWKMHWDRQLYKALEHQYQLGLEGLNENLPEIKVELTFRQQRLQFRPPLEEIRAKYFREMRKFISIPNHFRGVGEDNSFYQLM----VDHNAPGFSTVYSKAEDLFRRLVAVQEMFKDWVVLGSIDLDALVDKHLHDVADWERNFRALKARGRDAEKLPLSVKVDCITVSTVPVKSTIDDHIQQLFDALMSSLRRSITQEVQTIDTFLTSGMEALSTRPQTVEEIGEANLKHTELTSQKPQIQPLFEKAESKNKLLRNVAGGGVEQIGQLQARWDKFELMLESHELMVKEQVEVMKSNVESRVQAFQQELDKFAARWHQLKP-KDIDVDTDRQACIAAVTSVKERKAEFVELEETMKKLIFECSHFGVTEPHFPVADDLRQDISTTEDMWRLFEEFNTGLEELAKEDWISFRSRTFLFDDFLTGWGENLRTKEPTVMTVRLQKDVEKYKNVVPLLKYVRGEALSQDHWLELFRLLKMPKGTTLEKLTFGSVLESADQIVTHADVLKELNSRAQGEVSIREALRELELWGAGAVFSLTSYSDSHEKELSIIKDWKELVNQVGDNQCLLQSLKDSPYYKGFEDKASIWEGRLADLDEYLHNLNQIQRKWVYLEPIFGRGALPREQGRFKRVDDDFRSIMMDVSKDNRVLSLVGRPGIRNTLVTLLDQLQRCQKSLNEFLEEKRSLFPRFYFIGDDDLLEILGQATNPTVIQSHLKKLFAGIHHVGFDEGNKTIIAIKSIEGEVVPLKRPVNITPEVEAWLGHLAVEMKDTLRELLTQCLDISRKGGGS--GVDPSKFPSQILNLAEQVQFTERCEVAIKSGSLQEFLIEMESQLESYTSADVQGSGEPGDSHVLELKLKALILDTIHSIEVVQNLIKAGVKSLDEWMWQKQLRFYMHKGE--CMIRMCDAEFHYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQTIQAALKSKMASTELLGRQIDIDFNSGIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNELIAETIMFSEGFKEAKSLGRKLVAIFNLSKELLSKQQHYDWGLRALKTILKGCGNLLQSHKQ--------SGEKVNPS-IEARVVVQALRVNTLSKLTFADSRRFDALVQDVFPGVDVKGVEYMELAEALRAAAKECNLVVMETQVKKALELYEQLRQRMGVVVIGPSGSGKSTIWRLLRLALGKIGQTVKQYTMNPKAMPRTQLLGQIDMDTREWSDGVLTNAARQVVREPIDIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFESHDLSCASPATISRMGMIFLSDEDTDVKALVKSWLANRPEDERRLLETWLEDYFYKALEWVLKQGDLVVETTLVGMVMNGLSHMFEVRAKQQFVCSLIRGLGANLSVTTQTAFAKEVFHWTHEMPPDPKRP--LDTFYDSDRGRLASFELEVPDSLSVDDLISTTNG-QPVIKTSDVKRGLDMFSPWLHTDYREPFLLVGPEGCGKEMLLRHCFEQLRSTQVAIVHCSAQSSPAHVLQKLQQMCMVISTNTGRVYRPKDCERLVLYLKDLNLPKPDKWGTSQLIAFLQQVLTYKGFYDDNLEWVGLEGVQVVASMSAGTGMGRHSITTRFTSIVRVCSIGYPDHSQLQAIYSAYLQPVLHKTLRSHPVWGSVRNIQTLAGSMVFVYDQIRAKFTVDDYSHYLFTPRDLTNWVLSLLRYDLDPGSSDSSANLLLEVWAYEARRLFRDRLVGKQGLDRFDSILASQLRSDWSVSF-DRLETTYFVTWGAHTAMPANPAPGEEGKADGGAPVLSSGALPPYGRKLGKLETSDFKQVISKGLKTYARENRELDILMFKEVLDNIARVDRTLTVPGGSLLLAGRSGVGRRTAVTLVTHMHNIELVTPKVSRAYGLKQFKNDLKTVMQKAGIDGEQMAFVLEDHQLVDAAILELINSLLSAGEIPGLYSPEELEPLLSPLRDQASQEGFRGTMFSYFASRVRTNLHIVLIMDSSSPSFIVNCESNPAFFKTCAVQWMEQWSKESMIQSKCFVAQFVSASLYGASHHRWPIPRMLMP----DEG--VTADQAKGKK--SSGDELVKSFIAIHEGCDPKDAAPRRYMTFLQNYKAIYTEKKEGLVKRQTHLQAGISKLTDAKNLVDNLKQKAGEQSRKLAEKQEEADTALQEITTSMQRASESKSEMETLKQKQGEESVKLEKRKKAIEIELSEIEPLVQEAKDAVGNIKPESLSEIRSLRMPPEVIRDILEAVLRLMGIFDTSWVSMKSFLAKRGVKDEICSFDARKITPDIRASVEELLTKNANSFDPKLAKRASVAAAPLAAWVRANVKFSVVLEKIEPLENEQAQLQRNLDKSQQRLEKLGRALDKVDHEVAEMRNRFELRTKEATQLKMELDKAQETIAAAETLVSKLDGEFNRWTGQ------------------TGFVTYLSSAPEDVRRDTMKRWCDSMALEGFELRRFLSTESEQLVWKSEGLPSDDLSMENALVIMKSAVRPFLVDPSSRATEWLKTNLKDQRLEVINQQDSNFSTGLELAVRFGKTLLIQEMDGIDPVLYPILRGDLISQGPRFVVQIGEKVIDYNEDFKLFMATRNPNPDLPPDAFAIISEVNFTTTRAGLTGQLLGITIQHEKPQLEVKKTELLRKEEELKVQLAEMEDSLLETLASAEGNILENKDLLDSLNKTKASSLTIAESLQDAHRVQTTLDQERDAYLPLAQSGSTMFFVISDLAKLNNMYRFSLSSFLRLFQRSLETNQDSSSTELRIKALKSSLQLLVHEYVCRSLFKADRLMFALHLVHGTHPELFQEKEWEFFCGLVVTDMFKRQESMKNLRESLPSWMESDRAGPAGSLKNTFTTLYKTLDLESSDTWGSFARSSQCEQEFPSQITKKICLFQQVLVVQAFRPDRLQSAMNMFASKALGMKELSPPTLNLKRLVK-ETVPGEPILIVISPGADPSQELQELAGEIVGIDRYHQVAMGQGQADIAMQQLHNCARNGEWLCLKNLHLVTSWLPTLEKELNSLEPHEKFRLWLTAESHPKFPTILLQSSLKVTYEAPPGIKKNMLRTYDSWSPEFVQRGNNSTRAQALFVLSWFHAIMQERRNYIPQGWTKFYEFSFGDLRAGAEIIDRLCSDSGSGSVRWQFVHGLFANAIYGGRIDNTFDMKVLESYLLQYFEQAVFAQGSCLFV-----------QDYLEIINSLPDVDKPSFFGLPANIERSSQRIISSQVISQLKVLMRSDVVAHKFDKEKWSTELSPILNLWKKLNQGSQLIQMKVSPP---SETGSDSPVTSFVLLERYSAVTLVQTVHASLAALSKVIRGTQLLSAEVQTLAASLLRQEVPQEWTSIWEGPMDPVHWLRALVSKTLALGSWVERSEARTLLKDTLDLA-------------------LKTAMDNLKPAVAWKGGVPGAKYPVKLGGLQIEGCTFDGNALTENQNDSPSVSAVPTATMAWVPKDSPDPYPESECISVPIYYNSDRDSIVTCFNMPC-GGNQNYWLQCGAALFLKS 4293          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1220.68 bits (3157), Expect = 0.000e+0
Identity = 878/3186 (27.56%), Postives = 1586/3186 (49.78%), Query Frame = 3
Query: 2772 IKIDCITVNCAPIKMSVDTLI---QNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRS-------QIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFE-----------------KLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNK-----DIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENN-------IITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQ-------TVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQ-DEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAH-----------------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKL--KSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTM----IEVYSQLKSK-FTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKD-TIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRG---SLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQ-NSAKPKTQLTGS--DNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATER----KGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRC-KDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKE-KMQLWMEKT---GLE---KFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWIDA---DRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECER-EIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK---PHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRD 12002
            + ID + ++C+P+K ++ +     QN F  LL   R+     +  ++ +L  + K LS  P+ +DE+ ++     +   D   I +       Q    EK    +     G +D +S    +W  F+  +    +M+++  E  KT ++   ++F++ +    D +Q   P        S+    +A++++     ++  L   +T+L +    F++E      L+ + KD++  + +W+  +E++        E W +++   ++  E +T   E                 K +N EI      ++  I+ +K  +P+++ ++   +   HW ++   +  P   T +  TL  I++   +  +  E I E++  A  E++I +AI  +          +  Y D  +  +   K+  ++  Q+ DNQ  L ++K S Y + F+ +   WE  L+ + E ++ +  +QR+W+YLE IF     +  LP+E + F  V+ +++ IM  +N++   L      G+   L+ M  +L+  QK+L+ YLE KR +FPRFYF+ +DDLLEILGQS NP+ ++ HLKK F  I  +   +     D    + M S +GE VE  + VL+   VE WL ++   M+ TL + L +    L+ S  S       ++P Q+   S  + +T+ C + L+ +        + +LKK+ V  LN ++     +   S   +  LK+ +L+   VH  D+I++L+   C  VT +EWL QLR Y       CV++  + +F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR++ GL + G+WGCFDEFNR+   VLS V+ QI  I   +           R +N+  +  IFIT+NP   GY GR +LPDNLK +FRP++M  PD+ +IAE+IL ++GF N K L +K+  ++ L+ + L+ Q HYD+GLRAL +VL+ A              G     N   SD E  L+  +++   ++KLT  D   F  ++ D+FP I+   I+Y  L +AI   +K+           K++++YE    R   ++VG +GSGKS  W++L+ A+ ++ +        V+ + +NPKA+   +L G  D++T EW+DGVL+   RQ   + +  + WI+ D  +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  DL+ ASPAT+SR GM++        +  V SWL ++ D+     L    + F  K L++     +  + TS + +V +      A+  + +                 F  CLI  +  +++E+SR+    ++ EL  +      K  V  Y+ + KQ    ++  +       +  +   KI+ P + T         F ++     ++P +L+GP G GK+ +     QKL  K+  +  ++ SAQT+   V + +      +   T  VY P   +++I ++ D N+P  D +G+   +  ++  I Y  +YD   + V       + +       GR  +S R  S   L ++++P + Q+  I+   +   L+              VK L + M    IE+Y+ + +K        HYLF   D+++    LLR +  +    TA+S L +  +E  R+F DRL+ +  R+    +L + + S + +   +   +     +G+           +  K++ +   + ++D  ++ G++        ++++LF++  ++V ++ RV+ +P G++LL G  G GR++ + L S++   K+   ++ + Y  ++F++DLK     AGV+ +  V L  D Q LE  +LE +N++L+SGEVP LY  +E E +  +L D+A +   +    S+ ++F +R++  LHI+L M      F    +  PAF    ++ W  +W  D++L++    +  I  E G + T+ N A+    +  S  D      L+L       + T  +Y+  +  Y  +  +KK E+    + ++ G+ KI + +  V  +  +  + +  + E Q + ++ L  I    + A E+    +   EK+ ++  +  V+    +  +D+ +    P +++A  A+  +   D++EI++   PP ++  ++E V +I+   + +W   +  LG     +++  +D   +T   RI ++++ T C +  F P+   R S+AA  L  WV+A   Y      + P +   +Q    LE  +  + + +  + +V   +   ++ +++ +A   +L  + +     +  A  LV  L  E +RW   +  L   +  L    L+AAA + Y      + R E  ++ W+ +    G+     F    FL       EW  +GL SD  S EN +++ +G   P +IDP   A  W+KN      L+I++ Q S++   LE +V+FG  +++Q V + L+P L P+L   ++  G R +++LGDK ++Y+PDF+ ++ T+   P   P+     + VNF   + GL+ QLL + ++  +P+LEE+K  L+      K +L ++E+ +L+ L  A G++L+++ L+ +LN +K +S  +++ L  S + ++ +D  R+ + P A+  S LFFV++D+ +I+ MY+FSL +++ LF  ++  S+ S +   R  +L       VY+Y CR +F+  +L+F+  M  C +           E+  F   G  +  +   +    +W+     D    +  L +    + S      D  W+Q+  SSE E   +P   +N  +  Q++L++++LRPDR+    + F  + L  K + P  +++  + +  + +  P++ ++SPG DP+  L +L+     S R++ +++GQGQA I   ++ +  ++G+W+ L N HL  SW+P L+K +  L+   PH DFRLW+++ PH  F   +LQ  +K+T E P G+K N+ R Y   +E   S+     +    LF L +FH+++ ERR F+  GW   Y F+ +D      +L  I         W  +  L     +GG V + FD R+L SYI   FND  +     +Y    LP+    +D
Sbjct:  828 LNIDFVLLDCSPLKFALLSHCNEWQNKFTTLL---REMASQKLTELNNFLKGNAKKLSAPPETLDELGDSLSLLEQLQNDLPNIEAKFAPLHQQFAILEKYEVAIPEEVQGMLDALSG---EWLLFQQCLIDSDVMLKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGP------FSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWE--------ELWDTWKVGKFV--ELVTTDMETQAQLLFKRLNKIIREVKDKNWEICD---SIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLD--QFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRL---KQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVLLEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKS-LSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFS----EMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNP---GYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYA--------------GRKKRANPDMSDEEILLL--SMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRVDKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDALATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLRELEGQFPA---KDTVYEYHVDIKQKTWASWEDKLRSGWRYNPSVPFYKIMIPTVDTVRYD-----FLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESK---VEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQDF---------EEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWV--HECFRVFSDRLIDNTDRESFVTLLSDKLGSMFDLTFHNLCPNKQSPIFGNFMKDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIA-------INLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENI--ELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRH---NYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAI----PALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAV-MILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMT--DRI-LKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQM--CSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRD--WNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSS-TRTPLIFVLSPGVDPTSALLQLAENCGMSNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLL-SIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTP--YYKLSSLPTYYVPKD 3909          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1175.61 bits (3040), Expect = 0.000e+0
Identity = 913/3252 (28.08%), Postives = 1575/3252 (48.43%), Query Frame = 3
Query: 3609 LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIREL-ELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQH---IITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELL------NENNIITLKKELVKKLN-IYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQ-SWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLK-KQDEHDQHLLSTYLDDFFYKSLDWI---------AKRNEFTISTSNVGTVYNGLSNLKAI-------------KNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQL--------MSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTL----HCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQI-VCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIY----TAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQL-------KSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNA-----KRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK-------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDG-LEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS-HCCRPD-LFKPQEWELF-TGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNI---KDDDLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKV-IGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSL-KPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRN----IQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNG--SGNFYGKIQLPSAASK---------RD-YLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLP-----DSLKRS---STDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSN---VSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDK-----IVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            L++++  +K+ IP+   ++ E L + HW ++  +  M   L  E  TL+++   A E+   ++ I ++   A  E+ I + I E+ + W A   F + +Y+        ++    +I+  + DN   LQS+  S +   F +    WE  L+ + E ++    +QRKW+YLE IF     +  LP+E  +F  +D+ F+ IM+D  +N +VL  C      + L  +++ L++CQK+LN+YL+ KR+ FPRF+FI DD+LL ILG S +P  ++ H+ K+F  I  + F +          M S +GE ++ R  V     VE+W+ ++  EM+ T  ++L          NQ        +Y   +      + +T   E++       ++  +    ++  ++++ +    + +LS +        K  ++++  VH  DIID  +  +     E+EW  QLRFY        +I+    EF Y YEY G   +LV TPLTD+ YLT+TQ + M LGG P GPAGTGKTE+ K L    G   +V NC EG+D KS+G+IF GL +CG+WGCFDEFNR++ +VLS VS QI+ +Q+ + + ++ +      + +D    IFIT+NP   GY GR +LP+++K LFRPV    PD   I E++L S+GF  AK L +K+  ++ L+   L+ Q HYD+GLRALK VL  A  L        K    +  E+V        ++++ALR   L K  + D   F  LI D+FP +D   + Y N   A+E  + +   + L  Q  K++++YE +  R   +IVGP+G GK+ +   L +A  ++G   K YVMN KA    +L G +D  TR+W+DG+L+   R++ K   + +  +I+ DGD+D  W+E++NSV+DDN+LLT+ +GERI+   +   +FE  DL  ASPAT+SR GM+++  +    +     W   + +  ++  L    + +   S+D I          K+ +  I  +N+  V      L A+               +A F   LI   G  L E+ R  +   +  L            V        Q  L  Y ++ ++ L +  L          D K    L+ T D  R     ++ +N    +P +L G  G  K+    +  + +   Q TTL    + S++TT ++V   L      +   T   Y P   +RL++++ D+N+P++D++GT Q I+ L+ ++   G YD   E +  +   I   +       GR+ +  RF S+  + ++++PS++ L  IY    T +L+P  K +            V+ +  + +E+Y+ +        SKF      HY+F   DL++ V   L    P   D+ A   + +   E MR+F DRL +   R+   G + + +   +S     ++ D     +G         P   +      +  +  K   +  L +Y+ +   ++++LF +  +++ ++ RV+    G  LL G  G G+++ + L +      +    + RGY+   F+ DLK    + G+E + +V L  D    +  +LELIN++L SG VP LY  +E E I+  ++D AN++G    R S+  YF ++  + LHI+L M          C++ P                         L +KIP ++  +   +      Q  G+ +  S+   L     V ++T ++Y++FI  Y R+   K   +  + + ++ G+ K+  A E +AEL  K A Q   +TEK    +K L +I    Q A E+K        +  E+N ++   K   ++ LA   P +++A+ A+ D+  SD++EIR+   PP  ++ + E ++ + G  + SW S +  + +    + +   D   IT          + +C+D     N      K  S A A L  +V A + Y     +I P   +  +L+RN   ++++++ +EK +  +++ +    K ++    + + L+ E +     + AA+ L+  L +E  RW K + +L  +   L    LL AA + Y+ +   D R++ ++   E   +++       F +   LT + E  +W  EGL  D+LS+EN ++  Q    P  IDP   A  W+K   +   L++V   D +F   LEL++++G  ++ ++VD  ++PV+  +L  ++  +  R+ V LGDK +DY+P F+L+L T+   P+  P   +    VN+T T  GL+ QLL++ +   + +LEE++  L+QE  + K  L  +E++LL+ELA + GN+L+N +L+ +L  TK  ++ +S+ L+   K  + +D+ RD + P A+ G+ LFFV+S++S +N+MY++SL S+L +F  +L  S   T  + R  +++  L   VY Y C  +F+  +L+F+  M+      D   K +E + F  G    +KS R      W+       +  L    PE++  L     +++  W +++     E    P   +  LS FQ++L+++  R DR+  A++ F    +  K+++P  ++   I E  T    P++ I+SPG+DP+ DL +L+ +   G  +   +AMGQGQ  + L LL      G WL L+N HL+  WL  LEK L  + KPH DFRLW+T +P   F   +LQ SLK+  E P G+K NL  +Y   S   ++     + +  +F L +FHA++QERR +   GW   Y+F+ +D R    +L+  + KS +N    I W  +  L    ++GGRV + FD RV+ +Y+  Y  D + +     +FY   ++     K         RD Y+  I +L   N+P  F L  N +       +  + L L  LQ      T  D    SRE        + + +  + I+  LP     D ++++    T + VV   +L+R+N   L++ + +SLI+L + L G   ++ E+  +S  L  G  PN+W +      +   ++M     +     KW    E       ++ L  L  PD++L AL Q T R     +D       V ++  ++     A     +  L++EG  +D  +   C R     VL+  + V  V   + +     +    P+Y    R       +V + D+   +     W+  GV L L S
