Histone acetyltransferase

Overview
NameHistone acetyltransferase
Smed IDSMED30005691
Length (bp)1304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone acetyltransferase (SMED30005691) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30005691) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone acetyltransferase (SMED30005691) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone acetyltransferase (SMED30005691) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005691

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005691h1SMcG0010803 SmedASXL_006348SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30005691h1SMcG0010803 dd_Smed_v4_10027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT8 (lysine acetyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:17933])

HSP 1 Score: 415.616 bits (1067), Expect = 2.410e-142
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT8 (lysine acetyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:17933])

HSP 1 Score: 415.616 bits (1067), Expect = 2.410e-142
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT8 (lysine acetyltransferase 8 [Source:HGNC Symbol;Acc:HGNC:17933])

HSP 1 Score: 400.979 bits (1029), Expect = 1.797e-136
Identity = 201/382 (52.62%), Postives = 272/382 (71.20%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP 1213
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KKP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKP 434          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT7 (lysine acetyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:17016])

HSP 1 Score: 316.235 bits (809), Expect = 3.833e-103
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  184 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 469          
BLAST of Histone acetyltransferase vs. Ensembl Human
Match: KAT7 (lysine acetyltransferase 7 [Source:HGNC Symbol;Acc:HGNC:17016])

HSP 1 Score: 315.079 bits (806), Expect = 4.383e-103
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  154 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 439          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-2 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A131MBB1])

HSP 1 Score: 293.123 bits (749), Expect = 4.982e-94
Identity = 174/438 (39.73%), Postives = 250/438 (57.08%), Query Frame = 2
Query:    5 KSYML*KFVSSVYVY*NMNKNSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVN-----------SKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIED--ISTATCISIDDIKSVLESHNLMKYYHRHGKE---------LQISRKSLIHYLENFNNKKP-IQIDKSCLKWLP 1249
            K YM+ KF+       N  K    ++I+ ++    ++        IE     + +  Y+VHY   DRR DEW+  + I VN           +K  +++     ++        G LTR Q+R + E  H ++ D   +D+ T +LE+EH+  T+VK I  I  G +EI  WY+SP+P D      +Y+CEYCL Y    + F  H   C  +QPPG EIYRK++LSV+E+DG+ +KLYCQ LCLL+KLF+DHKTLY+DV  FMFYVLCE D  G H+VGYFS+E  S +  NLACI+  PPFQ+KGYGK LI FSYEL++ E  IG PEKPLSDLG +SYRSYW + +      +   ++    +S  + I++DDI S L +  + + Y    KE         ++I RK + H +     K P + +D++ ++W P
Sbjct:   38 KRYMVEKFII------NTVKKVVAVIIHIDFRKPPQEVRTNNYKSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVIKVPTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEEYSHLKT-DLNDLDATTARLEREHEERTKVKNIPQITIGAHEILAWYYSPFPPDCENLD-IYMCEYCLLYTPHHERFKQHIDTCKVRQPPGNEIYRKDHLSVYEVDGSGQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESAN--NLACIMVFPPFQKKGYGKLLIQFSYELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKLFHIHQGHTVTATFLSNESGIAVDDIVSTLITMRMCRQY----KEPEFIPGEWYVRIHRKIVDHCVMCGYGKPPRLLLDRTKVRWAP 461          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-2 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A131MBB1])

HSP 1 Score: 293.123 bits (749), Expect = 5.960e-94
Identity = 174/438 (39.73%), Postives = 250/438 (57.08%), Query Frame = 2
Query:    5 KSYML*KFVSSVYVY*NMNKNSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVN-----------SKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIED--ISTATCISIDDIKSVLESHNLMKYYHRHGKE---------LQISRKSLIHYLENFNNKKP-IQIDKSCLKWLP 1249
            K YM+ KF+       N  K    ++I+ ++    ++        IE     + +  Y+VHY   DRR DEW+  + I VN           +K  +++     ++        G LTR Q+R + E  H ++ D   +D+ T +LE+EH+  T+VK I  I  G +EI  WY+SP+P D      +Y+CEYCL Y    + F  H   C  +QPPG EIYRK++LSV+E+DG+ +KLYCQ LCLL+KLF+DHKTLY+DV  FMFYVLCE D  G H+VGYFS+E  S +  NLACI+  PPFQ+KGYGK LI FSYEL++ E  IG PEKPLSDLG +SYRSYW + +      +   ++    +S  + I++DDI S L +  + + Y    KE         ++I RK + H +     K P + +D++ ++W P
Sbjct:   38 KRYMVEKFII------NTVKKVVAVIIHIDFRKPPQEVRTNNYKSIENHEQGAKELMYYVHYEELDRRNDEWITLDKILVNEVVVEPVIKVPTKAPVEDLHKEIVVGPPVIKPSGALTRSQRRTLEEYSHLKT-DLNDLDATTARLEREHEERTKVKNIPQITIGAHEILAWYYSPFPPDCENLD-IYMCEYCLLYTPHHERFKQHIDTCKVRQPPGNEIYRKDHLSVYEVDGSGQKLYCQCLCLLSKLFMDHKTLYFDVDDFMFYVLCETDEHGAHIVGYFSREVESAN--NLACIMVFPPFQKKGYGKLLIQFSYELSRREGYIGMPEKPLSDLGKVSYRSYWWWRLMKLFHIHQGHTVTATFLSNESGIAVDDIVSTLITMRMCRQY----KEPEFIPGEWYVRIHRKIVDHCVMCGYGKPPRLLLDRTKVRWAP 461          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: mys-1 (Histone acetyltransferase Tip60 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9TYU5])