Sbjct: 1177 LEEKMKEFKNSIPLFSDLKNEALRERHWKKLMDMTGMKFDLNPETFTLQNMF--AMELHNFSDVIADITASATKELGIEKGIAEVSDTWNAMK-FTVAKYMKGTQERGFVLGTVDEILQILDDNAMNLQSMSASRFVGPFLETVNKWEKSLSHIGEVVEVWMVVQRKWMYLESIFIGGDIRAQLPEEARKFDDIDKTFKKIMADTAKNPKVLEACHAPNRLDQLQFIVNGLEKCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SHDPTCVQEHMIKMFDNIASLRFQEGSNKETLATAMISSEGESMDFRQAVPAEGRVEDWMTSVLKEMRRT--NRLITKEAIYNYCNQITRIEWMMQYQGMVALAGNQVWWTWEVEDVFRKVKKGDKMGMKNYARKCHRQIDDLVVKVRSNLSKNDR-----KKFNTVLIIEVHARDIIDSFVRDSIMDSREFEWESQLRFYWDQAPDELMIRQCTGEFGYGYEYMGLNGRLVITPLTDRIYLTITQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGEGMDFKSIGKIFSGLAQCGAWGCFDEFNRIDVSVLSVVSTQIKTLQNSLSSGLKRLQFEGTEIALDARMGIFITMNP---GYAGRTELPESVKALFRPVVCIVPDLQQICEIMLFSEGFLYAKVLAKKMTVLYKLASGQLSKQSHYDFGLRALKAVLVMAGEL--------KRGSPELSEDV--------VLMRALRDMNLPKFVFEDVPLFLGLIADLFPGLDCPRVRYPNFNDAVESSLTDNKYILLPHQADKVVQMYETMLTRHTTMIVGPTGGGKTVVINTLAMAQTRLGMHTKLYVMNAKACTVIELYGTLDPVTRDWTDGLLSNIFREINKPTDKNERKYIVFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQKHCALLFEVADLRYASPATVSRCGMVYVDPKNLGYRPYWQKWCNARSNAKEREELDRLFEKYVPASVDLILEGILDGKQGKKLKTIIPLTNLNMVEQLSHMLDALLPPAESSNFLGPDVTEAIFISSLIWSTGAGLLEDGRIVYDQLIKRLAGIPANPAEGTVVGPGELPSAQPTLYEYYFDSKKLLWVPWLDVVPEYVHNPDLKYNEILVPTVDTVRTTWLLQLMVN--IHRPVLLVGETGTSKTATTANYLRGMD--QDTTLLLNINFSSRTTSINVQHNLEAN---VEKRTKDTYGPPMGKRLLVFMDDMNMPQVDEYGTQQPIALLKLLLEKGGMYDRGKELIWKNVRDIGFVAAMGKPGGGRNEVDPRFISLFSVFNVTFPSEESLRRIYSSILTGHLQPFPKNI---------QDLVEHITTSTLELYTNIIRDLPPTPSKF------HYIFNLRDLSR-VYQGLCLTTPDRFDSPA-KFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDPCL--FGDYRNTLTEDPRLYE----DVVDYDATKAIFEEILEEYNMDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPG------------------------LNDKIP-DQYRETVVDHVVFVHQTVGTYS-QSFLQKLRR---VNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQ-------VKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKEEKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQKPY-SWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQST-PFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQ----PQTAGDSGGISRE--------EFITKIASDIQGKLPPLFDVDRVRKNLSEITPTAVVLLQELDRFNV--LIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGE-----PAVIWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTVTKYHNADEVTERAHSGCFVSGLYLEGASWD--LAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADL-ATTEHTSHWVLQGVCLTLNS 4308          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 1158.28 bits (2995), Expect = 0.000e+0
Identity = 863/3179 (27.15%), Postives = 1532/3179 (48.19%), Query Frame = 3
Query: 3801 IKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCL-LQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG-----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKD-----IQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFT-------ARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDL------KLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQD-EHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKA-------------HFSVCLIKGLGGNLNENS----RETFA-LWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYS-----YECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKS--VQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQ-IVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSK-VKLLANTMIEVYSQLKSKFTVDDYS-HYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLAN---YFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENV-ILAK----RKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTM-----DTSWVSMRNFLGK-RGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQR----KEKMQLWMEKTG-----LEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQE-----LANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVA-ISNLA----SAMPELWSVLNIKDD-----DLWHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKV---IGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLK--PHKDFRLWVTAEP------HIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNR-WKILNQGLNIIKASLPDSLKRSSTDSP--VVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQ-WEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGS--NVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            ++ +  KA  E+ + + ++EL++  +   F+  E++ +    I L+K   ++I  + DNQ + LQ+L  S Y   F ++   W+ KL+  D  +    ++QR W +LE IF      +N LP++  RF  +D DF+ + ++  +   V+  C+  G+   L  + ++L  C+KAL EYLE KR  FPRFYF+   DLL+IL     P  +  HL KLF  +  + F +D      +  + M S +GE VE  +      +VE WL  + + M+ T+  + S ++       +  +  +   +P+Q+      I +T        R EE   EN I    K+ V +L+   N           ++ DL      K+ ++    VH  D++ +L+ Q   S   + WL QLR     +   C   + DA+F Y+YEY GN P+LV TPLTD+CY+TLTQ +H+ + G P GPAGTGKTE+ K LG   G  V VFNC E +D KS G I+ GL + G+WGCFDEFNR+   VLS +++Q++ IQD I++K +        + +     +FIT+NP   GY GR +LP+NLK LFRP AM  PD +LI E++L ++GF  A+ L RK + +++L +ELL+ Q HYDWGLRA+K+VL  A +L    + + + Q                ++++ALR   + K+   D   F  LI D+FP +D+      +  + +++ + +  +        K++++ E L  R  V ++GP+G+GK+ + + L        +    + +NPKA+   +L G I+  TREW DG+ +   R +     +   WI+ DGDIDP WIESLN+V+DDN++LT+ S ER+   P++  +FE   L  A+PAT+SR G++FL+         V+SW+  ++ + ++  L    D +    LD +  R +      ++  V      L+ +   A             +F    +   GG + ++     R  F+  WV E    K P      V +YY + +  + V ++     +E + E+ +  +         L+ TA+  R   +  + +  + ++P +L G  G GK++++N  FQ L      V  +  +  TT   + Q L +    +    GR Y P  +++LI ++ D+N+P +D +GT Q  + ++Q + Y  ++D + L    +   Q I C   ++ S   +    R  ++    +IS+P  D L  IY + L   +K     H   S  SK  + + +  + +  ++ S F       HY+F   DL+     +L          T V    +  +E  R+++D+L+        D  +F+ I  + + +  + L++     +      +  +    + K L     E L   +   L  Y+     ++++LF++   +V +++R+L  P G+ LL G  G G+++ + L + +  +++    + +GY +   K DL +    AG++    V LL D Q  E  +L LIN LLASGE+PGLY  +E+E I+  +++    +G + +  N   +F +R++  L ++L          +  +  PA     ++ W  +W +++++ +    I  + + E ++     A+  + +  S N  S    L +     ++T + ++  I +Y  +  KK  E+  +   ++ G+ K+    + V +LK+K A Q   L +K  +ADK ++K+     G    K   EK      E+ V ++AK    ++ + +++LA  EP +  A++A++ +   +L+E+++  +PP  + ++   V++++        D SW + +  +GK     +++  +D   I   +   V+  L      F+P   K  S+AA  + AWV   V++ Y    + P           L  AE+K+  ++  + ++D+ +A    +FE+ T++  K + E ++  +TI  A  LV  L +E  RW + +     +   L    LL  A V Y        R     +K  +++          E  D    LT       W  E L +D +S ENA ++      P +IDP      W+K   +   L IV      +   +E +V  G+ ++I+ + + ++PVL  L+  + I +G  + +++GDK ++Y+ DF++ L T+   P   P+  A  + +NFT T+ GL+ QLLA  +   +P LEE K +        +     ++   L++     L+ A GN L +  L+ +L  TK ++  I   + E+ + ++ +++ R+A+ P A   S L+F+++DL+KIN MY+FSL +F  +FQ+A+  +E + +   R  +LI C+   V+ Y  R +F+ D+++F   ++           +  L     I  + D  +  P  ++    V  +SNL+     A+  +    N+  D       W +FA+S   E+E  PQ  KNK +L QK+ +++ALRPDR+  A+S F  + L  K++  +       +E E+    PI  I+SPG DP +D++    K+     ++ ++ V++GQGQ  +    L   ++ G W+ L+N+HLV +WLP LEK+L +     + D+R++++AEP      HI     +L++S+KIT E P G+  NL ++ +N+++D +          + LFSL +FHA++ ERR F PQGW + Y F+  DL    ++L   + ++N  + W  +  LF   ++GG + + +D R+  +Y++ Y    ++ G  N      LP  +  + Y   I++     SP  + L  N +       S  +   L  +Q     G +        ++  VL+  ++ L +  N+     P+ + R    +P  VVAF + ER N   L   + +SL  L   LKG   +T E+++LS  L     P  W ++ +        +   L+L+ K +E+W      D  L  ++ L   F+P +FL A+ Q  AR  +  +D++     V +      N   +    +  L +EG  +D    T    DS    L P + V ++     +     ++   P+Y    R                 KW  +GVAL L S
Sbjct: 1400 VRGIVDKATKELGMEKVLKELDVTWSQMEFEHEEHVRTH---IPLLKSSEELIETLEDNQVVQLQNLMTSKYIGHFLEEVTSWQKKLSTADSVITIWFEVQRTWSHLESIFIGSEDIRNQLPEDSKRFDGIDVDFKELTNEGAKIPNVVECCNRPGLFEKLENLQERLSLCEKALAEYLETKRLAFPRFYFVSSADLLDILSNGNQPVEVARHLSKLFDNMARLKFKEDDAGNVTKDAVGMYSKEGEYVEFDSVCDCDGQVEIWLNRVMDRMRATVRKEQSESVVSYEEKPREQWLFD---FPAQVALCGTQIWWTTEVGIAFGRLEEGY-ENAIKDYYKKQVSQLSTLIN----------MLIGDLSKGDRQKIMTICTIDVHARDVVAKLIQQKVDSAQAFLWLSQLRHRWDDQQSHCFANICDAQFKYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLSQTGAWGCFDEFNRISVEVLSVIAVQVKSIQDAIRDKKERFIFQGEDICLVPTVGLFITMNP---GYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARALARKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRQRPEDQ----------------VLMRALRDFNIPKIVTDDVPVFMGLIGDLFPALDVPRKRDPDFEALVKKSVTDLKLQPEDSFILKIVQLEELLAVRHSVFVLGPAGTGKTQVIRSLNKTYMNQKRKPMMFDLNPKAVTADELFGFINPATREWKDGLFSTIMRDLSNIASDSPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERVPLTPSMRLLFEIGHLKTATPATVSRAGILFLNFADVGWNPYVSSWIDTREVQSEKANLQILFDKYVPVCLDLLRVRFKKITPIPDITMVTTLCYLLECLLTPANTPPDCNKELYELYFVFAAVWAFGGAMFQDQLVDYRTEFSKWWVTEFKTIKFPSAG--TVFDYYIDSETKKFVPWTDKVQKFELDPEVPLQAV---------LVHTAETTRVRFFMDLLM--ENRRPVMLVGGAGTGKTVLVNDYFQSLDPDVSMVGNVPFNYYTTSAMLQQVLEKP---LEKKAGRNYGPPGNKKLIYFIDDMNMPMVDTYGTVQPHTLIRQHLDYSHWFDRTKLTLKDIRNTQYIACMNPTAGSFTINPRLQRHFAVF---AISFPGLDALKTIYLSILNGHMK----VHNFASAVSKFTEKVTDAALAMNQKVTSTFLPTAIKFHYVFNLRDLSNIFQGILFATHECIK--TPVDFARLWMHECNRVYRDKLIDD-----KDMEVFDKIQIDMTKKFFEELDEE--AMYAKPNMFSHFSSGIGEPKYLAVPDWEVLSKLLTEALENYNEVNAVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQLE-AEYKPPVAEFMSYVHTSVNEESQMY-LANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKV-----GVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPANKIPKDRSWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLD--NPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTR-EGNDLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIKKG--RAIKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAF----------QVLLMKKEIIPHELDFLLRFPAVMNVTSPVDFLSNLSWGGIKALSNMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNKTAL-QKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFE-ESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHI-IPQGILETSIKITNEPPTGMMANLHKALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYL-EANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLAPGFPLPPNSDFKGYHLYIDETLPPESPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPRDAGGGEGASQTREEKVKQVLDDIFEKLPEEFNV-----PEMMARVEDRTPYTVVAFQECERMNM--LTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWT----SDFCLPNVVWLSGFFNPQSFLTAIEQSMARKNEWPLDKMALQVDVTKKNKEDFNSPPREGAYVHGLFMEGARWDTQ--TGMIADSKLKDLTPAMPVMFIRAIPVDKQDTKNVYECPVYKTRQRGPTYVWNFFLKTRENPSKWTLAGVALLLSS 4471          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 1155.97 bits (2989), Expect = 0.000e+0
Identity = 879/3287 (26.74%), Postives = 1588/3287 (48.31%), Query Frame = 3
Query: 3378 EHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEI----TTMTIR-----------LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFG----KNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLL---STMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQ------------------------HIITMKSLDGEVVELRNQVLITSEVE------NWLGNLNNE-----MKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMI------HFTARCEELLNENNIITLKKELVKKL--NIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQ---------TVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQD----EHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYN-------------GLSNLKAIKNKAHFSVC------LIKGLGGNLNENSRETFALWVYEL----TDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNS--DTQQPFILSGPEGCGKSLM----LNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKF-TVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEW---------SVEVQDSLNDVW--FVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYS-RECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANES----GHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIP-REEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMV-----------AELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT---GL---EKFDMRKFLTTEREQLEWKKEGLSSDEL-SMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSH--CCRPDLFKPQEWELF---TGTFISDKSDRNITVP-------------------------KWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNE-PILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKEL-----NSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANAL-FSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNF--YGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQ-LRILQRF-SVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKA--SLPDSLKRSSTDSPVVAFLQ-LERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF 12671