HSP 1 Score: 289.271 bits (739), Expect = 2.784e-93
Identity = 167/400 (41.75%), Postives = 226/400 (56.50%), Query Frame = 2
Query:  134 TIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRH----QKRKINEI----YHGRSIDEAPMDSITLK--------------LEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVI----FTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
             I  CR + +   +++VHY   +RRLDEWV  + +++ S  E+ ++       L  E  D          +KRKI  +        S+D  P+ +I+                +     A TR++ +E I  G   I+ WYF+PYP+       +YICE+CLKY+K +     H  +C    PPG +IY  + LS FEIDG + K Y QNLCLLAKLFLDHKTLYYD  PF+FYVL E D +G H+VGYFSKEK S + YN+ACIL LPPFQ+KGYG  LI FSYEL+KIE+  GSPEKPLSDLG LSYRSYW   I    F +   +P    +++DIS +T I  +D+ S L+  +L KYY      +    K  ++       KK  +I+ + L+W P
Sbjct:   51 VISRCR-AANGSIKFYVHYIDCNRRLDEWVQSDRLNLAS-CELPKKGGKKGAHLREENRDSNENEGKKSGRKRKIPLLPMDDLKAESVD--PLQAISTMTSGSTPSLRGSMSMVGHSEDAMTRIRNVECIELGRSRIQPWYFAPYPQQLTSLDCIYICEFCLKYLKSKTCLKRHMEKCAMCHPPGNQIYSHDKLSFFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVLTEEDEKGHHIVGYFSKEKESAEEYNVACILVLPPFQKKGYGSLLIEFSYELSKIEQKTGSPEKPLSDLGLLSYRSYWSMAIMKELFAFKRRHPGEDITVQDISQSTSIKREDVVSTLQQLDLYKYYKGSYIIVISDEKRQVYEKRIEAAKKKTRINPAALQWRP 446          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 212.231 bits (539), Expect = 1.563e-62
Identity = 111/286 (38.81%), Postives = 166/286 (58.04%), Query Frame = 2
Query:  434 RVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYL------LDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGK-------ELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            + +  E I +G + ++TWY SP+P ++   +KL+ICE+C  Y + ++    H  +C  + PPG EIYRK ++SVFE+DG  +K YCQ LCL++++FL+ KT++YD  PF FY++   D  GCH  GYFSKEK   D  NL+CI+TLP +Q  G G+FLI  SY L++ EK  G PE+PLS+LG  +Y  YW   I + L      L++ +  SI+ I+  T ++  DI  V+ S    K      K       ++     S+I      + +  +Q D  CL W+P
Sbjct:  209 QARLPERIHFGAFIMKTWYGSPFPAEFINVKKLFICEFCFFYARSDEIMQNHAKKCMLRAPPGLEIYRKGDISVFEVDGRLQKEYCQTLCLVSRMFLESKTVFYDTEPFFFYIVTINDDIGCHFAGYFSKEKYEPDVNNLSCIMTLPCYQEMGLGRFLIDISYALSRKEKWFGGPEQPLSELGRKAYGGYWRTTIASCLGRLKDELEFGSGISIKMIADDTGVNCHDILEVVCSLGWAKPVDPDEKNHYKLEWDVDWDMVSIILRESEASKETKVQYDPECLDWVP 494          
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Match: lsy-12 (Histone acetyltransferase [Source:UniProtKB/TrEMBL;Acc:L8E6K3])

HSP 1 Score: 212.231 bits (539), Expect = 1.563e-62
Identity = 111/286 (38.81%), Postives = 166/286 (58.04%), Query Frame = 2
Query:  434 RVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYL------LDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGK-------ELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            + +  E I +G + ++TWY SP+P ++   +KL+ICE+C  Y + ++    H  +C  + PPG EIYRK ++SVFE+DG  +K YCQ LCL++++FL+ KT++YD  PF FY++   D  GCH  GYFSKEK   D  NL+CI+TLP +Q  G G+FLI  SY L++ EK  G PE+PLS+LG  +Y  YW   I + L      L++ +  SI+ I+  T ++  DI  V+ S    K      K       ++     S+I      + +  +Q D  CL W+P
Sbjct:  209 QARLPERIHFGAFIMKTWYGSPFPAEFINVKKLFICEFCFFYARSDEIMQNHAKKCMLRAPPGLEIYRKGDISVFEVDGRLQKEYCQTLCLVSRMFLESKTVFYDTEPFFFYIVTINDDIGCHFAGYFSKEKYEPDVNNLSCIMTLPCYQEMGLGRFLIDISYALSRKEKWFGGPEQPLSELGRKAYGGYWRTTIASCLGRLKDELEFGSGISIKMIADDTGVNCHDILEVVCSLGWAKPVDPDEKNHYKLEWDVDWDMVSIILRESEASKETKVQYDPECLDWVP 494          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: mof (gene:FBgn0014340 transcript:FBtr0070829)

HSP 1 Score: 356.681 bits (914), Expect = 4.784e-115
Identity = 188/449 (41.87%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   77 ILINEN----YIVKRKDDSLCKATIIECRIS--TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS------------KFEIKEESCSNLLALAT------------------------------ECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLD--YPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP-IQIDKSCLKWLPPIKVKV 1267
            I I+EN    Y ++R+D ++ +  +++ R +   +  +EY+VHY G +RRLD WV    I  N+                 + S S  +                                  + SD ++TR+QKR+ +EI H +    A + +    LEKEH++ T++KYI+ +++G YEI+TWYFSP+PE+Y K + LY+CEYCLKYM+   S+  H  +C +++PPG+EIYRK N+S++E++G E+ LYCQ LCL+AKLFLDHK LY+D+ PF+FY+LCE D+EG H+VGYFSKEK S++NYN+ACIL LPP QRKG+GK LIAFSYEL++ E +IGSPEKPLSDLG LSYRSYW Y +   +     P   +I+++S  + I+ DDI   L+S  ++KY+ +    + ++ K++  +L+    K+P + ID   L W P     V
Sbjct:  373 IDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQK-SHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYW-KGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQTAAAV 819          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0070668)