            ++F++E  +F  LEE+H ++   Q +W+   E+     + +++DW        LFEE      E L N  +    T M +            L+++++  +  +P++  +R   L Q HW ++ ++ N       E LTL  +LD   E   H E+I+E++ +A  E ++   ++++E       F ++ + DS++  + ++    DI + + D+   + ++  S +    + +   W+ +L    E +      QR W+YLE IF     +  LP E   F  VD+ ++ IM  VNR    L   +  G+       + ++DQ+Q+C   L  YLE K  +FPRFYF+ +D+LLEIL Q+ NP  ++ HL+K F  I  ++F   +Q                         I+ M S +GE V L  +V  +  +E      +WL +++N       K +L   L Y              I   + P  I+  S  I      H++      +N NN+  L + ++ KL  NI                    L +LI   VH  DI+  +++    S   +EW+KQLR+Y       CV++M ++ + Y YEY G + +LV TPLTD+CYL L   + + LGG P GPAGTGKTE+ K L     +Q +VFNC EG+D K MGR F GL + G+W CFDEFNR++  VLS ++ Q+  I++    K        R + +  + A FIT+NP   GY GR +LPDNLK LFRP+AM  P+  LIAEVIL S+GF+++K L RK+  ++ L  E L+ Q HYD+G+RA+K+VL  A  L        K    D  E+V        ++++ALR + L K   AD I F +++ D+FP  +I + +Y  L S IE+ +  + + ++    KK++++YE +  R GV++VGP+GSGK+T + +L+  L  + +          V+ +++NPK++   +L G ++  T EW DG++    RQ V+E      WI+CDG +D  WIE++N+VLDDN++L + + ERI+    ++ +FE  DL+ ASPAT+SR GM+++       +  V SW++K      E  +  L    D +    L + +K+    +   ++  V               G  +      K H  +C       +  +GGNL E   E+F  +  +L     D + P     ++ +YY +    R+  +    E+ +   +  S+      L+ T D  R    F   ++      +  + +G  G GKS++    L+   QK   + +  ++ SAQT+     + +      +      +      +R+++++ D+N+PKLD +G+   I  L+Q   ++GFYD    F        +CS  +    GR+ ++ RF     +  I   ++  L  I+    K ++   +   P   +     ++  + +E+Y+++ +        SHY+F   DL++ +  +L+ D  V  D   +    +  +E+ R+FQDRL++     + D   FNTI SE          S E  +S   ++  F+  G+ +P           K +  L ++YL D        Y+    +++ ++ F +  ++++++ R++ +P G+ LL G  G G+++ + L  HM   K    ++ RGY+   F+ DLK     AGV+GE+ V L  D Q +  ++LE IN++L SGEVP L+  EE E +L   + LA E+    G R  + +YF  R+++ LHI+L M      F   C+  P+    C++ W  +W R+++L +      ++    EG +        +   + S   + ++ +L       ++T   Y+  I +Y+ +  +K+ ++   ++ ++ G+KK+ E  ++V            +LK K+ +  KL+ + Q++ ++A  K+ +V+Q       E      K  E + I A+ +  +D+ L    P ++ A+ A+  +  SD+SE+R    PP+++  ++E + +++G +   W S +  LG  G  +++  +D  +I   +  ++++ +   K     +  ++ S A   +  WV+A   Y+     + P   +    +  LE     +++ +  +++V+  +A  +  ++   A+   L   +      +  A  L   L +E  RW + +     E+  +     +AAA V Y  +     R E +  W+E+    G+   + F +   L    E  +W  +GL  D L ++E+ ++ L  +     +     A  W++       L+I+   D+NF   LE  +R G  ++++EV + L+P L P+L      QG R +++LGD  IDY+ +F+ ++ T+   P   P+    V+ +NFT TK+GL+ QLL+  ++  +P LE+++  L+      K +L  +E+ +L+ L ++ GNIL+++ L+ +LN++K +S  IS  L+E+ + +  +   R+ + P+A  GS ++FV++ L++++ MY++SL  F +LF   + +SE + D   R   L+    + VY  V R +F+ D+L+F+  +      + ++   +EW  F   TG    ++  +   VP                          ++ A  T+++ NL  +         + DDD           + E P+S +++L+ F++++ I+A + +++  A   F C+ L    +   S++L  ++E+  +SN  P++ I+S G+DP       +  +  +ER   +++GQGQ  +   L+   S+NGDW+ L+N HL  SW+  +E  +     N  + H+DFRL++++ P   F   +LQ+S+K+T E P G++ N  R++     D       G R   L F + +FHAIIQER+ F P GW   YEF+ +D     E L   +   + NI W  +  +     +GGRV + +D R L++ + R+F+  ++  +  F   G    P   S  DY   ++ L   + P  F + +N + + Q   + Q+I   L +  R  S  G K + +I     + +L +   L   L++ KA  SL ++  +   +S      Q ++R+N+  L+K + +SL  L K +KG  +++ E+  +    L  Q P++W        +P   +++ L+L+   VE+W               +   F P  FL    Q  AR   + +D+L F
Sbjct:  633 KNFKVEVTKFEELEEVHAELRLKQSLWNSLVEW-----DQSQQDWTE-----TLFEELNP---ETLSNNVMKYAKTVMQLEKGLPPNSVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNY-HFKDEEPLTL-GLLDKI-EAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKD--VFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKC---LEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPSTPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSL-GKVSYSHSIETLTLCFSWLKDMSNHPLNLHKKISLFSSLMY--------------ITWSRSPQYIITSSTTINALFPSHYSLCIVFPMNLNNLAALVRGVLPKLTRNI--------------------LGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNP---GYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGAL--------KRSNPDLEEDV--------VLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQAEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKHSDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFNLDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDLFADTHDVRIP--GSGDLYSYYVDFDTRRMEPW----EKIIPAFKYSSEVPYFDLLVPTVDTVR----FGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIM-MNFSAQTSSQRTQEMIETK---LEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIF----KSIVSGFLLDFPAEVRECADAIVGAS-VEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQI--FRLFCHEASRVFQDRLIN-----KEDKTFFNTIMSEMAHKHFQQARSPEKFESNPILFGDFMKMGA-DPADKLYEELTDLKKVKNLLTDYLDD--------YNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRY---YTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEA-DKVRNVVQAEEAVAKE------KADETSAIAAEAQKDLDEAL----PALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLG-VKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVV--EVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKP-DVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITISMGNLQQS--------EVGDDD-----------QAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFEN--VSNMIPLIFILSTGSDPMNAFLRFARDMNYTERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPFESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFL--VDENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILEDNYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGK---LMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNN--LLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFW-----ISGFFFPQGFLTGTLQNHARKYNLPIDQLTF 3754          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Medaka
Match: DYNC2H1 (dynein cytoplasmic 2 heavy chain 1 [Source:NCBI gene;Acc:101163989])

HSP 1 Score: 3454.07 bits (8955), Expect = 0.000e+0
Identity = 1768/3421 (51.68%), Postives = 2419/3421 (70.71%), Query Frame = 3
Query:  108 EDQRKDTIFLITKSHFPNQNSKFVNEEC-LDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDT------DPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDF---IHRSRQGKVPP--TKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVK---SVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKIVNLMGIDLLRQQQKWKDTLNEIRQILFQIENQKHLPENTLPWKRHLDHQLYKALEYQYHIGLEALNENLPEIRVDLVYRQGRLQFNPTFEEIKSKYFKEMKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRN-AEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSL--SADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFET-KLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXX--XXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIV-ELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQ 10304
            ED RK  +   T + F  + +  +N+E  L+ F D+ +  VL ++   N    SN++       N LVF K  P++IT +N++  ++++++ E+PI++LY  ++ ++ P+LL D       DPK+  L+SELE GLGS++R   +K S       +  GI +  DE  FW + L ++  +  + R        + + +E + + + SL++    +E     L+D+W+     P YP++RM  LM++I   L R +Q +L+    +E+ +A V+++L  AI +C HW+  C+ L  + WK+Y PH W    +   S +     RL E+ +LR VHE++  ++P  ++Q    +  F+ F+ + PL YNPYTEP+WK AV +F R I P+E  +  RLK    +    + PQQLL++FQ++ +LI RP I+  L  ERE LLA+L+ + K    +F    H     K  P   +N  + ++K+VW +QL  K+ + + I   +L DL GF+ F+    +  E +  + QEQFE W++++   L D  +      +  R+M+L   DG L ++YSDRLV+L+REVR LS LG+ +   +  AA+   KFY +A+ILKQVA FYNTI+ QMIP Q+ MML  A+ FE+++K   S+  +S  K  + W+NP+EL  +I KLQ A+  + ++NR LRK H    +K+V+LM +DLLR QQ+WKD L E+R     +E Q    ++   W+ H +HQLYKALE+QY  GLEALN+NLPEI++DL+++QGRLQF P FEE++ +YF+EMK+FI++PNQFKG+  S  G +LIF  +I++NA+GF+  + KAE LF RL A  +KFKEW++LG +DLE+ V+++   + D+E+NFKA+K +GKE+E+LP++ K+DCITVNC P+K ++D LIQ +FD LL SLRK+I+G + ++D++++ S++ LS RP  ++EI  A   + +    +  +  Q   +E+ N LLR VAG G D++S L+ KWDK EL+MES Q+M++EQ+EVM+++   R   ++ D+ +F  RW  LKP  + L+ G   A L  +Q I+DK+ E +EL ++++ L +DC +F ++P +F++ EEI  D+++    WS +EE+Q G  + A EDW++FRS+ Y+FEEFL  W ++LR   + T+M+++LQ E+D YK+++P+LK++RGE LSQDHWL+MFR+L +PRG TLE LT   +L  A  I+  A+ +K+LN +AQ EVTIREA+REL+LWGA A F L EY DS   +ISLIK+WRD++SQVGDN+CLLQSLKDSPYYR FQDK ++WE +L+DLDEYL NLN IQR+WVYLEPIFG+ ALP+E++RF+RVDEDFRSIMSD+ R+ RV+SL S +G+K+ L  ++DQLQRCQK+LNE+LEEKRS FPRFYFIGDDDLLEILGQ+TNP VI+SHLKKLF GI+ V F++  QHI+ M SL+GEVV LR  V I+S VE WLG L+ +MK TL   L   L  ++  N     ++  +YPSQILCL+E I FT   E+ L + ++  L+ EL  KL  YT    +   S ++  ++  LKLK+LILD +HNI ++ QL      S  +W W KQLRFY    D+ C IQMVDA+F+YTYEYQGNA KLVHTPLTDKCYLTLTQ M MGLGGNPYGPAGTGKTESVKALG LFGRQVLVFNCDEGIDVKSMGRIF+GLVKCG+WGCFDEFNRLEEAVLSAVSMQIQ IQD +K+      LL + V++D NS +FIT+NPAGKGYGGRQKLPDNLKQLFRPVAMS+PDN+LIAEVIL S+GFKN + LG KLVA+FNL+RELLTPQQHYDWGLRALKTVLK   +LL+  + +             D + E+  L+VQALR+NT+SKLT+AD   F++L+KDVF  +D  ++E   L  A+E+V +E  +  + GQ KK LE+ EQLRQRMGVVIVGPSG+GKST+W++LR AL+  G+ VK Y MNPKA+PR QLLGHID+DTREW+DGVLT+SAR VV+EPQE+ SWI+CDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNF+FETHDLSCASPATISRMGMIFLS E  DV +L+ SWL+ Q +  +  L  +L D+F ++LDW+ K+N+F + TS VGTV+N LS+L A+  +  F V L++GLGGNLN  +R+ FA  +     E  P+  K   L+ Y++ K + L  Y+++  E L+++Q  S   +L P+I T  +QR L  F  WL +  +QPF++ GPEGCGK ++L + F +L+S QV  +HCSAQT+  HVLQKL+Q C++++SNTGRV+RPK+ E L+LYLKDINLPK DKWGTS L +FLQQ +TYKGFYD NLE+V L+ +Q+V SM++  S+   SL++RF SIVR+C+I YP ++QL+ IY+AYL+PVL+  +     W+   +   LA +M+++Y Q+K+KFTVDD+SHYLFTP  LT+WVLSLLRYDL     N   S+LE+++YE+ R+F+DRLVSS      D +L + I  +WS +  D++ D ++VTWG  E        P+   GK LG+L S  L++ I +G++ Y+R+ ++LD++LF EV D V+++DRVL++ GGS+LLAG+SGVGR T + LVSHMH   L + K+ RGY LK F NDLK  +Q AG++G+ +VLLLED+QF+ P +LE++NSLL+SGEVPGLYT EELEP+L  LKD A++ G  G L NYF+ RI+  LHI+LIMDCSN NF INC+SNPAF++ CSVQW+E WS  SM KIP +L++K   E+G    +             +L   FL +H++C    +T   Y+ F+ +Y  +Y +KKN++ TRQ H+Q G+ K++EAK +V +LK +AAEQS LL  KQ EAD AL++IT+ MQ A+++K EMEK+  K   E   + +RKA I+DEL  ++P V +A+ AV +IK   LSEIR+LR PPDVIRDILEGVL +MG  DT+WVSM++FL KRG++E+I TFDAR IT E R  VEELL R K SFDPKNAKRAS AAAPLAAWVKANV+YS+ LE+I PLE EQ  L  NL   E +   LE  +++V   V   ++ F++ TA+AAKLE E+  A +TI+AAE L+ +L  E  RWN Q++ E+  EL  L  ++LLA+  + Y+ ++ ED+R+  ++ WM ++GL+KFD+R FL +E EQL WK +GL SD+LSMENALVILQ +  PFLIDPSS AT WL+ H K+ KLE++NQQD+NF T LEL+VRFGKTLIIQEVDG+EPVLYPLLR D I+QGPR VVQ+GDK+IDYN DF+LFLATRNP   +PPDA ++V+ VNFTTT+A  K +
Sbjct:    6 EDARKRFLLNTTGNFFAVKPASTLNDEAELNNFLDDENEFVLSIRRRGNDLQLSNKVTQE----NVLVFFKLRPTVITEENLHQNLLISSMLESPINTLYQAVKQVFAPVLLKDERWRSAFDPKLAGLLSELELGLGSVVRSSGAKSS-------VKEGILTPTDEFQFWREVLESAQKNSVRERATYFTEQFKTIQKEYEGLDALSLSDVVELVEQSRETLDDVWRQTEFQP-YPEARMVRLMDVIGGALGRYVQRKLSDSKVFEEPFASVRDNLRMAISICEHWVTGCEFLTGQAWKKYSPHPWKGSKHCPQS-LDCLLKRLNEVVTLRVVHEKLLCLVPGGKQQALTSDRVFEPFIGLNPLHYNPYTEPLWKAAVAQFERLITPSEQEVAGRLKAYIADVQ--DNPQQLLQVFQKHKELIRRPTINKELQTEREMLLARLLDYNKGTNSNFENCCHGGPGDKSGPLSGRNLPEVVNKVVWVRQLTHKVEDSVRIAKALLSDLSGFKTFVHFCDDLSEVLKAYEQEQFEDWSRDILSGLADPKSG-----ISSRVMDLDHADGRLKIHYSDRLVSLLREVRQLSALGFPVPAKIQQAANTADKFYREAIILKQVANFYNTIDQQMIPSQRPMMLSLALAFERVIKNPRSLSKESGGKLQITWDNPKELEGYIAKLQSAAEKLSTENRKLRKWHTDFIDKVVSLMNVDLLRHQQRWKDGLQELRTGFATLEAQGFRSDDMRAWRLHWNHQLYKALEHQYQTGLEALNKNLPEIQIDLIFKQGRLQFRPPFEEVRVRYFREMKRFISIPNQFKGV--SVQGEELIFTIMIDKNASGFLTIFSKAEDLFSRLQAIHHKFKEWVVLGQVDLEKLVEKNLTSVQDWERNFKALKARGKESERLPSQEKVDCITVNCEPVKSTIDDLIQRLFDMLLLSLRKSIQGHLQAIDSFVSESMEALSTRPDNLEEIGAANSKYNQILSRKPEMLPQFQCAEEKNRLLRAVAGAGFDSLSSLRSKWDKLELVMESHQLMIKEQVEVMRSHAAGRISTYRADLERFQLRWDQLKPKDENLEGGDHAALLACLQTIRDKQQEFQELELVRSKLLEDCTYFDLDPPDFSMAEEIKVDMEELSQTWSLYEEWQQGFTDKAHEDWITFRSKTYVFEEFLLTWQDRLRKLKQPTSMSVKLQGEVDKYKNMVPVLKYVRGEHLSQDHWLDMFRMLGLPRGTTLERLTFSDLLAVADTIVEKAKELKDLNSRAQAEVTIREALRELDLWGAAASFTLTEYTDSSGRTISLIKDWRDVVSQVGDNRCLLQSLKDSPYYRSFQDKVSLWEVRLSDLDEYLLNLNAIQRRWVYLEPIFGRGALPREEARFKRVDEDFRSIMSDIQRDTRVVSLSSRAGIKSSLVAILDQLQRCQKSLNEFLEEKRSAFPRFYFIGDDDLLEILGQATNPSVIQSHLKKLFAGIHSVVFDEQCQHIVAMCSLEGEVVPLRTAVRISSLVEVWLGELSVQMKETLKHLLYECLMAVKKGN-----VDPLRYPSQILCLAEQIQFTEDVEKALKQQHLHQLELELNSKLEHYTRVDTNSDDSPNTESVILQLKLKALILDIIHNISMVKQLNQAGVTSTDDWAWKKQLRFYM-GPDKFCHIQMVDAQFSYTYEYQGNAAKLVHTPLTDKCYLTLTQAMKMGLGGNPYGPAGTGKTESVKALGGLFGRQVLVFNCDEGIDVKSMGRIFVGLVKCGAWGCFDEFNRLEEAVLSAVSMQIQAIQDSLKHHKNICELLGKEVSLDPNSGVFITMNPAGKGYGGRQKLPDNLKQLFRPVAMSKPDNELIAEVILYSEGFKNGEMLGGKLVAVFNLARELLTPQQHYDWGLRALKTVLKACGSLLQQQRRR------------PDKEKESNSLVVQALRLNTMSKLTFADSSRFDALVKDVFTGVDFTDVEDQILIHALEQVYQEAQLELIPGQLKKALELNEQLRQRMGVVIVGPSGAGKSTLWRMLRAALSMTGKVVKQYTMNPKAMPRQQLLGHIDMDTREWADGVLTHSARCVVREPQEVNSWIVCDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFLFETHDLSCASPATISRMGMIFLSDEDIDVGALMKSWLRGQSDECRSQLENWLGDYFQRALDWVFKQNDFVVETSLVGTVFNALSHLSAVNERGEFLVGLLRGLGGNLNLKTRQEFAKELLSWAREPPPDARKP--LDTYYDNKSDHLAAYTFQHPESLTLEQF-SHAHML-PVIKTTGMQRGLHGFFPWLTASHRQPFMVVGPEGCGKGMLLRYAFSQLRSTQVAVVHCSAQTSSRHVLQKLSQTCLLLSSNTGRVFRPKDCENLVLYLKDINLPKPDKWGTSNLTAFLQQALTYKGFYDENLEWVSLENIQVVASMSTGGSVCSHSLTSRFCSIVRICAIDYPDREQLHSIYSAYLQPVLQHSLGSQAGWASTGRTHQLAGSMVQLYEQVKAKFTVDDHSHYLFTPCILTEWVLSLLRYDLTAAQSNLTQSVLEVIAYEARRLFRDRLVSSKDLHTFDNMLSSVIRGDWSSDALDNMADGFYVTWGCSEGTVMAPCQPLPPHGKQLGRLDSSDLREVIQKGVMLYNRDNKELDLLLFWEVCDFVSRVDRVLSRLGGSLLLAGRSGVGRHTAACLVSHMHGYALFTLKICRGYTLKHFSNDLKMVMQLAGLDGQQVVLLLEDYQFVHPSFLEIVNSLLSSGEVPGLYTPEELEPLLSPLKDSASQDGFSGPLYNYFSHRIQQNLHIVLIMDCSNSNFTINCESNPAFYRKCSVQWMEGWSESSMKKIPELLLSKT--EDGGINVREK---------HGDLCRLFLMVHESCKEHGATPSQYMAFLHVYTSLYSRKKNQLTTRQQHLQAGVSKLNEAKALVDDLKRRAAEQSALLKTKQQEADAALQEITTSMQNASDQKTEMEKIKEKMAVEVSKIEERKAKIEDELKEVQPLVDEAKRAVGNIKPEALSEIRSLRMPPDVIRDILEGVLRLMGIFDTTWVSMKSFLAKRGVREDIATFDARNITPEIRQSVEELLNRNKASFDPKNAKRASAAAAPLAAWVKANVQYSFVLERIGPLEKEQAGLLENLRKTENRKNKLEDQLNNVGAKVNKLKEKFQRHTAEAAKLEAEVTKAQDTITAAEQLISQLVGEHTRWNAQVMSEIKTELDTLPFRTLLASGFITYLSAASEDRRRHCLETWMSQSGLQKFDLRSFLCSESEQLIWKSQGLPSDDLSMENALVILQSVACPFLIDPSSRATEWLRTHLKEHKLEVINQQDNNFMTSLELAVRFGKTLIIQEVDGVEPVLYPLLRRDFIAQGPRYVVQIGDKVIDYNEDFRLFLATRNPSLFIPPDAASVVTEVNFTTTRAAHKAK 3371          

HSP 2 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 418/834 (50.12%), Postives = 573/834 (68.71%), Query Frame = 3