HSP 1 Score: 292.738 bits (748), Expect = 1.504e-93
Identity = 146/283 (51.59%), Postives = 184/283 (65.02%), Query Frame = 2
Query:  425 AFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLL--------DYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
              TR+K +E I  G + I+ WYFSPYP++  +   +YICE+CLKY K       H S+C  + PPG EIYRK  +S FEIDG + K+Y QNLCLLAKLFLDHKTLYYD  PF+FYV+ E D  G H+VGYFSKEK S ++YN+ACILT+PP+QRKGYGK LI FSYEL+K E   GSPEKPLSDLG LSYRSYW   I    +        + P  +I DI   T I  +D+ S L++ NL+ YY   G+ +    + +I       +K+ I+ID  CL W P
Sbjct:  253 VVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIKKEDVISTLQNLNLINYY--KGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTP 533          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: Tip60 (gene:FBgn0026080 transcript:FBtr0333186)

HSP 1 Score: 292.738 bits (748), Expect = 1.504e-93
Identity = 146/283 (51.59%), Postives = 184/283 (65.02%), Query Frame = 2
Query:  425 AFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLL--------DYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
              TR+K +E I  G + I+ WYFSPYP++  +   +YICE+CLKY K       H S+C  + PPG EIYRK  +S FEIDG + K+Y QNLCLLAKLFLDHKTLYYD  PF+FYV+ E D  G H+VGYFSKEK S ++YN+ACILT+PP+QRKGYGK LI FSYEL+K E   GSPEKPLSDLG LSYRSYW   I    +        + P  +I DI   T I  +D+ S L++ NL+ YY   G+ +    + +I       +K+ I+ID  CL W P
Sbjct:  253 VVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKSRKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYDTDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYELSKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIKKEDVISTLQNLNLINYY--KGQYIVCINRVIIEQHRRAMDKRKIRIDSKCLHWTP 533          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: enok (gene:FBgn0034975 transcript:FBtr0343339)

HSP 1 Score: 295.434 bits (755), Expect = 1.060e-88
Identity = 143/280 (51.07%), Postives = 193/280 (68.93%), Query Frame = 2
Query:  449 ETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLL---DYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGK-ELQIS-----RKSLIHYLENFNNKKPIQIDKSCLKWLPPIKV 1261
            ++I+ G ++IETWY SP+P++Y +  KL++CE+CLKY K       HQ++C  KQPPG EI+R+ N+SVFE+DGN  K+YCQNLCLLAK FLDHKTLYYDV PF+FY+L + D+ GCHLVGYFSKEK     YN++CILT+P +QR+GYG+FLI FSY L++ E  +G+PEKPLSDLG LSY SYW+ V+  YL    +Y   + +DI+  T ++I DI    E  N +K     G    QI+     +K L H+ +  N+K  I I+  CL+W P + V
Sbjct:  713 KSIQIGKWDIETWYSSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGNISVFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKHCTQKYNVSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKHRNYTKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEWKKVLAHHNKMANSKTRIIIEPDCLRWSPLLSV 992          
BLAST of Histone acetyltransferase vs. Ensembl Fly
Match: enok (gene:FBgn0034975 transcript:FBtr0072250)

HSP 1 Score: 295.434 bits (755), Expect = 1.060e-88
Identity = 143/280 (51.07%), Postives = 193/280 (68.93%), Query Frame = 2
Query:  449 ETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLL---DYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGK-ELQIS-----RKSLIHYLENFNNKKPIQIDKSCLKWLPPIKV 1261
            ++I+ G ++IETWY SP+P++Y +  KL++CE+CLKY K       HQ++C  KQPPG EI+R+ N+SVFE+DGN  K+YCQNLCLLAK FLDHKTLYYDV PF+FY+L + D+ GCHLVGYFSKEK     YN++CILT+P +QR+GYG+FLI FSY L++ E  +G+PEKPLSDLG LSY SYW+ V+  YL    +Y   + +DI+  T ++I DI    E  N +K     G    QI+     +K L H+ +  N+K  I I+  CL+W P + V
Sbjct:  713 KSIQIGKWDIETWYSSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWKQPPGTEIFRQGNISVFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHLVGYFSKEKHCTQKYNVSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFSYWKSVVLEYLYKHRNYTKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEWKKVLAHHNKMANSKTRIIIEPDCLRWSPLLSV 992          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 410.609 bits (1054), Expect = 6.205e-140
Identity = 207/397 (52.14%), Postives = 280/397 (70.53%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H SQC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   98 VEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAPP 492          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 410.609 bits (1054), Expect = 6.205e-140
Identity = 207/397 (52.14%), Postives = 280/397 (70.53%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H SQC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   98 VEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAPP 492          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 410.609 bits (1054), Expect = 6.205e-140
Identity = 207/397 (52.14%), Postives = 280/397 (70.53%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H SQC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   98 VEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTHCLKWAPP 492          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 397.512 bits (1020), Expect = 2.394e-134
Identity = 208/425 (48.94%), Postives = 276/425 (64.94%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYY-------------HRHGKELQISR--------------KSLIHYLENFNNKK--PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H SQC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+               H K  Q  +               SL+ +   FN        +D  CLKW PP
Sbjct:   98 VEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITGNIRKTNAELGSLLLFSPKFNRLTFCASTVDTHCLKWAPP 521          
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Match: kat8 (K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB-GENE-030131-7510])

HSP 1 Score: 389.037 bits (998), Expect = 7.308e-131
Identity = 208/439 (47.38%), Postives = 277/439 (63.10%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCH--------------QSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYY-------------HRHGKELQISR--------------KSLIHYLENFNNKK--PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H              +SQC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+               H K  Q  +               SL+ +   FN        +D  CLKW PP
Sbjct:   98 VEIGETYLCQRTDKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLPRWRLRHIDRHMGKSQCQWRQPPGKEIYRKNNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITGNIRKTNAELGSLLLFSPKFNRLTFCASTVDTHCLKWAPP 535          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat8 (K(lysine) acetyltransferase 8 [Source:NCBI gene;Acc:548988])

HSP 1 Score: 408.297 bits (1048), Expect = 2.143e-139
Identity = 206/396 (52.02%), Postives = 279/396 (70.45%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D++   A +I+ R++    + EY+VHY G +RRLDEWV    + +     +  +++    L   +E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T++KY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H   C  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI   L+S N++KY+ +    + ++ K +  +L++   KK PI +D   LKW PP
Sbjct:   62 VEIGETYLCRRADNTWHSAEVIQSRLNEQEGREEYYVHYVGCNRRLDEWVDKNRLALTKTVKDAVQKNTDQYLNELSEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKIKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWVCEYCLKYMKFEKSYRYHLGLCQWRQPPGKEIYRKGNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIIGTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSINLKWAPP 455          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat8 (K(lysine) acetyltransferase 8 [Source:NCBI gene;Acc:548988])

HSP 1 Score: 395.586 bits (1015), Expect = 9.262e-135
Identity = 199/382 (52.09%), Postives = 271/382 (70.94%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP 1213
            + I E Y+ +R D++   A +I+ R++    + EY+VHY G +RRLDEWV    + +     +  +++    L   +E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T++KY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H   C  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI   L+S N++KY+ +    + ++ K +  +L++   KKP
Sbjct:   29 VEIGETYLCRRADNTWHSAEVIQSRLNEQEGREEYYVHYVGCNRRLDEWVDKNRLALTKTVKDAVQKNTDQYLNELSEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKIKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWVCEYCLKYMKFEKSYRYHLGLCQWRQPPGKEIYRKGNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIIGTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKP 408          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat8 (K(lysine) acetyltransferase 8 [Source:NCBI gene;Acc:548988])

HSP 1 Score: 396.356 bits (1017), Expect = 3.699e-134
Identity = 199/382 (52.09%), Postives = 271/382 (70.94%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP 1213
            + I E Y+ +R D++   A +I+ R++    + EY+VHY G +RRLDEWV    + +     +  +++    L   +E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T++KY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H   C  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI   L+S N++KY+ +    + ++ K +  +L++   KKP
Sbjct:   97 VEIGETYLCRRADNTWHSAEVIQSRLNEQEGREEYYVHYVGCNRRLDEWVDKNRLALTKTVKDAVQKNTDQYLNELSEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKIKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWVCEYCLKYMKFEKSYRYHLGLCQWRQPPGKEIYRKGNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIIGTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKP 476          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 314.309 bits (804), Expect = 1.723e-101
Identity = 153/288 (53.12%), Postives = 203/288 (70.49%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ---IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E  +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI    + + K+      +D SCLKW PP
Sbjct:  266 KLRLQGQITEGSNMIKTIIFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEDKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWASKDAKRTNSNKTMDPSCLKWTPP 551          
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Match: kat7 (lysine acetyltransferase 7 [Source:NCBI gene;Acc:548673])

HSP 1 Score: 313.538 bits (802), Expect = 2.226e-101
Identity = 153/288 (53.12%), Postives = 203/288 (70.49%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ---IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E  +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI    + + K+      +D SCLKW PP
Sbjct:  247 KLRLQGQITEGSNMIKTIIFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEDKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWASKDAKRTNSNKTMDPSCLKWTPP 532          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat8 (K(lysine) acetyltransferase 8 [Source:MGI Symbol;Acc:MGI:1915023])

HSP 1 Score: 415.616 bits (1067), Expect = 1.691e-142
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat7 (K(lysine) acetyltransferase 7 [Source:MGI Symbol;Acc:MGI:2182799])

HSP 1 Score: 314.694 bits (805), Expect = 3.498e-102
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  234 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 519          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat7 (K(lysine) acetyltransferase 7 [Source:MGI Symbol;Acc:MGI:2182799])

HSP 1 Score: 315.849 bits (808), Expect = 8.548e-102
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  295 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 580          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat7 (K(lysine) acetyltransferase 7 [Source:MGI Symbol;Acc:MGI:2182799])

HSP 1 Score: 315.464 bits (807), Expect = 8.826e-102
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  293 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 578          
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Match: Kat7 (K(lysine) acetyltransferase 7 [Source:MGI Symbol;Acc:MGI:2182799])

HSP 1 Score: 316.62 bits (810), Expect = 9.965e-102
Identity = 153/288 (53.12%), Postives = 202/288 (70.14%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIH---YLENFNNKKPIQIDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHL+GYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI      E   +     +D SCLKW PP
Sbjct:  325 KLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPP 610          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9H7Z6|KAT8_HUMAN (Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2)

HSP 1 Score: 415.616 bits (1067), Expect = 1.157e-141
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q9D1P2|KAT8_MOUSE (Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.183e-141
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q5XI06|KAT8_RAT (Histone acetyltransferase KAT8 OS=Rattus norvegicus OX=10116 GN=Kat8 PE=1 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.348e-141
Identity = 209/396 (52.78%), Postives = 281/396 (70.96%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF-EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +     +  +++    L+   E  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I  G YEI+ WYFSP+PEDY K  KL++CEYCLKYMK E S+  H  QC  +QPPGKEIYRK N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EVDR+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+ +DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   55 VEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 448          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|Q8LI34|MYST1_ORYSJ (Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os07g0626600 PE=3 SV=1)