Query: 10557 EERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAI-----------SNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGN---------FYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNII--KASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVE-KWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLK 12989
            +ERDA+LPLAE  S ++FVI+DLSKINNMYRFSL SFLRLFQRAL   +   ++ +R  +L A L+ +VYEYVCRS+FK+D+LMFA+H      P+LF   EWE+F G+ + +      T  +W  ++  + +           S   +  P L+  L + D DLW  F +SS+CE+EIP S+  K+S FQ++L++QA+RPDRLQSA++ F    L +K LSP  +NL ++Y +ET+  EP+LIIISPGADPSQ+L EL+ + I        +MGQGQAD+ L  L +CS+NGDWLCLKNLHLVT+WLP LEKELN L+PH +FRLW+TAE H  F  ILLQSSLKITYEAPPG+K NLLR+Y++W+ + ISK GS  RA +LF LAWFHA+ QERRN+IPQGWTKF+EFS++DLRAG +I+D++  ++ + +QW F+HGLFE+AI+GGR+DNP D+R+L SY+K++F+   ++  G          F  +I LPS+ S  DY  +I  L + + P+FF LP NI+RSSQRIISSQVI QLRI+ R    G+KFD+++WS  L+P+LN WK LNQG ++I  K   P   +R    SP+++F+ LE++N+I++++ +H SL +LSKV++G++LLT EVQ L+  LL  + P  W  +WEGPEEP  Y+R ++ +A A++  W E + +  LLS ILDL ELFHPDTFLNALRQ TAR++  SMD L FV  W      AK  +++G L +EGC FDG  ++E    S S+  +P   + WV +      + ++ I LP+Y    R K+VT I +PC       WIQ+G ALFLK
Sbjct: 3406 KERDAYLPLAESASKMYFVITDLSKINNMYRFSLASFLRLFQRALQAKKEEGNTEVRIAALQANLKNMVYEYVCRSLFKADQLMFAMHFVKGMHPELFLENEWEVFVGSIVGEIKTTFRTECRWSLSNYGLNLVFSFIVLPFLTSLFQATFPALYQTLCLSDSDLWLSFMQSSQCEQEIPSSIAKKMSRFQQVLMVQAVRPDRLQSAMTAFASHALSMKELSPPPLNLRRLY-AETMEWEPVLIIISPGADPSQELAELAAETI--------SMGQGQADVALGTLRECSRNGDWLCLKNLHLVTAWLPHLEKELNILRPHANFRLWLTAEVHPKFPPILLQSSLKITYEAPPGLKKNLLRTYESWTPEQISKGGSLARAQSLFCLAWFHAVCQERRNYIPQGWTKFHEFSLSDLRAGFDIIDRLF-EAGKTVQWDFVHGLFESAIYGGRIDNPADLRILRSYLKQFFSAQFLSSVGQRNSREEGNVFPPQIVLPSSCSILDYRRVIENLPEDDRPAFFGLPANIERSSQRIISSQVISQLRIVSRLVATGSKFDRELWSSSLSPILNLWKKLNQGSSLIHQKVDPPVEGQR----SPILSFIVLEQFNAIRMIQSIHQSLAALSKVIRGTQLLTPEVQKLATALLNQECPITWQNKWEGPEEPMQYLRAVVTRALAMQVNWVERASRQALLSNILDLSELFHPDTFLNALRQETARSLGCSMDSLVFVSSWKSPLAQAKLQIQVGGLQLEGCRFDGVHLSENQHHSPSVSAVPTCYMAWVLQVPFYHPASEEKIWLPLYTSSERVKVVTHIPLPC-GANASHWIQTGAALFLK 4224          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 897/3259 (27.52%), Postives = 1569/3259 (48.14%), Query Frame = 3
Query: 3609 LQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIK--EWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF--GKNA--LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMS-GMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDI-QHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGIN-ADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIY----TNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLE-RRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLK--GAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVY---NGLSNLKAIKNKAH----------FSVCLIKGLGGNLNENSRETFALW-----VYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTP---LILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKL-KSVQV-TTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY--DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYT-----------AYLKPVLKRLIPK-----HPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVE---VQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKL-----TSEYLKDTIDRGLLQYSRECR--DLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSL-----KDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAK--PKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIM-------------GTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMK----DLEKGVSDVDKAVAG---YRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK--------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAIS--NLASAMPELWSVLNIKD-----DDLWHQ-FAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWL-PVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIK--KSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQ--RFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVA---FLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIK-ISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFD--GTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPC-------QSGQQDKWIQSGVALF 12983
            L++ ID + +  P+L+ +  + +   HW  +  +      +  E   LR+I++A  + +++ E I+++   A  E  I + ++E+        F    +   +N    L++     ++I+ + D+  +L SL  + Y   F+ +   W   L++  + +++   +Q  W+YLE +F  G  A  LPKE   F  +D+ +  IM+  +    V+  C     M  LL  +++QL  CQK+L  YLE+KR LFPRF+F+ D  LLEILGQ+++   I++HL  +F  I  V F++ I   I+ + S + E +EL   +     VE WL  L  E + +L   +  A   L + N+    I+  + + +Q+  L   + +T   EE L   +     + ++ K N +     N  + ++      V   K ++LI   VH  DI D L   +  + +++EWLKQ RFY         I + D  F+Y  E+ G   +LV TPLTD+CY+TL Q + M +GG P GPAGTGKTE++K +G   G+ V+VFNC + +D + +GRIF GL + GSWGCFDEFNR+E  VLS  + QI I+    K++ +     +   V+++    IF+T+NP   GY GRQ+LP+NLK  FR V+M  PD  +I  V L S GF +  +L  K   ++ L  E L+ Q HYD+GLR + +VL+  GAA                  +    SD E+ ++ + L+   LSKL   D   F SLI+D+FP I++ +  Y  L +AI++ I+E  +++      K++++YE  R R G++ +GPSGSGK+T  ++L  A+ + GQ  +   MNPKAI   Q+ G +D+ T +W+DG+ +   R+ +K  +    WI+ DG +D  WIE+LNSVLDDNR LT+ +G+RI   PN   +FE H++  ASPAT+SR GM+F+SS       ++  WLK++  ++  +L       F +   +  +  EF +       +    N L  L  +K +            +   L+   G  L    R+   LW     V   +  + P   ++ + +YY    +   V +S   EE +           +TP    IL  ++      F I   S   +  +L G +G  K++++     K    +Q+   L+ S+ TTP+ + Q+  ++   ++   G  Y P   +++ + + DIN+P +++WG       ++Q++  KGFY  +   EF  +  VQ + +M             R      + + + PS   ++ I+             +++ V +R IP+       +W Q +K+K+L            +KF      HY+F   DL++    +L  +  V   N+   LL +  +E  R+  DR    D  +  D  L   +  +   E   V D   + +FV +    P+A G  P      + K+     + E LKD ++  L QY+   R   +D++ F++   ++ K+ R++  PGG+ LL G  G G+++ + L S +   K+    + R Y       DLKS  + AG +G+ I  +  D++  E  +LE +N++L+SGEV  L+   E++ IL  L     ++         +L +YF  R++H LH++L        F       PA    C++ W  +W +D+++++ +  ++    +   Q+     +     Q   ++    YFL    +  V   T + Y++FI+ Y  IY++K+ E+      +  G++K+ EA E VA L  +   + K L     +AD  LK++T   + +   K E++K+  K       +   KA  +++L    P +++A  A+  IK SD++ +R L  PP +I   ++ VLL++               + +SW    N +       E++ F    I  E+   ++        +++ + A+ AS   A L +W KA   +    +++ P       LK NL   E ++     DLEK  +++D   A     R ++E+   +   L  + K     +  A +L+  L  E ERW +Q  E  A+   L    LLA A + Y  S P +Q    + L   +  L++         D+ + L       EW  +GL +DELS+ N +++ +    P LIDP +    W+KN     +L+I +     F   LE S+  G+ L+I++V + L+PVL  +L  + I  G    V++GDK +D    FKL++ T+ P P   P+  A  S ++FT T  GL+ QLL   +   K ++E+ +T+LL++    K ++ ++E++LL  L +  G++++++ L++ L  TK+++  ++Q L+ +   Q+ ++  R+ + P+A  GS L+F+I+++S +N MY+ SLT FL LF  +L  S  S++++ R  S+I  +   VY Y  R +++  + +F L ++             E    T I   +  ++       A+  + +S  NL   + +LW    I D     + LW   F K +  E  +P S ++ L  F+++L+I+   PDR  +   ++  D +  K+     +++   +E E+    P++  +S G+DP+  +  L  K+    RY  V+MGQGQ      LL +   NG W  L+N HL  +++  +++  + +   +  FRLW+T E H  F   LLQ S+K T E P G+K  L R+Y   ++D +  + +      L+ +A+ H+ +QERR F P GW   YEF+ AD  A  + +   +    + + + W  +  +     +GGRV + +D R+L+++ K +FN ++     NFY    +P  +S   YLA I  L  Y++P  F L  N D + Q   +  V+  +  +Q    S  G +  +   SR  + +L +         +    +P  +KR     P+     FL+ E     +++  V S+LI L   + G+ ++++ +++  +C+   + P  W++ W      F +   L+ + +  + W      +    T       F+P  FL A++Q  AR  K  ++D +     V +W   ++       V +  L++EG  +D     +TE    S   VL   + V W+       Y+E++++  P  Y     K  T+ DI C        +   + W+  GVAL 
Sbjct:  966 LKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEA--DPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGF---KNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQLDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDRPITAEGNVEVWLNALLKESQRSLHLVIRQAA--LAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAH---YDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAA------------------KRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKEQCGELPREHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVT-AEGHWVHWSTRVEEYIYPPD-------VTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPL-MFQRTVES--YVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQ-RLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEV-QRTIPQLVLLTRRLW-QLTKIKMLPT---------PAKF------HYIFNLRDLSRIWQGMLCTNAEVI--NSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHV---TPKSYLSFIQGYKTIYVEKRAEV------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNL--PNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLP-------LKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSY--SGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFL--TLIKGGASLDLKTCPQKPAEWILDMSWLNLVE-LSKLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWE-ESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRY--VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEK---------LPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKSWASSTLGFWFTE-LLERNRQFQTWLFKGRPNCFWMT-----GFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTE----SKPKVLFEMMPVIWM-------YAENNVVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALL 4109          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 1007.67 bits (2604), Expect = 0.000e+0
Identity = 874/3301 (26.48%), Postives = 1542/3301 (46.71%), Query Frame = 3
Query: 3615 KEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLE---ALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKN----ALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSE----VENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLAL---NKIG----QTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKK-----QDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNK----------------AHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPE-------------MNKQNVLNYYFNE--KQNRLVTYSYECEEELSIDQLMS-DKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSL-----MLNH----CFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKR--LIPKHPIWSQNSKVKLLANTMIEVYSQ-LKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTS----------------EYLKDTIDRGLLQYSRECRD-LDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTL-QTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRG------SLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALK--KITSVMQGATERKGEM--EKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIK-SSDLSEIRALRAPPDVIRDILEGVLLI-----------MGT---MDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVE-ELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKT------GLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXX--XXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKL-------VYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWE------LFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSV-LNIKDDDLWHQFAKSSE-CEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEK---ELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSY--DNWSE-DFISKTGSGTRA--NALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVV-------NGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHG--------TKFD--KDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPF-DYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSAKYSVKIGNLHIEGCLFD--GTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKID---------IPCQSGQQDKWIQSGVALFLK 12989
            ++I  +KD IP++  +   GL   HW +M ++     G  L      +LR +L    E     E  + ++  A  E ++ +A++ +     G  F    + D+    +S+     DI   + D     Q++  SP+ + FQ +   WE +L  + E +    ++Q +W+YLEPIF        +P+E   F+ VD ++R IM    ++++VL   S+ G+   L      L++  K LN YLE+KR  FP                                                M S +GE VEL  Q + TSE    VE WL  L + M +++ D +  +    R   ++       ++P Q++  +  I +T    + L         K+  ++L    N  + L            L +L+   VH  D++  L+++     T++EWL QLR+Y  + +    + +++ +  Y YEY GN+P+LV TPLTD+CY TL    H+ LGG P GPAGTGKTE+ K L      Q +VFNC +G+D  +MG+ F GL   G+W CFDEFNR+E  VLS V+ Q+  IQ  I +K++        + ++ N  + IT+NP   GY GR +LPDNLK LFR VAM  P+  LIAE+ L S GF NAK L  K+V  + L  E L+ Q HYD+G+RA+K VL  A NL    K K   +  D             L++++++     K    D   F  +  D+FP + +   +Y     A EE  K  N+   K    K+++ YE +  R   ++VG S +GK+ +  +L   L   N+ G    + V F  +NPK+I   QL G  D+ + EW+DGV+  + R+        + W++ DG ID  WIES+N+VLDDN+ L + SGE IQ    ++ IFE +DLS ASPAT+SR GMI++       K LV SW+       Q   ++ L+          SL  + +     + T+N  TV       K I ++                A F+  L+  +GG  + +SRE F  ++ +    K  E             +N++ ++  YF E  ++ R + ++ +  E +++ ++ +  ++I+ P I T      +D         +Q P +  GP G GKS+     +LN+    C+  L      + H SA  T   ++ K+++           V+ P   +R +L++ D+N+P  +++G    +  L+Q + + G YD  +   + L  VQ + +M        +   +RF   + + SI+  S D +  I+++ +   +K+    P+  I         +   M+EVY + + +       SHY F   D ++ +   L   L   S     +L+ +  +E  R++ DRLV  + R      L N+I       V+D  N  +   +G  +         +Q    G   +                E   + +   L +Y++  ++ +++++F  + ++++++ RVL +PGG+ LL G  G GR++ + L + M ++ L  P++ + Y + ++++DLK  L + AGV+G+  V L+ D Q  +  +LE I+S+L +GEVP L+  +E + I+ +++ +A ++G +       +L  +F  R K  LH+++        F    +  P+    C++ W + W  +++ ++    +  +   E  +  +     KT  T ++ L+ +  +L       + T   Y+  I  + ++  +K+  I   +     G+ +++ A+  VA++K +  +    L + +++  K ++  ++ S+   A  R   +  E   +K  E   +    K+  +++LA   P ++ A  A+  +K  SD+S ++A++ PP  ++ ++  V ++            GT   +   W   +  LG      +++ +D   I       +  E +T     FDP     AS AA  L  W+ A   Y    + +AP + +  + + +L   +  +      + +V+  +   +K FE+ T + A+LE ++++    +  AE L+  L  E + W+K   +L      LT   L++A  + Y+       R+   +LW            + F + K L    E   W   GL +D  S++N  VI++    P +IDP   A  W+KN  KD  L ++   D ++   LE  ++FG  L+++ V + L+P L PLL      QG  + ++LG+++I+Y+ DF+ ++ TR   P   P+    VS +NF  T  GL+ QLL + +   +P+LEE +T L+ +    K +L ++E+S+L+ L ++ GNIL ++  +      K   + IT  Q ++ + K ++ + E R+ +  +A+H S LFF I+DL+ I+ MY++SL  F+ L+        I++   +++  L   LE L       +Y  VCRS+F+ D+L+F+  +  CC  +L   +E E      L TG      +  N   P W+  D++      AS +P    +   IK+ + +     S E C  ++P     KL+  QK++I + LRPD +  A+++F    L  K + P + +L + +  ++ S  P++ ++SPGADP   L+  S K +   R+  +++GQGQ  I   ++    QNG W+CL+N HL  SW+  LEK   + +    H+DFRLW+T+ P   F   +LQ+ +K+T E P G++ NLL+SY  D  S+ +F +            LF L +FHA++QER+ F P GW   Y F+ +DL      L Q + + ++ + ++ I  L     +GGRV + +D R+L + +  ++ + ++       + SG ++     P  +S  DY+  I  L     P  F L +N+D S     +  +   L + Q     G        T +D   +I +++L P  +R  +L +   + + S+   L +           ++ERYN   L   +  SL +L K LKG  ++  E++ ++  L+ G+ P  W +      +P   Y+   + + K ++ W E  +       +  L   F    FL  + Q  AR  +I +D L F   V     S    +  V +  L ++G  +D  G +  +  R     +L   + + WV   + N    D +   P+Y    R   ++            +     +   WI+ GVA+ L+