HSP 1 Score: 349.362 bits (895), Expect = 8.429e-116
Identity = 185/394 (46.95%), Postives = 255/394 (64.72%), Query Frame = 2
Query:   83 INENYIVKRKDDSLCKATIIECRISTSNQN----EYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDY-PNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            +    + + +D  L    +IE R S+++ +    EY+VHY   +RRLDEWV  E +D+ +     +E   +      + +  ++TRHQKRKI+E +  +  +E  +D+ +L+   EH+ FT+VK I  I  G YEI+TWYFSP+P +Y    KL+ CE+CL +MK ++    H  +C  K PPG EIYR   LS+FE+DG + K+Y QNLC LAKLFLDHKTLYYDV  F+FYVLCE D  GCH+VGYFSKEK S ++YNLACILTLPP+QRKGYGKFLIAFSYEL+K E  +G+PE+PLSDLG LSYR YW  V+   L  +  N SI+++S  T I  DDI S L+S +L++Y  R G+ +  +   ++        +  +++D S L W P
Sbjct:   65 VGTRVMCRWRDQKLHPVKVIERRKSSTSSSPADYEYYVHYTEFNRRLDEWVKLEQLDLETVETDVDEKVED------KATSLKMTRHQKRKIDETHVEQGHEE--LDAASLR---EHEEFTKVKNIAKIELGRYEIDTWYFSPFPPEYNDSPKLFFCEFCLNFMKRKEQLQRHMKKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKHKSNISIKELSDMTAIKADDILSTLQSLDLIQY--RKGQHVICADPKVLDRHLKAAGRGGLEVDVSKLIWTP 445          
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Match: sp|O02193|MOF_DROME (Males-absent on the first protein OS=Drosophila melanogaster OX=7227 GN=mof PE=1 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 4.796e-114
Identity = 188/449 (41.87%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   77 ILINEN----YIVKRKDDSLCKATIIECRIS--TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS------------KFEIKEESCSNLLALAT------------------------------ECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLD--YPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP-IQIDKSCLKWLPPIKVKV 1267
            I I+EN    Y ++R+D ++ +  +++ R +   +  +EY+VHY G +RRLD WV    I  N+                 + S S  +                                  + SD ++TR+QKR+ +EI H +    A + +    LEKEH++ T++KYI+ +++G YEI+TWYFSP+PE+Y K + LY+CEYCLKYM+   S+  H  +C +++PPG+EIYRK N+S++E++G E+ LYCQ LCL+AKLFLDHK LY+D+ PF+FY+LCE D+EG H+VGYFSKEK S++NYN+ACIL LPP QRKG+GK LIAFSYEL++ E +IGSPEKPLSDLG LSYRSYW Y +   +     P   +I+++S  + I+ DDI   L+S  ++KY+ +    + ++ K++  +L+    K+P + ID   L W P     V
Sbjct:  373 IDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQK-SHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYW-KGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQTAAAV 819          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A0X3NS70 (Histone acetyltransferase OS=Schistocephalus solidus OX=70667 GN=KAT8 PE=3 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 4.700e-164
Identity = 241/419 (57.52%), Postives = 308/419 (73.51%), Query Frame = 2
Query:   68 SNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRS-IDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQ-SQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-------------PIQIDKSCLKWLPPIKVKVTGKK 1279
            ++ + I +N+ V+R D  L  A I+E R+  S   EYFVHY   DRRLDEWV  + I+ NSKF         +L +  + SDGRLTR+QKR+ +E+ H  S +D A  DSIT +LEKEHQ FTRVK+I+ IR+G YEI TWYFSPYPE+YRK + L+ICE+CLKYMK E +++ H   +C Q QPPG+EIY+K+N+ VFE+DG++ KLYCQNLCLLAKLFLDHKTLYYDVAPF+FYVLCEVD  GCH+VGYFSKE+ S++N NLACILTLPPFQR+GYGKFLI+ SYELAKIE +IGSPEKPLSDLG LSY+SYWE VIF YLL+Y +SSIE+IS  TCI+ +DI   L+SH+ +KY+ RHG+ +++S++SL  YL     +              P+++D SC+ W P  K     K+
Sbjct:    4 TSTVSIGDNFKVRRHDGQLYPACILETRLLESGDIEYFVHYLECDRRLDEWVTIDRIEQNSKF-TSSSPPDGVLKIPGQ-SDGRLTRNQKRRYDEMNHVTSELDTA--DSITQRLEKEHQKFTRVKFIDHIRFGKYEIGTWYFSPYPEEYRKLKYLWICEFCLKYMKFEKTWIRHMLHECRQHQPPGREIYKKDNIRVFEVDGDQHKLYCQNLCLLAKLFLDHKTLYYDVAPFLFYVLCEVDTTGCHIVGYFSKERFSVENNNLACILTLPPFQRRGYGKFLISLSYELAKIENLIGSPEKPLSDLGRLSYKSYWEKVIFNYLLEYSDSSIEEISAVTCIAPEDIIWTLQSHHAIKYW-RHGRHIELSQRSLQDYLTRMAQRNRLAAQNHGPDWRPPVELDVSCIHWTPSTKANKPVKR 417          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A0X3PHZ0 (Histone acetyltransferase (Fragment) OS=Schistocephalus solidus OX=70667 GN=KAT8 PE=3 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 9.929e-163
Identity = 241/419 (57.52%), Postives = 308/419 (73.51%), Query Frame = 2
Query:   68 SNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRS-IDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQ-SQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-------------PIQIDKSCLKWLPPIKVKVTGKK 1279
            ++ + I +N+ V+R D  L  A I+E R+  S   EYFVHY   DRRLDEWV  + I+ NSKF         +L +  + SDGRLTR+QKR+ +E+ H  S +D A  DSIT +LEKEHQ FTRVK+I+ IR+G YEI TWYFSPYPE+YRK + L+ICE+CLKYMK E +++ H   +C Q QPPG+EIY+K+N+ VFE+DG++ KLYCQNLCLLAKLFLDHKTLYYDVAPF+FYVLCEVD  GCH+VGYFSKE+ S++N NLACILTLPPFQR+GYGKFLI+ SYELAKIE +IGSPEKPLSDLG LSY+SYWE VIF YLL+Y +SSIE+IS  TCI+ +DI   L+SH+ +KY+ RHG+ +++S++SL  YL     +              P+++D SC+ W P  K     K+
Sbjct:   66 TSTVSIGDNFKVRRHDGQLYPACILETRLLESGDIEYFVHYLECDRRLDEWVTIDRIEQNSKF-TSSSPPDGVLKIPGQ-SDGRLTRNQKRRYDEMNHVTSELDTA--DSITQRLEKEHQKFTRVKFIDHIRFGKYEIGTWYFSPYPEEYRKLKYLWICEFCLKYMKFEKTWIRHMLHECRQHQPPGREIYKKDNIRVFEVDGDQHKLYCQNLCLLAKLFLDHKTLYYDVAPFLFYVLCEVDTTGCHIVGYFSKERFSVENNNLACILTLPPFQRRGYGKFLISLSYELAKIENLIGSPEKPLSDLGRLSYKSYWEKVIFNYLLEYSDSSIEEISAVTCIAPEDIIWTLQSHHAIKYW-RHGRHIELSQRSLQDYLTRMAQRNRLAAQNHGPDWRPPVELDVSCIHWTPSTKANKPVKR 479          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A0R3UEN4 (Histone acetyltransferase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5485 PE=3 SV=1)