Sbjct:  565 EQIQKFKDYIPVVSILCNPGLRGRHWEKMSQI----AGFDLTPNFGTSLRKLLQLKLEPF--LEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDT---GVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP------------------------------------------------MYSSEGERVELI-QNISTSEANGAVEKWLLQLEDGMISSVRDIIDRS----RAYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKALG-------LKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIEK-VSDETDFEWLAQLRYYWMNDN--VRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNP---GYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNL----KLKFPNENEDI------------LLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWINTLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESIRTWIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWECPINEKGLVYDYFYEFKEKGRWIHWN-DTIENINLGEINTKGQEIIVPTIDTVRYTYLMDL------CISQGPLLFVGPTGTGKSVYVKDKLLNNLDKDCY--LPFFINFSAHTSANQTQNIIMSKMDK-------RRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDH-GHYDLKDTSKISLVDVQFIAAMGPPGGGRNAVT-SRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQ-----IVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLL--LKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQ-LMNSI-------VKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIA-QAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENER-QEVITICKTFHTSANQLSDFQAELGR---YNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQAL----KSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTN--PDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGE-KIWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNG-VIVRNSRRPLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFKQG-VESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVAK-EPELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLY--------INSIQDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLL--CC--NLLARKEIEHSDLMFLLTGGIGLQNTVANPD-PSWLQ-DKSWDEICRASELPGFQGLEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPDMV-PAVTKFVTRNLGKKFVQPPAFDLTKSF-LDSNSTIPLVFVLSPGADPMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDK-VPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFA----PPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQ-----------EMERYN---LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQ-----PKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKSETPPEDGVYVNGLFLDGARWDKEGVLTEQHPR-----ILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQ 3679          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 934.48 bits (2414), Expect = 0.000e+0
Identity = 762/2763 (27.58%), Postives = 1328/2763 (48.06%), Query Frame = 3
Query: 5061 TPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLER-RVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLK--GAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYN------GLSNLKA-IKNKAHFSVCLIKGL----GGNLNENSRETFALW-----VYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPL---ILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKL-KSVQV-TTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFY--DSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYT-----------AYLKPVLKRLIPK-----HPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVS-LLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVE---VQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKL-----TSEYLKDTIDRGLLQYSRECRD--LDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSL-----KDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAK--PKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIM-------------GTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMK----DLEKGVSDVDKAVAG---YRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK--------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAIS--NLASAMPELWSVLNIKD-----DDLWHQ-FAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWL-PVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIK--KSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQ--RFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVA---FLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQ-WEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIK-ISMDELKF---VCRWGGSNV--SAKYSVKIGNLHIEGCLFD--GTMITECNRDSNSIVLLPPVSVGWV-DKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPC-------QSGQQDKWIQSGVALF 12983
            T L   CY+TL Q + M +GG P GPAGTGKTE++K +G   G+ V+VFNC + +D + +GRIF GL + GSWGCFDEFNR+E  VLS  + QI I+    K++ +     +   V+++    IF+T+NP   GY GRQ+LP+NLK  FR V+M  PD  +I  V L S GF +  +L  K   ++ L  E L+ Q HYD+GLR + +VL+  GAA                  +    SD E+ ++ + L+   LSKL   D   F SLI+D+FP I++ +  Y  L +AI++ I+E  +++      K++++YE  R R G++ +GPSGSGK+T  ++L  A+ + GQ  +   MNPKAI   Q+ G +D+ T +W+DG+ +   R+ +K  +    WI+ DG +D  WIE+LNSVLDDNR LT+ +G+RI   PN   +FE H++  ASPAT+SR GM+F+SS       ++  WLK++  ++  +L       F +   +  +  EF +       +        GL  LK  +K   H     I  L    G  L    R+   LW     V   +  + P   ++ + +YY    +   V +S   EE +    +       TP    IL  ++      F I   S   +  +L G +G  K++++     K    +Q+   L+ S+ TTP+ + Q+  ++   ++   G  Y P   +++ + + DIN+P +++WG       ++Q++  KGFY  +   EF  +  VQ + +M             R      + + + PS   ++ I+             +++ V +R IP+       +W Q +K+K+L            +KF      HY+F   DL++    +L  +   +S N     LL +  +E  R+  DR    D  +  D  L   +  +   E   V D   + +FV +    P+A G  P      + K+     + E LKD ++  L QY+   R   +D++ F++   ++ K+ R++  PGG+ LL G  G G+++ + L S +   K+    + R   L+     LKS  + AG +G+ I  +  D++  E  +LE +N++L+SGEV  L+   E++ IL  L     ++         +L +YF  R++H LH++L        F       PA    C++ W  +W +D+++++ +  ++    +   Q+     +     Q   ++    YFL    +  V   T + Y++FI+ Y  IY++K+ E++   N +  G++K+ EA E VA L  +   + K L     +AD  LK++T   + +   K E++K+  K       +   KA  +++L    P +++A  A+  IK SD++ +R L  PP +I   ++ VLL++               + +SW    N +       E++ F    I  E+   ++        +++ + A+ AS   A L +W KA   +    +++ P       LK NL   E ++     DLEK  +++D   A     R ++E+   +   L  + K     +  A +L+  L  E ERW +Q  E  A+   L    LLA A + Y  S P +Q    + L   +  L++         D+ + L       EW  +GL +DELS+ N +++ +    P LIDP +    W+KN     +L+I +     F   LE S+  G+ L+I++V + L+PVL  +L  + I  G    V++GDK +D    FKL++ T+ P P   P+  A  S ++FT T  GL+ QLL   +   K ++E+ +T+LL++    K ++ ++E++LL  L +  G++++++ L++ L  TK+++  ++Q L+ +   Q+ ++  R+ + P+A  GS L+F+I+++S +N MY+ SLT FL LF  +L  S  S++++ R  S+I  +   VY Y  R +++  + +F L ++             E    T I   +  ++       A+  + +S  NL   + +LW    I D     + LW   F K +  E  +P S ++ L  F+++L+I+   PDR  +   ++  D +  K+     +++   +E E+    P++  +S G+DP+  +  L  K+    RY  V+MGQGQ      LL +   NG W  L+N HL  +++  +++  + +   +  FRLW+T E H  F   LLQ S+K T E P G+K  L R+Y   ++D +  + +      L+ +A+ H+ +QERR F P GW   YEF+ AD  A  + +   +    + + + W  +  +     +GGRV + +D R+L+++ K +FN ++     NFY    +P  +S   YLA I  L  Y++P  F L  N D + Q   +  V+  +  +Q    S  G +  +   SR  + +L +         +    +P  +KR     P+     FL+ E     +++  V S+LI L   + G+ ++++ +++  +C+   + P  W+++ W      F +   L+ + +  + W      +    T       F+P  FL A++Q  AR  K  ++D +     V +W   ++       V +  L++EG  +D     +TE    S   VL   + V W+  +N  +S  +  ++  P  Y     K  T+ DI C        +   + W+  GVAL 
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNP---GYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAA------------------KRANPSDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKLKVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSPNEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIPLKVRLKLNQHLERLYIFALMWSAGALLELEDRKKMELWFRGNDVIRRSLPEIPPGREETMFDYYVT-AEGHWVHWSTRVEEYIYPPDV-------TPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPL-MFQRTVES--YVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQ-RLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEV-QRTIPQLVLLTRRLW-QLTKIKMLPTP---------AKF------HYIFNLRDLSRIWQGMLCTNH--SSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHV---TPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVKVEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNL--PNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLP-------LKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSY--SGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFL--TLIKGGASLDLKTCPQKPAEWILDMSWLNLVE-LSKLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQS-LDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWE-ESNPRTPLICFLSMGSDPTDSIIALGKKLKIETRY--VSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFMDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGIPKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEK---------LPPDYIPFEVKRLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWASSTLGFWFTE-LLERNRQFQTWLFKGRPNCFWMT-----GFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKWMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTE----SKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTDINCIASVGLKTTQPPEHWVLRGVALL 2683          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 930.628 bits (2404), Expect = 0.000e+0
Identity = 826/3200 (25.81%), Postives = 1481/3200 (46.28%), Query Frame = 3
Query: 3681 QDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGK----NALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDI--QHII-TMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTT---LSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELL---NENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYN---GLSNLKAIKN------KAHFSVCLIKGLGGNLNENSRETFALWVYELT------DEKTPEMNKQ-----NVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKI-WLNSDT---QQPFILSGPEGCGKSLMLNHCFQKLK--SVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD--SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVD-----DYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLND-VWFVTW-GSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINK--IPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFEL-----KNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRK----EKMQLWMEKTGL---EKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQ-QDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGN-IXXXXXXXXXXXXXXESSITISQ-SLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMS-HCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVL--NIKDDDL-WHQFAKSSECERE-IPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSL-KPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRN----IQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYG------KIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPE---EPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGT---MITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDK-----IVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            +DHW ++         + L+  TL  +   + E+ ++A  I E+   A  E++I       E+      F +   +      + L+    +I+  + ++   LQ +  S +   F D    WE  L    E ++   Q+Q KW+ LE IF      + LP+E  + +++ + F  IM        +   C++ G  + L  + + L+R QK L  +L+ KR+ FPRF+ I DD+LL +LG S +P  I+ H+ K++  I  +    D   Q ++  M S +GEV+E R  V + + VE+W+  +  EMK T   ++ +  Y   D   S Q    + A++           + +T   E  +   N+ +   LKK   ++++   +  ++     T     LK+ ++++  VH  DI+D  + ++ + V ++EW  QLRFY   +     ++  +   +Y YEY G   +L  TPLT + YLTLTQ + M LGG   GPAG GKTE+VK L    G   +V +C E +D  ++G+I  GL KCG WGCFDEFNR+  +VLS VS QIQ I++ + +  +      +++++D +  I+IT+NP+   Y  R +LP+++K  FRPV +  PD   I E++L S GF  AKEL +K+  ++  +   L+ Q HYD+GL + K+VLK A         KMK    D++E  +D      ++++ALR   L KL   D   F  LI D+FP +D   + + +    +EE++++ N   L  Q  K++++YE +  +   +IVG +  GKS +   L  A   +G   K Y +NPKA    +L G  D +TR+W+DG+ +   R++ +   + + +I+ DGD+D +W+E++NSVLDDN+LLT+ +G+RI+   +   +FE  DL  ASPAT+SR  ++F+  +          W+K +       L+   + +    +D +   +E  +  ++V  V      L  L   KN      + +F   L   LG  L E+ R  F   V  L+      DEK      +      + +++F+E Q + V +S    E            I  P +  ADI   +D  +  W+       ++P +L G  G  K+ ++ +  +     S    T++ S++TT + + + L      I   T   Y P   ++L+++  DIN+PK+D +GT Q ++ L+ ++   G YD    L F  +  +  + +M  +          RF S+  + +I  P+ + L+ IY + +K   +            + ++ +  T+ E   +L +    D        HY F+  +L++ +   L    P  S  T    + +   E +R F DRL     +    G +   +   +  + +  L D + F  +  +RE                ++  +     + + + Q           LF++  +++ ++ R+L    G  LL G  G   +  + L +   + ++    + RGY    F+NDLK+     G+E    V L  D   +E  +LE IN++L S  VP L+  +E E I+  +   A + G    + S+  YF  +  + LHI+L +  +       C++ P       + W   WS  ++  +   ++    IP+     +  +       L    + +   L  H  C   ++TS+ +++FI  Y  + L++KNE   +   ++  + ++ EA+E + E                                          L +K  ++ V+LAK+ A                    + ++  D ++  +   PP  ++ + E +L++ G  + +W++ +  + + G    +   D   I+  S I   + L   + S +    +  S A + +  +V++ + Y    +++ P +++  +L++    ++ +++ ++  ++++ K  +  ++ +E      A LE EL     K     ++AA+ LV  L +E E W K + EL  +   L    L+AAA + Y  +   D R     +K    +++ G+   + F +  FLT + E + W  EGL  DE S++N ++  +G   P  IDP   A  W+KN  KD  L+ V+   D +F   LELS+++G   ++Q+V + ++P++  +L  +++    R V+ LGDK ++Y+P+FKLFL T    PQ  P        +N++T + GL+ QLL++T   ++   +++   L++E  + K  L  + +SLL EL  +TGN + N + +        E+S TI + S+ +S  ++ +    R+ + P+A+ G+ LFF +SD++ +N MY++SLTS+L LF+ +L  S    +   R  ++I  L   V+ Y    +F   +L+F+++M+    + +   PQ+   F    +S    +     +WI       I+ LA   PE +S L  +I+ +   W  +      E+   P      LS FQK+L+++ LR DRL  A++ +   V     + P  +N   IYE  T +  PI+ I+S G+DP+ DL + + K     ++  +A+GQGQ  + L LL K    G WL L+N HL+  WL  LEK L  +  P+ +FR+W+T      F   +LQ S K+  E P  +K N+  +Y   S+  +S        + ++ LA+FHA++QER  +   GW+    F+ +D  A  E+L   + K +      I W+ +  L    ++GGR  + FD R+L  Y+  YF D + +   +F+         ++P    K  Y   I ++    +P    LP  ++         ++   LR+LQ  +  G     D     +   + +       +N++   L   L  +S    VV   +L R+N  KLV  +  S++ L + L G   ++KE  +L+        P +W +    PE      D+M  L  + +    W ++ E +     ++ L  L  P+++L A+ Q   R     +D+  F               ++   ++ G   +G    M   C   S   VL+  + +  V   Q NS    + +  P+Y   LR       +V + D+   +     W+ SGV L+L S