HSP 1 Score: 472.626 bits (1215), Expect = 2.479e-162
Identity = 233/407 (57.25%), Postives = 301/407 (73.96%), Query Frame = 2
Query:   74 DILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQ-SQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKP-------------IQIDKSCLKWLPP 1252
            D+ + +N+ ++R D     A ++E R++   Q EYFVHY G DRRLDEWV  + I+++SKF     + +++L +    SD RLTRHQKR+  EIY   S  ++  D I+ +LE+EHQ FTRVK+I+ IR+G YEI TWYFSPYPE+YR+ Q L+ICEYCLKYMK+E ++L H    C Q+QPPG+E+YRKE++ V+EI+G+ +KLYCQNLCLLAKLFLDHKTLYYDVAPF+FYVLCE D  GCH+VGYFSKE++S D  NLACIL LPPFQRKGYGKFLI+ SYELAKIE ++GSPEKPLSDLG LSYRSYWE VIF YLLD+ N SIE+IS+ATCI+ +D+   LESH  +KY+ RHG+ ++IS ++L  Y+     +               +++D SCL W PP
Sbjct:    6 DVNVGDNFYIRRSDGQTYPACVVETRLTDFLQVEYFVHYLGFDRRLDEWVTLDRINISSKFN-SSATPTDVLGVPGP-SDRRLTRHQKRRYEEIYSSPSEPDS-TDIISQRLEREHQEFTRVKFIDLIRFGKYEIGTWYFSPYPEEYRRKQYLWICEYCLKYMKMERTWLRHMLKDCRQRQPPGREVYRKESIRVYEINGSTQKLYCQNLCLLAKLFLDHKTLYYDVAPFVFYVLCESDPSGCHIVGYFSKERVSADKNNLACILVLPPFQRKGYGKFLISLSYELAKIEGLVGSPEKPLSDLGRLSYRSYWEGVIFKYLLDFTNKSIEEISSATCIAPEDVIWTLESHPTIKYW-RHGRHIEISHRALKEYVSQMAQRDKARMSAGRGAGAPLVELDVSCLTWSPP 408          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A0R3X735 (Histone acetyltransferase OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9333 PE=3 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 1.993e-159
Identity = 227/411 (55.23%), Postives = 302/411 (73.48%), Query Frame = 2
Query:   62 KNSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQ-SQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK--------------PIQIDKSCLKWLP 1249
            +++ DI+I +++ ++R +     A+I+E R++ + Q EYFVHY   DRRLDEWV  + ID  SKF I       LL      +DGRLTRHQKR+  E+    S +  P +++T +LE+EHQ FTRVK+I+ +R+G YEI TWYFSPYP++YR+ + L++CE+CLKYMK+E +++ H   +C Q+QPPG+EIYRK ++ VFE+D  ++KLYCQNLCLLAKLFLDHKTLYYDVAPF+FYVLCE D +GCH+VGYFSKE++S+DN NLACILTLPPFQRKGYGKFLI  SYELAKIE  IGSPEKPLSDLG LSY+SYWE VIF YLL + + +IE+ISTATCI+ +DI   L++H ++K + RHG+ L++SR++L  Y+     ++              P   D SCL+W P
Sbjct:    2 RHTVDIVIGDHFKIQRNNGQSYPASIVETRLTDTGQVEYFVHYLNFDRRLDEWVSADRIDTTSKFVIPTPIDDVLLVPGQ--NDGRLTRHQKRRYEELNSTPS-ELYPANTLTERLEREHQEFTRVKFIDQVRFGKYEIGTWYFSPYPDEYRRLKCLWVCEFCLKYMKMEKTWVRHMLHECRQRQPPGREIYRKSSIRVFEVDAAKEKLYCQNLCLLAKLFLDHKTLYYDVAPFLFYVLCEADTDGCHIVGYFSKERVSLDNNNLACILTLPPFQRKGYGKFLITLSYELAKIEGTIGSPEKPLSDLGRLSYKSYWEGVIFRYLLTHTSCTIEEISTATCIAPEDIIWTLQTHEVIKSW-RHGRHLELSRRALSDYMTRIVERELRGVRNGEDGAALCPTVFDVSCLRWTP 408          
BLAST of Histone acetyltransferase vs. TrEMBL
Match: A0A068Y9X6 (Histone acetyltransferase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000898000 PE=3 SV=1)

HSP 1 Score: 462.225 bits (1188), Expect = 7.804e-158
Identity = 231/413 (55.93%), Postives = 302/413 (73.12%), Query Frame = 2
Query:   65 NSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQ-SQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIED--ISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK--------------PIQIDKSCLKWLPP 1252
            ++ DI+I +++ + R +  L  A+I+E R +   Q EYFVHY   DRRLDEWV  + ID  SKF +       LL      +DGRLTRHQKR+  E+    S +  P ++IT +LE+EHQ FTRVK+I+ + +G YEI TWYFSPYP++YR+ + L+ICE+CLKYMK+E +++ H   +C Q+QPPG+EIY K ++ VFEID +++KLYCQNLCLLAKLFLDHKTLYYDVAPF+FYVLCE D +GCH+VGYFSKE+IS+DN NLACILTLPPFQRKGYGKFLIA SYELAKIE +IGSPEKPLSDLG LSY+SYWE VIF YLL + + +IE+  ISTATCI+ +DI   L++H ++K + RHG+ L++SR++L  Y+     ++              P+  D SCL+W PP
Sbjct:    3 HTVDIVIGDHFKILRNNGQLYPASIVETRTTDIGQVEYFVHYLNFDRRLDEWVSVDRIDTTSKFAVPAPLDGILLVPGQ--NDGRLTRHQKRRYEEMNTAPS-ELDPANTITERLEREHQEFTRVKFIDQVHFGKYEIGTWYFSPYPDEYRRLKCLWICEFCLKYMKMEKTWVRHMLHECRQRQPPGREIYCKGSIRVFEIDASKEKLYCQNLCLLAKLFLDHKTLYYDVAPFLFYVLCEADTDGCHVVGYFSKERISVDNNNLACILTLPPFQRKGYGKFLIALSYELAKIEGIIGSPEKPLSDLGRLSYKSYWEGVIFRYLLAHTSCTIEEISISTATCIAPEDIIWTLQTHEVIKNW-RHGRHLELSRQALSEYMTRIVGRELRGARGGGEGAATSPLVFDVSCLRWTPP 411          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat8 (lysine acetyltransferase 8 [Source:NCBI gene;Acc:103040440])

HSP 1 Score: 403.675 bits (1036), Expect = 4.390e-137
Identity = 204/397 (51.39%), Postives = 279/397 (70.28%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I E Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++           +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+P+DY K  KL+ICEYCLKYMK E +F  H +QC  +QPPGKEIYR+ N+SV+E+DG + K+Y QNLCLLAKLFLDHKTLY+DV PF+FY+L EV+R+G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:  110 VEIGETYLCQRADKTWHSAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKGRLALTKTVKDAVRKSVEEGGGGELGDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPDDYGKQPKLWICEYCLKYMKYEKTFRYHLAQCQWRQPPGKEIYRRGNISVYEVDGRDHKIYSQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTLCLKWAPP 504          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000046538.1 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:103035053])

HSP 1 Score: 312.768 bits (800), Expect = 3.467e-101
Identity = 154/287 (53.66%), Postives = 201/287 (70.03%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ--IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK  +SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L+S  ++KY+   GK L + R+ LI    +   K+     ID + LKW PP
Sbjct:  259 KLRLQGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGVISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLYNFQGKEISIKEISQETAVNPVDIVSTLQSLQMLKYW--KGKHLVLKRQDLIDDWRSKEIKRGSSKTIDPTALKWSPP 543          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat7b (histone acetyltransferase KAT7-like [Source:NCBI gene;Acc:103032007])

HSP 1 Score: 312.768 bits (800), Expect = 4.005e-101
Identity = 151/288 (52.43%), Postives = 200/288 (69.44%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ---IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG E+YR+  +SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  Y+ ++     SI++IS  T ++  DI S L+S  ++KY+   GK L + R+ LI   +    K+      ID   LKW PP
Sbjct:  264 KLRMQGQITEGSNMIKTILFGRYELDTWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHMAKCVWKHPPGDEVYRQGAISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYMYNFQGKDISIKEISQETAVNPVDIVSTLQSLQMLKYW--KGKHLVLKRQDLIDEWKAKETKRGTNNKTIDPGSLKWTPP 549          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: kat7b (histone acetyltransferase KAT7-like [Source:NCBI gene;Acc:103032007])

HSP 1 Score: 311.997 bits (798), Expect = 5.222e-101
Identity = 151/288 (52.43%), Postives = 200/288 (69.44%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ---IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG E+YR+  +SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  Y+ ++     SI++IS  T ++  DI S L+S  ++KY+   GK L + R+ LI   +    K+      ID   LKW PP
Sbjct:  248 KLRMQGQITEGSNMIKTILFGRYELDTWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHMAKCVWKHPPGDEVYRQGAISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYMYNFQGKDISIKEISQETAVNPVDIVSTLQSLQMLKYW--KGKHLVLKRQDLIDEWKAKETKRGTNNKTIDPGSLKWTPP 533          
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000046151.1 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:103035053])

HSP 1 Score: 313.538 bits (802), Expect = 7.279e-101
Identity = 154/287 (53.66%), Postives = 201/287 (70.03%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ--IDKSCLKWLPP 1252
            KL  + Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK  +SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  YL ++     SI++IS  T ++  DI S L+S  ++KY+   GK L + R+ LI    +   K+     ID + LKW PP
Sbjct:  313 KLRLQGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGVISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLYNFQGKEISIKEISQETAVNPVDIVSTLQSLQMLKYW--KGKHLVLKRQDLIDDWRSKEIKRGSSKTIDPTALKWSPP 597          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat7b (K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZDB-GENE-030131-1901])