Sbjct: 1176 RDHWNKLMERTGKSFDMNLQRFTLETLF--SLELHKYANDIDEIVTSALKELSI-------EMTWKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRNDLERIQKNLANHLDSKRNEFPRFFLISDDELLNVLG-SVDPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEFRKPVPLEARVEDWIMAVLQEMKRTSRLITKEAVYHYVDWIRSYQCMMVLAANR-----------VWWTWEVENAIKNVNKGDKYALKK-YAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPS---YERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAG--------KMK---RDSLELSEDV-----VLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQA-QTLGLCTKLYPLNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNR-------LNRLFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEVLECYFLEALYCSLGATLVESGRLKFDKLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFDETQEKWVPWSSLVPE-----------YIHNPAMKFADILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEAN---IEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVD-PRFLSLFSVFNIPPPATESLHLIYASIIKGHTRPF---------KAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSR-IYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLADPILFGDYRAAREECEQ------------RVYEDIGDYDVSKAIFQ-----------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNMLISM-VPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLC---DFSKQLLLKHQRC--NYATSKSFLDFISSYSTL-LEEKNEHVLQCKCLEGSLNRLREAREQIDE------------------------------------------LNLKLADQKVVLAKKTAT-----------------CTAFLEEIDKNQTISFAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISN-SHISTIKFLKNLQTSVE--EMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYED-----ANLEKELQLDEAKLMERRLTAADKLVLGLTSERE-WTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLE-ISWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYSTLR-GLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFA--NLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVT-VTMGNCVHPPLINFTTIYERST-AFSPIVFIMSSGSDPTTDLIKFAEK--SGTKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPTS----VVLLQELRRFN--KLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRL--APETLKSLDDWMSHLRRRYEQYSNW-QVREGE---PKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRNASGAGLVFEADL-FTTMHTSHWVLSGVCLYLNS 4175          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Planmine SMEST
Match: SMESG000008382.1 (SMESG000008382.1)

HSP 1 Score: 6964.39 bits (18068), Expect = 0.000e+0
Identity = 3504/3509 (99.86%), Postives = 3506/3509 (99.91%), Query Frame = 3
Query: 2466 MKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFISDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            MKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFELMMESFQMMMQEQIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQKIKDKKLELEELVIIKTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQ NDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCSMNSSSSMGRSSLSTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREPQAAGAPPPIQGKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNLLQEEEKLKIELSKMEESLLQELANATGNILNNKDLLLSLNKTKESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFI DKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQEL+TKVIGSERYNQVAMGQGQADI LNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDRSSQRIISSQVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSE+DMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS
Sbjct:    1 MKKFITLPNQFKGLNDSSPGNQLIFPSVIERNAAGFVVCYQKAEFLFQRLSACLNKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKAMKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTVSQLQQKWDKFELMMESFQMMMQEQIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQKIKDKKLELEELVIIKTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTIRLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMSNQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFIVHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQENDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQDEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNGLSNLKAIKNKAHFSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCSMNSSSSMGRSSLSTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREPQAAGAPPPIQGKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESGHRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGSDNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEKFDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNLLQEEEKLKIELSKMEESLLQELANATGNILNNKDLLLSLNKTKESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCRPDLFKPQEWELFTGTFIGDKSDRNITVPKWIDADRTVAISNLASAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELATKVIGSERYNQVAMGQGQADIALNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDRSSQRIISSQVILQLRILQRFSVHGTKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSVGWVDKNQPNSYSENDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 3509          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Planmine SMEST
Match: SMESG000008384.1 (SMESG000008384.1)

HSP 1 Score: 1399.8 bits (3622), Expect = 0.000e+0
Identity = 687/691 (99.42%), Postives = 689/691 (99.71%), Query Frame = 3
Query:   96 MSKIEDQRKDTIFLITKSHFPNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDTDPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLICEKI 2168
            MSKIEDQRKDTIFLITKSHFPNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDTDPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFL  +K+
Sbjct:    1 MSKIEDQRKDTIFLITKSHFPNQNSKFVNEECLDKFFDNLDNNVLVVKFIDNKFIFSNQLNTTDKVVNALVFIKTSPSIITPDNINSGIIVTTLSENPISSLYNIIQNIYGPILLSDTDPKIQKLISELENGLGSIIRKPLSKKSKYQTDETIVLGIFSIDDEIMFWNDSLSASSHDQNQSRINELISFLQQVNEEMKLIASESLNESFSYLENVFGLLNDIWQSETINPNYPQSRMKTLMEIIANELVRIIQTQLNPLWFWEDSYALVKESLTQAIEVCSHWIDMCDKLIKRYWKQYLPHKWNTDNNLNLSYISNFQIRLTEISSLRTVHEQITQILPHRERQEFKIEEAFKYFLNILPLAYNPYTEPIWKIAVKKFHRHIEPAETNIGTRLKVIFKECASAEMPQQLLRLFQRYNDLITRPKISVNLLQERETLLAQLVIHRKQLREDFIHRSRQGKVPPTKNASDEISKIVWSKQLEAKLNEILSITSNVLKDLDGFEKFLKETKNFLEEISNWRQEQFEQWNQEMTRRLDDSSNDGIRLDMQGRLMELSQKDGLLYVNYSDRLVNLIREVRTLSGLGYDISKSVIAAADNGQKFYSKAVILKQVAQFYNTINTQMIPCQQAMMLDAAINFEKLVKSVGSQSKTKNVVQWNNPEELNQFIDKLQKASHSIISQNRLLRKQHFLSVKKL 691          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Planmine SMEST
Match: SMESG000038602.1 (SMESG000038602.1)

HSP 1 Score: 1346.26 bits (3483), Expect = 0.000e+0
Identity = 957/3418 (28.00%), Postives = 1730/3418 (50.61%), Query Frame = 3
Query: 3453 MWSQFEEYQTGLQNLAKEDWLSFRSRYYLFE-EFLTQWFEKLRNAEITTMTI-RLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIREL-ELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSE--VENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSN-----YGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFI----VHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCV----IQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGI------KNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIEN-VQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQH-------KKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQV---VKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKK-------QDEHD------------------------QHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVG--TVYNGLSNL-----KAIKNKAHFS----------------------VCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNK-QNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGIL-------FNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAK-------PKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWM----EKTGLEKFDMRK--FLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRAL-NTSEIST--DSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHC----CRPDLFKPQEWELF----TGTFISDKSDRNITVPKWIDADRTVAISNLA----------------------------SAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVL--ELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTK--------VIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVN------GSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRILQR-------FSVHGTKFDKDI--------WSRELNPVLNRW-KILNQGLNIIKASLPDSLKRSSTDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGP--------EEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKFVCRWGGSNVSAKYSVKIGNLHIEGCLFDGTMITECNRDSNSIVLLPPVSV---GW--VDKNQP-NSYSEDDMISLPIYYDILRDKIVTKIDIPCQSGQQDKWIQSGVALFLKS 12992
            +W++ +     ++++ +  WLS + R    + E LT   ++L N+     +   ++  + MY  +   +  ++ E + + HW  + R LN+    +L  L L  + D   +++++ E I+E+   AQGE  + E +R++ E+W    V +L  Y   Q+ S  +IK W D+ ++V ++   + S+K SPY++ F+++A  WE++L  ++        +QR+W+YL+ IF  +A     LP E  RF+ V  +F  +M  V ++  V  + +++ ++  L  + D L + QK+L EYLE +RS FPRFYF+GD+DLLEI+G S + + ++ H KK+F G++ +  ++D + I+ M S +GE +   + V I     + +WL  +  EM+ +L+  L+ A++++     +SN     + +  DKY +QI+ L+  I ++   E  L     ++L+  +        ++ +++ AD+       V   KL+ LI++ VH  D++  L +    S   ++W+ Q+RFY   K    +    I + +A+F+Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVK+LG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSAVS QIQ IQ+ +      K     + LL ++V+V+ + AIFIT+NP   GY GR  LPDNLK+LFR +AM++PD  LIA+V+L S GF+ A+ L  K+V  F L  E L+PQ HYD+GLRALK+VL  A N+    ++  K K+  +G +  E  + +   E ++++Q++    + KL   D     SL+ DVFP ++ ++ E   L   + +V + + +V     +       +K+L++Y+      G+++VGPSGSGK+   ++L  AL  I G     ++++PK+I +  L G++D +TREW+DG+ T+  R++   V+     + WI+ DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+SR GM++ S E      ++T +L +       + E D                        Q  +S+ L  FF +    IAK  +++ +  ++   T    L++L     ++I+N   ++                        ++  + G+     RE  + ++  ++    P +   +N++++  N  Q   V +S +  +       ++   ++ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +Q C    +  G V  P++  + LI +  +INLP +DK+GT ++ISFL+Q++ + GFY  +++++V  + +Q V + N  +  GR  LS RF   V +  + YP +  L  IY+ + + +L R++P     S       L N M+E + + + +FT D   HY+++P ++T+WV  +     P+ S +    L+ I ++E++R+FQDRLV  D R   D  +       F  I+ E +++       + +  W S              K    +T E L+D +   L  +  E  D+ ++LF +V D+V ++DRV  +P G +LL G SG G+ T S  VS ++ + +   K+H  Y  + F  DL++ L+ +G +GE I  ++++   ++  +LE +N+LLA+GEVPGL+  +EL  ++   K+ A   G     +  L  +F  +I   LH++  M+ S         ++PA F  C + W   WS ++  ++     N++  E       ++         P+  +     +N+    +H T                  T RHY++ I  Y+++  +K+ ++E +Q H+  G+KKI +  + V  ++    ++ + L      A+  LK++    Q A ++K   + L  +  ++   + +++  +  EL  +EP V +A+ AV +I+  D+ EI+A++ PP+ ++  +E + L++G   T W S+   + K      I  F+   ++  +R  +++      D ++ +   +AS A  P+  WV A + Y+  L+++ PL NE  +L    E   KK ++ E  ++ ++K++A Y +++    + A  ++ +L +    +  +  L+  L +E  RW+       A+++ +    LL++A + Y     +  R      W     E   L + D+ +  +L+   ++L W+   L +D+L +ENA+++ +    P +IDPS  AT +L N +K++K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  ++   G R ++ LGD+ ID +P F +FL+TR+P  +  PD  + V+ VNFT T++ L+ Q L   ++  +P +++++++LL+ + + +++L  +E+ LLQ L  A GN+L N  ++  L   K  +  +++ +EE+  +   ++     ++PLA+  S+++F +  +++I+ +Y++SL   L +F   L N  E++    ++ R   +   L ++ Y  + R +   D++ FA  ++        P  F   E++ F      T  S  S++   +   +  D+  ++  L                             S +PELW   N  +D+   + AK                     +LIIQA+RPDRL ++  +F   VL          +++L  I E E  +  PIL+    G DPS  +++L+++         IGS      A G  QA+  +N     ++ G W+ LKN+HL TSWL  LEK+++SL+ H +FRL++T E        LL++   + +E PPG+K NLLR+  + +   +SK     R+   F LAW +AI+QER  ++P G++K YEF  +D +   + +D  +  +           I W  +  L  + I+GG++DN FD R+L+S++   F +   +         +    I  P +    D L  +++L D  +PS+  LP++ ++     +   +I  +  +Q+         V  +K  + I        W R+L      W +IL + +  ++ ++       +   P+    + E  +   L+  V   L  +++V KG++  T   +++   L  G  P +W++    P        ++  D ++ L+  +    K   ++    L S  + LG LF  + ++ A RQ  A+  K +++EL      G   V +   V      I G    G+ I +      S ++   + +    W  V+K+Q     S  D + LPIY +  R  ++  +         D + + GVA+   S
Sbjct:  763 VWNELKSIWEKIRDMKETPWLSVQPRKLRQDIENLTAQLKELPNSFKQYASFEHVRTLLKMYMKVNASIVELKSEAIKERHWRMLMRKLNV--SWSLNELQLGKVWDI--DLVKNEEIIREVLAIAQGEKALEEYLRQITEVW-KNYVLELTNY---QSKS-KIIKGWDDLFNKVKEHINNVTSMKASPYFKQFEEEATAWEDRLNKINALFDVWIDVQRRWIYLDGIFAGSADIKVLLPVESQRFQSVSTEFLGLMKKVQKSPLVTDVLNIANVQRQLERLADLLGKIQKSLGEYLERQRSSFPRFYFVGDEDLLEIIGNSKDLKKLQKHFKKMFAGVHSIILSEDEKVILGMMSKEGEELRFISPVSIIEHPRINDWLTAMEKEMRVSLAKYLNVAVKEISGWRTESNIDKDKFMVWLDKYQAQIVVLAAQITWSEAVEASLASG--VSLESTMT-----VVHSTLNMLADTVLYEQPPVRRRKLEHLIIEYVHQRDVLRALHNDGVSSNKNFDWMSQMRFYFDPKQTDPLHQLSIHVANAKFHYGFEYLGVCDRLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKSLGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQGIQEALRELMVSKKDSINVELLGKQVHVNPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTQPDRQLIAQVMLYSQGFRTAEVLAGKVVPFFKLCDEQLSPQSHYDFGLRALKSVLVSAGNVKRDRIKQEKEKIVARGEEINETAIAEQLPEQEILIQSVMETMVPKLIADDIPLLYSLLTDVFPGVEYRQAEMKRLREELRKVSENKFLVYSDEPNTAGYLWVEKVLQLYQITTIHHGLMMVGPSGSGKTMACRVLLQALENIDGIEGVAHIIDPKSISKDSLYGYMDPNTREWTDGLFTHILRRIIDSVRGESNKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLAIPPNVRIMFEVQDLKYATLATVSRCGMVWFSEEVLTTGMILTHFLNELKKVQVMEGEEDFSVNQGDTGADADSKISSSPIIQLQTQVSSILAPFFTED-GLIAKCLDYSTTLEHIMDFTRLRALTSLFSMIKQSIRNMIEYNQSHSDFPLNNEQIENYVAKSLISSVVWSMSGDSKLKVREQLSQYIKNISTVDLPTVGGIKNIIDFEVN-IQGTWVAWSNKVPQIEVETHKITATDVVVP---TMDTVRHEALLYTWLAE--HRPVLLCGPPGSGKTMTLFSALRCLPDMEVVGLNFSSATTPELMLKTFDQYCEYRKTPNGIVLAPQQLNKWLIFFCDEINLPDMDKYGTQRVISFLRQMVEHHGFYRITDMQWVSFERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGETSLKQIYSTFNRAML-RMLP-----SLRGYADTLTNAMVEFFLKTQERFTHDMQPHYIYSPREMTRWVRGIHEALKPLESLSVE-GLVRIWAHEALRLFQDRLVEEDERHWTDDNINEVALKHFPNINKEEALK-----RPILYSNWLS--------------KDYSAVTQEELRDYVKARLKVFYEEELDVPLVLFNQVLDHVLRIDRVFRQPQGHLLLIGVSGAGKTTLSRFVSWINGLSVFQVKVHNKYTAEDFDEDLRNVLRRSGCKGEKITFIMDESNVMDSSFLERMNTLLANGEVPGLFEGDELTTLMTQCKEGAIREGLMIDSQEELYKWFTQQICRNLHVVFTMNPSADGLKDKASTSPALFNRCVLNWFGDWSLEAYFQVGKEFTNRLDLERTDYKVPDTLPCIAEGLLPQNPIYRDVVVNALVF-VHQTMHQANVRVQKRGGRTAAITPRHYLDLIAHYMKLSAEKRADLEEQQLHLNNGLKKIEQTVDQVEVMQRSLTKKRQELENMNEAANAKLKQMVQDQQEAEQKKTTGQALKEELAKQEQFVNEKQKTVKQELDQVEPTVNEAKQAVQNIRKKDIQEIKAMKNPPNAVKMAVESICLLLGEKTTDWQSILKVIIKDTFVTSILNFNTDDVSDNTRETMKKKYLSNPD-YNFEKVNKASNACGPMVKWVLAQISYADILKRVEPLRNELTELSDAAEQNRKKSQETEDLIAQLEKSIAKYTEEYATLISQAQTIKSDLASVESKVGRSVALLGSLSSERTRWDSGSETFKAQMATINGDCLLSSAFMAYGGYFDQHMRTSLFNTWCHHLSEADILFRSDLARVEYLSNPDDRLRWQANSLPADDLCVENAIILRRYNRYPLIIDPSGQATTFLLNEYKEKKITKTSFLDDSFRKTLESALRFGTPLLVQDVESYDPILNPVLNREVRRTGGRTLITLGDQDIDLSPTFTIFLSTRDPSVEFAPDICSRVTFVNFTVTRSSLQNQCLNAVLKIERPDIDQKRSDLLKAQGEFQLKLRHLEKDLLQSLNEAQGNLLENDKIIARLETLKREAADVAKKVEETDVVMQEVESVSTEYVPLAQSCSNIYFTLEAMNQIHFLYQYSLQLMLDIFSSVLINNPELANVKAASDRLKIITKNLFQVTYNRLARGMLHEDQITFATILARIFLKGSTPIGFLENEFQHFLRSQEATITSSDSNKQDNLGLTLHQDQIDSVKRLKKLKVFAKIEEKVKSTKDIKNWTLTVTPESNVPELWVDDNNYNDEKLSKIAKG-----------------MYNLLIIQAIRPDRLLASTQKFIASVLGDTFTESVRGTLDLASIVEVEVTACVPILLCAVQGYDPSGRVEDLASEQGKQLTGIAIGS------AEGFSQAEKAIN---SAAKTGKWVMLKNVHLATSWLVSLEKKIHSLQAHPNFRLFLTMEITPKLPVNLLRAGRVLVFEPPPGIKANLLRTLSSINNQRMSKEPV-ERSRLYFLLAWLNAIVQERLRYVPLGYSKKYEFGESDFKCALDTIDTWVDGAAMGRTNLPPEKIPWVALQTLLGSCIYGGKIDNAFDQRLLNSFLGYLFTEKCFDHNFALVSDADDGSNIAFPESTKHTDILQWVHKLPDLQTPSWLGLPNSAEKVLLTNLGQSLIGNILKMQQSLEDDEELVVGQSKTKRTIEVGDGRPAWMRQLYQSTQTWLQILPKSVTPLQRTI------ENIKDPMYRCFEREVNSGCNLLASVRKDLEDVAEVCKGAKKPTNHHRSMMADLAKGIIPKMWIRYAIPPGLTVIQWIQDFADRIKQLLHISDTAAKSGVIA----LRSIQVWLGGLFMAEAYITATRQSVAQNNKWALEELFLDVELGEGKVDSNTCV------ITGLRLMGSEIVDPRTLKLSTLIYKDIDICRLKWIRVEKSQQLEGSSAKDKVCLPIYLNAARSTVLFTLYFSTTDSSYD-FYKRGVAILSSS 4082          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Planmine SMEST
Match: SMESG000038602.1 (SMESG000038602.1)

HSP 1 Score: 1327.38 bits (3434), Expect = 0.000e+0
Identity = 935/3330 (28.08%), Postives = 1689/3330 (50.72%), Query Frame = 3
Query: 3453 MWSQFEEYQTGLQNLAKEDWLSFRSRYYLFE-EFLTQWFEKLRNAEITTMTI-RLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIREL-ELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIFGKNA-----LPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHIITMKSLDGEVVELRNQVLITSE--VENWLGNLNNEMKTTLSDQLSYALQDLR-MSNQSN-----YGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKELVKKLNIYTNAKMSLSADSTFI----VHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCV----IQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQIQIIQDGI------KNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANL----LEMHKSKMKTQGNDTIEN-VQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQH-------KKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKI-GQTVKFYVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQV---VKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKK-------QDEHD------------------------QHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVG--TVYNGLSNL-----KAIKNKAHFS----------------------VCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNK-QNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKSVQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESER-LILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYD-SNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPKHPIWSQNSKVKLLANTMIEVYSQLKSKFTVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGIL-------FNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDRGLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG----HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAK-------PKTQLTGSDNLNSYFLDLHDTCP------------VEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIEPQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWM----EKTGLEKFDMRK--FLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEVDGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRAL-NTSEIST--DSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHC----CRPDLFKPQEWELF----TGTFISDKSDRNITVPKWIDADRTVAISNLA----------------------------SAMPELWSVLNIKDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVL--ELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTK--------VIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEKELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANALFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSN--------RNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVN------GSGNFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXV---ILQLRILQRFSVHGTKFDKD--------------------------------------IWSRELNPVLNRWKILNQGLNIIKASLPDSLKRS--STDSPVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGP--------EEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDEL 12665
            +W++ +     ++++ +  WLS + R    + E LT   ++L N+     +   ++  + MY  +   +  ++ E + + HW  + R LN+    +L  L L  + D   +++++ E I+E+   AQGE  + E +R++ E+W    V +L  Y   Q+ S  +IK W D+ ++V ++   + S+K SPY++ F+++A  WE++L  ++        +QR+W+YL+ IF  +A     LP E  RF+ V  +F  +M  V ++  V  + +++ ++  L  + D L + QK+L EYLE +RS FPRFYF+GD+DLLEI+G S + + ++ H KK+F G++ +  ++D + I+ M S +GE +   + V I     + +WL  +  EM+ +L+  L+ A++++     +SN     + +  DKY +QI+ L+  I ++   E  L     ++L+  +        ++ +++ AD+       V   KL+ LI++ VH  D++  L +    S   ++W+ Q+RFY   K    +    I + +A+F+Y +EY G   +LV TPLTD+CYLT+TQ +   LGG+P+GPAGTGKTESVK+LG+  GR VLVFNCDE  D ++MGRIF+GL + G+WGCFDEFNRLEE +LSAVS QIQ IQ+ +      K     + LL ++V+V+ + AIFIT+NP   GY GR  LPDNLK+LFR +AM++PD  LIA+V+L S GF+ A+ L  K+V  F L  E L+PQ HYD+GLRALK+VL  A N+    ++  K K+  +G +  E  + +   E ++++Q++    + KL   D     SL+ DVFP ++ ++ E   L   + +V + + +V     +       +K+L++Y+      G+++VGPSGSGK+   ++L  AL  I G     ++++PK+I +  L G++D +TREW+DG+ T+  R++   V+     + WI+ DGD+DPEW+E+LNSVLDDN+LLT+P+GER+   PNV  +FE  DL  A+ AT+SR GM++ S E      ++T +L +       + E D                        Q  +S+ L  FF +    IAK  +++ +  ++   T    L++L     ++I+N   ++                        ++  + G+     RE  + ++  ++    P +   +N++++  N  Q   V +S +  +       ++   ++ P   T D  R+      WL     +P +L GP G GK++ L    + L  ++V  L+ S+ TTP  +L+  +Q C    +  G V  P++  + LI +  +INLP +DK+GT ++ISFL+Q++ + GFY  +++++V  + +Q V + N  +  GR  LS RF   V +  + YP +  L  IY+ + + +L R++P     S       L N M+E + + + +FT D   HY+++P ++T+WV  +     P+ S +    L+ I ++E++R+FQDRLV  D R   D  +       F  I+ E +++       + +  W S              K    +T E L+D +   L  +  E  D+ ++LF +V D+V ++DRV  +P G +LL G SG G+ T S  VS ++ + +   K+H  Y  + F  DL++ L+ +G +GE I  ++++   ++  +LE +N+LLA+GEVPGL+  +EL  ++   K+ A   G     +  L  +F  +I   LH++  M+ S         ++PA F  C + W   WS ++  ++     N++  E       ++         P+  +     +N+    +H T                  T RHY++ I  Y+++  +K+ ++E +Q H+  G+KKI +  + V  ++    ++ + L      A+  LK++    Q A ++K   + L  +  ++   + +++  +  EL  +EP V +A+ AV +I+  D+ EI+A++ PP+ ++  +E + L++G   T W S+   + K      I  F+   ++  +R  +++      D ++ +   +AS A  P+  WV A + Y+  L+++ PL NE  +L    E   KK ++ E  ++ ++K++A Y +++    + A  ++ +L +    +  +  L+  L +E  RW+       A+++ +    LL++A + Y     +  R      W     E   L + D+ +  +L+   ++L W+   L +D+L +ENA+++ +    P +IDPS  AT +L N +K++K+   +  D +F   LE ++RFG  L++Q+V+  +P+L P+L  ++   G R ++ LGD+ ID +P F +FL+TR+P  +  PD  + V+ VNFT T++ L+ Q L   ++  +P +++++++LL+ + + +++L  +E+ LLQ L  A GN+L N  ++  L   K  +  +++ +EE+  +   ++     ++PLA+  S+++F +  +++I+ +Y++SL   L +F   L N  E++    ++ R   +   L ++ Y  + R +   D++ FA  ++        P  F   E++ F      T  S  S++   +   +  D+  ++  L                             S +PELW   N  +D+   + AK                     +LIIQA+RPDRL ++  +F   VL          +++L  I E E  +  PIL+    G DPS  +++L+++         IGS      A G  QA+  +N     ++ G W+ LKN+HL TSWL  LEK+++SL+ H +FRL++T E        LL++   + +E PPG+K NLLR+  + +   +SK     R+   F LAW +AI+QER  ++P G++K YEF  +D +   + +D  +  +           I W  +  L  + I+GG++DN FD R+L+S++   F +   +         +    I  P +    D L  +++L D  +PS+  LP++ ++     +++++   +L L      +    K +K                                        W R+L      W      L I+  S+   L+R+  +   P+    + E  +   L+  V   L  +++V KG++  T   +++   L  G  P +W++    P        ++  D ++ L+  +    K   ++    L S  + LG LF  + ++ A RQ  A+  K +++EL
Sbjct:  763 VWNELKSIWEKIRDMKETPWLSVQPRKLRQDIENLTAQLKELPNSFKQYASFEHVRTLLKMYMKVNASIVELKSEAIKERHWRMLMRKLNV--SWSLNELQLGKVWDI--DLVKNEEIIREVLAIAQGEKALEEYLRQITEVW-KNYVLELTNY---QSKS-KIIKGWDDLFNKVKEHINNVTSMKASPYFKQFEEEATAWEDRLNKINALFDVWIDVQRRWIYLDGIFAGSADIKVLLPVESQRFQSVSTEFLGLMKKVQKSPLVTDVLNIANVQRQLERLADLLGKIQKSLGEYLERQRSSFPRFYFVGDEDLLEIIGNSKDLKKLQKHFKKMFAGVHSIILSEDEKVILGMMSKEGEELRFISPVSIIEHPRINDWLTAMEKEMRVSLAKYLNVAVKEISGWRTESNIDKDKFMVWLDKYQAQIVVLAAQITWSEAVEASLASG--VSLESTMT-----VVHSTLNMLADTVLYEQPPVRRRKLEHLIIEYVHQRDVLRALHNDGVSSNKNFDWMSQMRFYFDPKQTDPLHQLSIHVANAKFHYGFEYLGVCDRLVQTPLTDRCYLTMTQALEARLGGSPFGPAGTGKTESVKSLGNQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQGIQEALRELMVSKKDSINVELLGKQVHVNPDMAIFITMNP---GYAGRSNLPDNLKKLFRSLAMTQPDRQLIAQVMLYSQGFRTAEVLAGKVVPFFKLCDEQLSPQSHYDFGLRALKSVLVSAGNVKRDRIKQEKEKIVARGEEINETAIAEQLPEQEILIQSVMETMVPKLIADDIPLLYSLLTDVFPGVEYRQAEMKRLREELRKVSENKFLVYSDEPNTAGYLWVEKVLQLYQITTIHHGLMMVGPSGSGKTMACRVLLQALENIDGIEGVAHIIDPKSISKDSLYGYMDPNTREWTDGLFTHILRRIIDSVRGESNKRQWIVFDGDVDPEWVENLNSVLDDNKLLTLPNGERLAIPPNVRIMFEVQDLKYATLATVSRCGMVWFSEEVLTTGMILTHFLNELKKVQVMEGEEDFSVNQGDTGADADSKISSSPIIQLQTQVSSILAPFFTED-GLIAKCLDYSTTLEHIMDFTRLRALTSLFSMIKQSIRNMIEYNQSHSDFPLNNEQIENYVAKSLISSVVWSMSGDSKLKVREQLSQYIKNISTVDLPTVGGIKNIIDFEVN-IQGTWVAWSNKVPQIEVETHKITATDVVVP---TMDTVRHEALLYTWLAE--HRPVLLCGPPGSGKTMTLFSALRCLPDMEVVGLNFSSATTPELMLKTFDQYCEYRKTPNGIVLAPQQLNKWLIFFCDEINLPDMDKYGTQRVISFLRQMVEHHGFYRITDMQWVSFERIQFVGACNPPTDPGRKPLSHRFLRHVPVVYVDYPGETSLKQIYSTFNRAML-RMLP-----SLRGYADTLTNAMVEFFLKTQERFTHDMQPHYIYSPREMTRWVRGIHEALKPLESLSVE-GLVRIWAHEALRLFQDRLVEEDERHWTDDNINEVALKHFPNINKEEALK-----RPILYSNWLS--------------KDYSAVTQEELRDYVKARLKVFYEEELDVPLVLFNQVLDHVLRIDRVFRQPQGHLLLIGVSGAGKTTLSRFVSWINGLSVFQVKVHNKYTAEDFDEDLRNVLRRSGCKGEKITFIMDESNVMDSSFLERMNTLLANGEVPGLFEGDELTTLMTQCKEGAIREGLMIDSQEELYKWFTQQICRNLHVVFTMNPSADGLKDKASTSPALFNRCVLNWFGDWSLEAYFQVGKEFTNRLDLERTDYKVPDTLPCIAEGLLPQNPIYRDVVVNALVF-VHQTMHQANVRVQKRGGRTAAITPRHYLDLIAHYMKLSAEKRADLEEQQLHLNNGLKKIEQTVDQVEVMQRSLTKKRQELENMNEAANAKLKQMVQDQQEAEQKKTTGQALKEELAKQEQFVNEKQKTVKQELDQVEPTVNEAKQAVQNIRKKDIQEIKAMKNPPNAVKMAVESICLLLGEKTTDWQSILKVIIKDTFVTSILNFNTDDVSDNTRETMKKKYLSNPD-YNFEKVNKASNACGPMVKWVLAQISYADILKRVEPLRNELTELSDAAEQNRKKSQETEDLIAQLEKSIAKYTEEYATLISQAQTIKSDLASVESKVGRSVALLGSLSSERTRWDSGSETFKAQMATINGDCLLSSAFMAYGGYFDQHMRTSLFNTWCHHLSEADILFRSDLARVEYLSNPDDRLRWQANSLPADDLCVENAIILRRYNRYPLIIDPSGQATTFLLNEYKEKKITKTSFLDDSFRKTLESALRFGTPLLVQDVESYDPILNPVLNREVRRTGGRTLITLGDQDIDLSPTFTIFLSTRDPSVEFAPDICSRVTFVNFTVTRSSLQNQCLNAVLKIERPDIDQKRSDLLKAQGEFQLKLRHLEKDLLQSLNEAQGNLLENDKIIARLETLKREAADVAKKVEETDVVMQEVESVSTEYVPLAQSCSNIYFTLEAMNQIHFLYQYSLQLMLDIFSSVLINNPELANVKAASDRLKIITKNLFQVTYNRLARGMLHEDQITFATILARIFLKGSTPIGFLENEFQHFLRSQEATITSSDSNKQDNLGLTLHQDQIDSVKRLKKLKVFAKIEEKVKSTKDIKNWTLTVTPESNVPELWVDDNNYNDEKLSKIAKG-----------------MYNLLIIQAIRPDRLLASTQKFIASVLGDTFTESVRGTLDLASIVEVEVTACVPILLCAVQGYDPSGRVEDLASEQGKQLTGIAIGS------AEGFSQAEKAIN---SAAKTGKWVMLKNVHLATSWLVSLEKKIHSLQAHPNFRLFLTMEITPKLPVNLLRAGRVLVFEPPPGIKANLLRTLSSINNQRMSKEPV-ERSRLYFLLAWLNAIVQERLRYVPLGYSKKYEFGESDFKCALDTIDTWVDGAAMGRTNLPPEKIPWVALQTLLGSCIYGGKIDNAFDQRLLNSFLGYLFTEKCFDHNFALVSDADDGSNIAFPESTKHTDILQWVHKLPDLQTPSWLGLPNSAEKVLLTNLAARLKKDVLTLVATDEAATEDAKQEKGQSLIGNILKMQQSLEDDEELVVGQSKTKRTIEVGDGRPAWMRQLYQSTQTW------LQILPKSVT-PLQRTIENIKDPMYRCFEREVNSGCNLLASVRKDLEDVAEVCKGAKKPTNHHRSMMADLAKGIIPKMWIRYAIPPGLTVIQWIQDFADRIKQLLHISDTAAKSGVIA----LRSIQVWLGGLFMAEAYITATRQSVAQNNKWALEEL 4000          
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Planmine SMEST
Match: SMESG000033128.1 (SMESG000033128.1)

HSP 1 Score: 1205.66 bits (3118), Expect = 0.000e+0
Identity = 956/3588 (26.64%), Postives = 1738/3588 (48.44%), Query Frame = 3
Query: 2628 NKFKEWIILGSLDLEEFVDQHCLDLTDYEKNFKA-------MKTKGKEAEKLPNEIKIDCITVNCAPIKMSVDTLIQNIFDALLNSLRKNIKGTIDSVDAYLTNSIKILSKRPQAIDEIAEATLNHAEFNKDRSRIRSQIDKSEKMNNLLRTVAGGGIDTV----SQLQQKWDKFXXXXXXXXXXXXXXIEVMKTNILSRQKQFQQDIMKFNDRWQGLKPGRDILDSGSTQACLDAVQXXXXXXXXXXXXXXXXTNLEKDCEHFQMEPEEFTLLEEIHKDIDQNQLMWSQFEEYQTGLQNLAKEDWLSFRSRYYLFEEFLTQWFEKLRNAEITTMTI--------------RLQKEIDMYKDIIPILKWIRGEGLSQDHWLEMFRLLNMPRGLTLEALTLRHILDAASEIIRHAEAIKELNQKAQGEVTIREAIRELELWGAGAVFQLVEYIDSQNNSISLIKEWRDIISQVGDNQCLLQSLKDSPYYRFFQDKAAVWENKLADLDEYLQNLNQIQRKWVYLEPIF----GKNALPKEKSRFRRVDEDFRSIMSDVNRNNRVLSLCSMSGMKNLLSTMIDQLQRCQKALNEYLEEKRSLFPRFYFIGDDDLLEILGQSTNPQVIKSHLKKLFQGIYDVDFNKDIQHII---TMKSLDGEVVELRNQVLITSEVENWLGNLNNEMKTTLSDQLSYALQDLRMS---NQSNYGINADKYPSQILCLSEMIHFTARCEELLNENNIITLKKEL--VKKLNIYTNAKMSLSADSTFI-VHDLKLKSLILDTVHNIDIIDQLLDQNCQSVTEWEWLKQLRFYQKSKDQGCVIQMVDAEFNYTYEYQGNAPKLVHTPLTDKCYLTLTQGMHMGLGGNPYGPAGTGKTESVKALGSLFGRQVLVFNCDEGIDVKSMGRIFIGLVKCGSWGCFDEFNRLEEAVLSAVSMQI-QIIQDGIKNKVQEITLLERRVNVDCNSAIFITLNPAGKGYGGRQKLPDNLKQLFRPVAMSRPDNDLIAEVILNSDGFKNAKELGRKLVAIFNLSRELLTPQQHYDWGLRALKTVLKGAANLLEMHKSKMKTQGNDTIENVQDSDFETKLIVQALRVNTLSKLTYADGICFESLIKDVFPNIDIKEIEYDNLASAIEEVIKEQNMVSLKGQHKKMLEVYEQLRQRMGVVIVGPSGSGKSTIWKLLRLALNKIGQTVKF-------YVMNPKAIPRTQLLGHIDIDTREWSDGVLTYSARQVVKEPQEIQSWIICDGDIDPEWIESLNSVLDDNRLLTMPSGERIQFGPNVNFIFETHDLSCASPATISRMGMIFLSSEATDVKSLVTSWLKKQ-DEHDQHLLSTYLDDFFYKSLDWIAKRNEFTISTSNVGTVYNG---LSNLKAIKNKAH--------------FSVCLIKGLGGNLNENSRETFALWVYELTDEKTPEMNKQNVLNYYFNEKQNRLVTYSYECEEELSIDQLMSDKKILTPLILTADIQRNLDYFKIWLNSDTQQPFILSGPEGCGKSLMLNHCFQKLKS--VQVTTLHCSAQTTPVHVLQKLNQACIIINSNTGRVYRPKESERLILYLKDINLPKLDKWGTSQLISFLQQVITYKGFYDSNLEFVGLDGVQIVCXXXXXXXXXXXXXXTRFTSIVRLCSISYPSKDQLNDIYTAYLKPVLKRLIPK-HPIWSQNSKVKLLANTMIEVYSQLKSKF-TVDDYSHYLFTPSDLTQWVLSLLRYDLPVTSDNTAVSLLEIVSYESMRIFQDRLVSSDARKRADGILFNTIHSEWSVEVQDSLNDVWFVTWGSREXXXXXXXXXXXXKSLGKLTSEYLKDTIDR-GLLQYSRECRDLDIMLFKEVYDNVAKLDRVLTKPGGSVLLAGKSGVGRRTTSLLVSHMHNIKLISPKMHRGYELKQFKNDLKSTLQTAGVEGEHIVLLLEDHQFLEPQYLELINSLLASGEVPGLYTTEELEPILMSLKDLANESG---HRGSLANYFADRIKHYLHIILIMDCSNLNFVINCQSNPAFFKYCSVQWLEQWSRDSMLKIPYMLINKIPREEGSQLTQNSAKPKTQLTGS------DNLNSYFLDLHDTCPVEFSTSRHYINFIKMYIRIYLKKKNEIETRQNHIQVGIKKISEAKEMVAELKSKAAEQSKLLTEKQLEADKALKKITSVMQGATERKGEMEKLTVKTGEENVILAKRKAAIDDELALIE-----PQVKQARDAVSDIKSSDLSEIRALRAPPDVIRDILEGVLLIMGTMDTSWVSMRNFLGKRGIQEEIQTFDARRITRESRIQVEELLTRCKDSFDPKNAKRASIAAAPLAAWVKANVKYSYALEKIAPLENEQNQLKRNLENAEKKMKDLEKGVSDVDKAVAGYRKDFEKFTADAAKLEFELKNANETISAAEDLVFKLENEFERWNKQIVELNAELSALTIKSLLAAASVIYMPSSPEDQRKEKMQLWMEKTGLEK------FDMRKFLTTEREQLEWKKEGLSSDELSMENALVILQGILIPFLIDPSSNATAWLKNHFKDRKLEIVNQQDSNFSTVLELSVRFGKTLIIQEV-DGLEPVLYPLLRGDLISQGPRQVVQLGDKLIDYNPDFKLFLATRNPQPQLPPDALAIVSTVNFTTTKAGLKGQLLALTMQHVKPKLEERKTNXXXXXXXXXXXXXXXXXXXXQELANATGNIXXXXXXXXXXXXXXESSITISQSLEESVKLQMSLDEERDAFLPLAEHGSSLFFVISDLSKINNMYRFSLTSFLRLFQRALNTSEISTDSTMRNTSLIACLEKLVYEYVCRSIFKSDRLMFALHMSHCCR----PDLFKPQEWELF--TGTFISDKSDRNITVPKWIDA---DRTVAISNLASAMPELWSVLNI-KDDDLWHQFAKSSECEREIPQSLKNKLSLFQKILIIQALRPDRLQSALSQFCCDVLELKHLSPSSMNLHQIYESETISNEPILIIISPGADPSQDLQELSTKVIGSERYNQVAMGQGQADITLNLLHKCSQNGDWLCLKNLHLVTSWLPVLEK---ELNSLKPHKDFRLWVTAEPHIGFSTILLQSSLKITYEAPPGVKNNLLRSYDNWSEDFISKTGSGTRANA-LFSLAWFHAIIQERRNFIPQGWTKFYEFSIADLRAGTEILDQIIKKSNRNIQWKFIHGLFENAIFGGRVDNPFDMRVLSSYIKRYFNDSVVNGSG---NFYGKIQLPSAASKRDYLAIINQLSDYNSPSFFSLPDNIDXXXXXXXXXXVILQLRIL--QRFSVHG-TKFDKDIWSRELNPVLNRWKILNQGLNIIKASLPDSL------KRSSTDS---PVVAFLQLERYNSIKLVKFVHSSLISLSKVLKGSELLTKEVQNLSECLLTGQTPNVWLQQWEGPEEPFDYMRILILKAKAVEKWAELSEKDELLSTILDLGELFHPDTFLNALRQLTARTIKISMDELKF---VCRWGGSNVSA--KYSVKIGNLHIEGCLFD--GTMITECNRDSNSIVLLPPVSVGWVD---KNQPNSYSEDDMISLPIYYDILRDKI------VTKIDIPCQSGQQDKWIQSGVALFL 12986
            ++F+E   +  L+ EEF+ Q+C DL  +  +  A       +  K  +AE +   + +  + ++ + +K S+    ++    L N L      ++  +  Y+ N  + +SK PQ ++E+ E+     + N++R+ I+ +    ++   +L        D +      L+++W +F   +   + M+++  +  KT +L +   F++ +      +Q   P        ++    +A+ KI + K  LE L I +  + +    F++E      +  + KD+D  + +W    E++T        +W  ++S  ++  E  T   E L N+     T                 +  +D ++  +P++  +R E +   HW ++   +           TL  I+D   +  +HAE I E++  A  E+ I  A++ +E        +++ + D + N   L+    D+   + DN+  L ++K S + + F+ +   WE  L+ + E ++ L  +QR+W+YLE IF     +  LPKE + F ++++ +R IM+++N+     +     G+    + M   L+  QK+L+ YLE KR++FPRFYFI +DDLLEILGQS NP  +  HLKK F  I  +   K +       +M S DGE V  + ++ +   VE WL +L   M+ TL D     L+D R++     S       ++  Q+   S  I +TA   + L        KK L  +KK       K S +  S    +  LK+ SL++  VH  DII++L    C  +  +EWL QLRFY + +   CVI+  +  F Y YEY GN+ +LV TPLTD+CY+TLT  +H+  GG+P GPAGTGKTE+VK LG   G  V+V NC EG+D KSMGR+F GL + G+WGCFDEFNR+   VLS V+ QI  I+     N   +     R +++  +  IFIT+NP   GY GR +LPDNLK +FRP+AM  PD+ +IAE+ L ++GF   K L +K+  +++LS + L+ Q HYD+GLRAL +VL+ A           K + N  +        + ++++ ++    L+KLT  D   F+ ++ D+FP ID   ++Y N+  AIE+      +        K++++YE    R  V+IVG + SGKST W+LL+ AL ++ +  +        + +NPK++   +L G  D++T EW+DGVL+   R+   + +  + WII DG +D  WIES+NSV+DDN++LT+ +GERI     V+ +FE  +LS ASPAT+SR GM++        +  V SWLK++ D      LS   D +  K  ++I       I TS   +V +       L  ++N                 F  C+I  +  +++E+ R+    ++ E+ +   P  NK  +  Y+ + K      +  + +     +  +   KI+ P + T  ++ N     +  N     P +L GP G GK+ +  +   +L +    + T++ SAQT+  +V Q + +A +     T   + P   +R++ ++ D N+P  D +G+   +  ++Q I Y  +YD   +         +         GR  +S R  S   L ++++P++  L  I+ + +   L+    +  PI        ++    IE+Y+ +  KF       HYLF   D+++    +LR +        +++ L I  +E+ R+F DR+V    +     +L   + S +     +   +     +G               + L K   E L +  +  G++Q       +D++LF++  ++++K+ RV+ +P G++LL G  G GR++ + L ++M        ++ + Y  ++F++DLK     AGV+ +  + L  D Q ++  +LE IN++L+SGE+P LY  +E++ +   L D A   G      S+  Y  DR++  +H++L M      F    +  PAF    ++ W  +W  D++L++    +  +    G +  ++  KP      S       +++   LD  +     + T  +Y+  +  Y  + ++K+ ++    N ++ G+ KI E +  V  +  +  E  K L   Q E D  L  +  V Q   +R+ + +  +V   +E + + + K     ELAL +     P ++ A  A+  +   D++EI++   PP +++ ++E V+++ G  + +W   +  LG++   +++  FD   I+  +  ++   +   +D F P    + S+AA  L  WV A   Y      + P        +  L   + ++   +  +  V + +   ++++ +      +L  + ++  + +  A  LV  L  E +RW K + +L  ++  L    L+A+A + YM     D R+  +  W E    E+      F   +FL+   +  +W  +GL  D  S+EN +++ +G   P ++DP   A  W+K   + +KL++++    +F  VLE++++FG+ +++Q V + L+P L P+L   ++  G   V++LGDK I+YN DF+ ++ T+ P P   P+       VNF   + GL+ QLL + ++  +P+LEE+K NL+      K +L+++E+ +L+ L  A G++L+++ L+ +L  +K +S  +++ L+ + K + ++D  R  +   A+  S LFFV++DL KI+ MY+F+L +++ LF  ++N S  S     R ++L       VY Y CR +F+  +L+F+  +  C +           E+  F   G  +  ++  +   P W+     D    +  LA+    + S     +D +LW  +   S     +P    N  + FQ++LI+++LRPDR+    + F  + L  K + P  +++ Q+ +  + +   ++ ++SPG DP+  L +L+  +  +++++ +++GQGQA I   ++++ ++ G+W+ L N HL  SW+P L+K   EL   +P   FRLW+++ PH  F   +LQS +K+T E P G+K N+ R Y    ED  S      +    LFSL +FH+++ ERR F+  GW   YEF+ +D      +L   + +      W  +  L  +  +GG V +  D R+L++YI  YF +  +       +      +P   S   Y   I  L + + P  F    N D +SQ   +  +   L  L  Q  SV G +K D               K+L    NI K  LP+++      K  STD     VV   +++RYN    +  +   L  L K ++G  +++ +++++ + +   + P +W + +   +    + R L+ + +  +KWA  +   +    +  +     P  FL A+ Q +AR   IS+D L +   V     +N+++  K  V +  L+++G  +D   +++ E +        +P +    ++   K+Q NSY        P YY   R  I      +  +++       + W + G AL +
Sbjct: 1045 DQFRE---IWELNKEEFISQYC-DLNPHVYSIDADISRYTEVTNKALDAEAM---VTVKFLQLDFSMLKNSIAAHCRDWQQKLTNLLLAMATKSLMYLHNYMKNMSEKVSKIPQNLEELGESMRLLDKLNEERNHIQEKFHPLDEHFIILDKYEVQYSDDIRLKKQNLEKEWQEFLQALVEAEQMIKKSKDKFKTGLLVQSDDFKKQVSALIMDFQTNGP------FAASIPPQEALAKIANFKSSLESLKIQEQEIRRGLNLFKIEQPPSKEIAALEKDLDNIENIWKLALEWET--------NWTQWKSGRFI--ELKTTEMENLANSSFRKATKFSRDLKDKNWEIIEYTRNRVDQFRRTMPLITDLRNEAMRDRHWFQIKNEIRKQFDEESSDFTLEKIIDLNFD--QHAEMINEVSGAATKELAIENALKGMEKLWESVELEIIPHKDKEKNHF-LLSGIDDLYQTLDDNRNTLSNMKTSRFVKPFEHEVDKWERDLSHIQETVEMLLTVQRQWLYLENIFLGEDIRKQLPKESADFDKINKQWRVIMTELNQIRNARACGKKEGLLETFNAMNTCLEDIQKSLDMYLETKRNIFPRFYFISNDDLLEILGQSKNPDKVLPHLKKCFDNINSLKIEKLMSQGFEASSMFSSDGEEVLFKQKLRLEGPVEAWLCDLEKCMRVTLRD----LLRDCRIALKKAASKRDKWIKEWSGQLCITSSQIQWTADVTKALQNVAQRNDKKPLRIMKKKQKLVLEKFSEAIRSNLTKIQRLKINSLVVIEVHQRDIIEKLYKSGCSDINAFEWLSQLRFYWEKEIDDCVIKQTNTSFQYGYEYLGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKSLGAYVIVVNCSEGLDYKSMGRMFSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALASNAPPKFMFQGRMIDLVPSVGIFITMNP---GYAGRTELPDNLKSMFRPIAMVTPDSAMIAEITLFAEGFSGCKVLAKKVFTLYSLSIQQLSKQDHYDFGLRALVSVLRYAGR---------KKRANPLMP-------DEEILLLSMNDMNLAKLTSVDLPLFKGIVSDLFPGIDSPVMDYTNMKEAIEKCCDNFQLQPTNFTITKVVQLYETKTSRHSVMIVGKTLSGKSTTWRLLQSALAELSKERESQFEKALEFPLNPKSVSLGELYGEFDLNTNEWTDGVLSSVMRKTCADTRPDEKWIIFDGPVDTLWIESMNSVMDDNKILTLINGERISMPEQVSLLFEVENLSVASPATVSRCGMVYNDVNDLGWRPYVESWLKRKVDSVLVEELSRMFDKYIEKIQNFIKMNCIELIRTSPTNSVISLCKLFDCLATVENGCDPSDTDNYSRVIELWFQFCMIWSICCSVDEDGRKKIDNYIREM-EGTFP--NKDTIYEYFVDNKNKSWGHWDEKLKAGWKYNASVPFYKIIVPTVDT--VRYNYLVQNLVCNF---HPVMLVGPVGTGKTSVAVNTLNQLNNDIWTILTINMSAQTSSNNV-QDIIEARV--EKRTKDTFVPVGGKRMLTFMDDFNMPAKDTFGSQPPLELIRQWIDYGFWYDRLKQTQKRIKDMYLFVAMGPPGGGRMMISNRLQSRFNLINMTFPTESNLKRIFGSMINQKLQDFEEELKPIGD------IITQATIEMYNGVVIKFLPTPTKIHYLFNLRDISKIFQGMLRTNKDYHDTKNSITRLWI--HENFRVFADRMVIDKDKVAFVELLSEKLGSLFDQTFHNICPNKQSPIFGDYMSSTDTYEDITDIEKLKKFMKEMLDEYNNTPGVVQ-------MDLVLFRDAIEHISKIIRVIRQPRGNMLLVGIGGSGRQSLTRLAAYMCEYTSFQIEVSKHYRKQEFRDDLKRLYWQAGVDNKPTLFLFNDTQVVDESFLEDINNILSSGEIPNLYKQDEIDDLRNQLSDEAKRDGIEDTTQSIFTYLIDRVRGNMHVVLCMSPVGEPFRNRIRMFPAFVNCTTIDWFSEWPLDALLEVAERYLKDLQLFIGGE--EDRMKPHLATIFSLMHRSVSDMSQRMLD--EMKRHNYVTPTNYLELVSGYKILLVEKRKQLSDSANKLKNGLGKIDETRAKVEVMSIELEEARKKLAIFQKECDDYL--VVIVQQ---KREADDQAKSVMQTQERIKVDEAKCLKMQELALADLAQAMPALEAAMQALESLNKKDITEIKSYGKPPALVQKVMEAVMILRGA-EPTWAEAKKHLGEQDFIKQLINFDKDNISDRTLKKIGTYV--AQDDFQPDMVGKVSLAAKSLCMWVGAMEVYGRVYRVVEPKRQRLQAAESVLREKQAQLAAAQAKLDAVMEEMKRLQQEYNEKMEQKEELRKKAEHTEKMLDRASKLVSGLAGEKDRWEKTVADLENQIGLLPGDCLIASAFLSYMGPFLSDYREALVIKWTEAIKKEQIPANPSFSFIEFLSNPTQIRDWNIQGLPRDGFSVENGVIVTRGSRWPLMVDPQCQAQKWIK-QMEGKKLKVIDLHMPDFIRVLEIAIQFGQPVLLQNVQEKLDPSLDPILNKSIVKIGGATVMKLGDKEIEYNYDFRFYITTKLPNPHYTPEISTKTCIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDNLVMSIAAGKRKLAELEDEILRLLNEAQGSLLDDEQLVNTLQTSKITSTEVTEQLQIAEKTETAIDIARQGYASCAQRASILFFVLNDLGKIDPMYQFALDAYIDLFNMSINKSTKSPKRDERISNLNDYHTYAVYCYACRGLFEKHKLLFSFQI--CAKILQTSGKMNMDEYNFFLKGGVVLDRENQMDNPCPGWLSDQAWDNISELDKLANFHGLITSFEQYPRDWNLW--YTSDSPETSSLPGEWDNATNEFQRMLIVRSLRPDRVSFCATSFIINNLGNKFVEPPVLDMKQVVDDSS-AKTCLIFVLSPGVDPTSGLLQLAESLGMAKKFHALSLGQGQAPIATRMINEGTKEGNWVFLANCHLSLSWMPQLDKIVEELQIEEPDPKFRLWLSSSPHPEFPISILQSGIKMTTEPPKGLKANMKRLYHLIKEDQFSACRKPEKYKKLLFSLCFFHSVLLERRKFLTLGWNIPYEFNDSDFEVSENLLSNYLDQY-ETTPWDALKYLIADINYGGHVTDDLDRRLLNTYIADYFREEAIKEPFFKLSIMSSYYIPRDGSLNSYREFITMLPNIDHPEAFGQHPNADIASQIQETRLLFDTLLSLKPQVVSVGGDSKED---------------KVLEISGNITK-QLPENIDYEGTAKILSTDPCPLNVVLLQEIQRYNF--QLDLIRKQLSDLEKGIQGLVVMSSDLEDIFDSIYDTKVPRLWSKAYPSMKPLASWTRDLVSRIEMFQKWAITAHAPK----VFWVSAFTFPTGFLTAVIQTSARLNNISVDTLNWDFTVLTISEANIASAPKDGVYVKGLYLQGAGWDMKNSILIEAS-PMELTCAMPVIHFKPIENKKKSQKNSY------ICPCYYYPNRAGISDRPSYIESVELKTGEKAPEHWTKRGTALLM 4509          
The following BLAST results are available for this feature:
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNC2H10.000e+053.95dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Sy... [more]
DYNC2H10.000e+053.88dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Sy... [more]
DNAH20.000e+027.19dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH20.000e+027.19dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
DNAH60.000e+027.43dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-30.000e+039.68Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-11.201e-1125.67Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-11.201e-1125.67Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-10.000e+025.67Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-32.322e-1620.14Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btv0.000e+031.68gene:FBgn0023096 transcript:FBtr0273418[more]
Dhc64C8.355e-1328.84gene:FBgn0261797 transcript:FBtr0332745[more]
Dhc64C8.284e-1328.84gene:FBgn0261797 transcript:FBtr0273370[more]
Dhc64C7.878e-1328.80gene:FBgn0261797 transcript:FBtr0073359[more]
Dhc64C7.620e-1328.78gene:FBgn0261797 transcript:FBtr0332747[more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNC2H10.000e+051.56dynein cytoplasmic 2 heavy chain 1 [Source:NCBI ge... [more]
DYNC2H10.000e+051.49dynein cytoplasmic 2 heavy chain 1 [Source:NCBI ge... [more]
dnah20.000e+025.01dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah20.000e+027.13dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+027.64si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNC2H10.000e+053.46dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI ... [more]
DYNC2H10.000e+051.36dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI ... [more]
DYNC2H10.000e+055.07dynein, cytoplasmic 2, heavy chain 1 [Source:NCBI ... [more]
DNAH20.000e+027.68dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
DNAH100.000e+028.01dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dync2h10.000e+053.84dynein cytoplasmic 2 heavy chain 1 [Source:MGI Sym... [more]
Dync2h10.000e+053.84dynein cytoplasmic 2 heavy chain 1 [Source:MGI Sym... [more]
Dync2h10.000e+053.78dynein cytoplasmic 2 heavy chain 1 [Source:MGI Sym... [more]
Dnah20.000e+027.81dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah20.000e+027.77dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27802|DYHC2_TRIGR0.000e+054.46Cytoplasmic dynein 2 heavy chain 1 OS=Tripneustes ... [more]
sp|Q8NCM8|DYHC2_HUMAN0.000e+053.95Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens... [more]
sp|Q9JJ79|DYHC2_RAT0.000e+053.78Cytoplasmic dynein 2 heavy chain 1 OS=Rattus norve... [more]
sp|Q45VK7|DYHC2_MOUSE0.000e+053.84Cytoplasmic dynein 2 heavy chain 1 OS=Mus musculus... [more]
sp|Q9SMH5|DYHC2_CHLRE0.000e+039.10Cytoplasmic dynein 2 heavy chain 1 OS=Chlamydomona... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157572370.000e+058.09tr|A0A1I8GFW0|A0A1I8GFW0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|239111610.000e+057.16tr|K1PYA0|K1PYA0_CRAGI Cytoplasmic dynein 2 heavy ... [more]
gnl|BL_ORD_ID|157439660.000e+056.47tr|R7UM87|R7UM87_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|238530260.000e+056.55tr|V4AES5|V4AES5_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|203038970.000e+056.79tr|A0A1S3JIZ4|A0A1S3JIZ4_LINUN cytoplasmic dynein ... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNC2H10.000e+051.83dynein cytoplasmic 2 heavy chain 1 [Source:HGNC Sy... [more]
dnah20.000e+027.24dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.10.000e+027.95dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.20.000e+027.28pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah120.000e+027.40dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000600.10.000e+049.55pep scaffold:Pmarinus_7.0:GL477903:500:65413:-1 ge... [more]
DNAH60.000e+026.32dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000006497.10.000e+025.43pep scaffold:Pmarinus_7.0:GL476875:373:73185:-1 ge... [more]
ENSPMAT00000001140.10.000e+027.31pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000001370.10.000e+027.86pep scaffold:Pmarinus_7.0:GL479430:457:33677:-1 ge... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN12.162e-1526.86Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Cytoplasmic dynein 2 heavy chain 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5