HSP 1 Score: 303.138 bits (775), Expect = 3.005e-98
Identity = 147/273 (53.85%), Postives = 192/273 (70.33%), Query Frame = 2
Query:  446 IETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQ---IDKSCLKWLP 1249
            I++I +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H  +C  K PPG EIYRK  +SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCH++GYFSKEK S  NYN++CILT+P F R+GYGK LI FSY L+K E  IGSPE+PLSDLG +SYRSYW+ V+  YL  +     SI++IS  T ++  DI + L++  ++KY+   GK L + R+ +I         KP+    ID + LKW P
Sbjct:  267 IKSIMFGRYELDTWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHTEKCVWKHPPGDEIYRKGTISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNTGCHIIGYFSKEKNSFLNYNVSCILTMPQFMRQGYGKMLIDFSYLLSKEENKIGSPERPLSDLGLISYRSYWKEVLLRYLHAFQGKEISIKEISQDTAVNPVDIVNTLQALQMLKYW--KGKHLVLKRQDVIDDFLEKEASKPVSNKVIDPASLKWTP 537          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007004.1 (pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 gene:ENSPMAG00000006332.1 transcript:ENSPMAT00000007004.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 293.123 bits (749), Expect = 5.896e-97
Identity = 143/244 (58.61%), Postives = 177/244 (72.54%), Query Frame = 2
Query:  446 IETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRK 1171
            I TI +G YE++TWY SPYPE+Y +  KLY+CE+CLKYMK       H ++C  K PPG EIYR   +SVFE+DG + K YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P F R+GYGK LI FSY L+K+E  IGSPE+PLSDLG +SYRSYW+ V+  YL  +     SI++IS  T I+  DI S L+   ++KY+   GK L + R+
Sbjct:  101 IRTIVFGRYELDTWYHSPYPEEYTRLGKLYVCEFCLKYMKSPTILRRHMAKCVWKHPPGDEIYRNGTVSVFEVDGKKNKTYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEGDNAGCHLVGYFSKEKNSFLNYNVSCILTMPQFMRQGYGKMLIEFSYLLSKMEDKIGSPERPLSDLGLISYRSYWKGVVLRYLHGFHGKEISIKEISQETAINPADIVSTLQYLQMLKYW--KGKHLVLKRQ 342          
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Match: kat5b (K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZDB-GENE-030131-985])

HSP 1 Score: 282.722 bits (722), Expect = 9.335e-91
Identity = 146/297 (49.16%), Postives = 189/297 (63.64%), Query Frame = 2
Query:  383 PMDSITLKLEKEHQ-AFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDY-------PNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            P  + +L  +K H    TR+K IE I  G + ++ WYFSPYP++      LY+CE+CLKY+K       H  +C  + PPG EIYRK N+S FEIDG + K Y QNLCLLAK FLDHKTLYYD  PF+FYV+   D +G H+VGYFSKEK S ++YN+ACILTLPP+QR+GYG  LI FSYEL+K+E   G+PEKPLSDLG LSYRSYW   I   L+D        P  +I +IS  T I  +D+ S L+  NL+ YY   G+ +      +I   +    K+ ++ID  CL + P
Sbjct:  203 PRQTGSLVSDKSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTSLPVLYLCEFCLKYLKSLTCLQRHMHKCNLRHPPGNEIYRKGNISFFEIDGRKNKAYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTTFDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGTLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILIDLKAENGERPQITINEISELTSIKKEDVISTLQHLNLINYY--KGQYILNLSYEIIEGHQKAMAKRELRIDSKCLHFTP 497          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: ESA1 (Catalytic subunit of the histone acetyltransferase complex (NuA4); acetylates four conserved internal lysines of histone H4 N-terminal tail and can acetylate histone H2A; master regulator of cellular acetylation balance; required for cell cycle progression and transcriptional silencing at the rDNA locus and regulation of autophagy; human ortholog TIP60/KAT5 is implicated in cancer and other diseases, functionally complements lethality of the esa1 null mutation [Source:SGD;Acc:S000005770])

HSP 1 Score: 268.855 bits (686), Expect = 2.669e-86
Identity = 154/424 (36.32%), Postives = 237/424 (55.90%), Query Frame = 2
Query:   71 NDILIN-ENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKF------EIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLK---------------------LEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLPPI 1255
            +DI+I  + ++ K  ++ L +   I  R +     +++VHY   ++RLDEW+  + I+++ +          E++       AT  S+      Q     + +   + D   +D++ ++                     + +      RV+ +  I  G YEIE WYFSPYP +      +YI ++ L+Y   +  +  ++ +C  + PPG EIYR + +S FEIDG +++ +C+NLCLL+KLFLDHKTLYYDV PF+FY +   D  G HLVGYFSKEK S D YN+ACILTLP +QR GYGK LI FSYEL+K E  +GSPEKPLSDLG LSYR+YW   + T L+++    +I++IS+ T ++  DI    ++ N+++YY   G+ +    + ++        KK   ID + L W PP+
Sbjct:   19 DDIIIKCQCWVQKNDEERLAEILSINTRKAPP---KFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGV--DGFSRENTDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYY--KGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPV 435          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS3 (Histone acetyltransferase catalytic subunit of NuA3 complex; acetylates histone H3, involved in transcriptional silencing; homolog of the mammalian MOZ proto-oncogene; mutant has aneuploidy tolerance; sas3gcn5 double mutation is lethal [Source:SGD;Acc:S000000148])

HSP 1 Score: 226.868 bits (577), Expect = 6.076e-67
Identity = 114/213 (53.52%), Postives = 145/213 (68.08%), Query Frame = 2
Query:  446 IETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGC-----------HLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSS 1051
            IE I    YEI+ WY SP+PE   + + ++ICE+CLKYM    +F  HQ +C   +PPG EIYR   LSV+EIDG E  LYCQNLCLLAK F++ KTLYYDV PF+FY+L E  RE             H VGYFSKEK + ++YNL+CILTLP +QRKGYG+FL+ FSY L++ E   G+PEKPLSDLG L+YR++W+      LL   +S+
Sbjct:  272 IEYIVLRNYEIKPWYTSPFPEHINQNKMVFICEFCLKYMTSRYTFYRHQLKCLTFKPPGNEIYRDGKLSVWEIDGRENVLYCQNLCLLAKCFINSKTLYYDVEPFIFYILTE--REDTENHPYQNAAKFHFVGYFSKEKFNSNDYNLSCILTLPIYQRKGYGQFLMEFSYLLSRKESKFGTPEKPLSDLGLLTYRTFWKIKCAEVLLKLRDSA 482          
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Match: SAS2 (Histone acetyltransferase (HAT) catalytic subunit of the SAS complex; acetylates free histones and nucleosomes and regulates transcriptional silencing; member of the MYSTacetyltransferase family; other members are Sas4p and Sas5p [Source:SGD;Acc:S000004734])

HSP 1 Score: 154.451 bits (389), Expect = 1.019e-43
Identity = 83/233 (35.62%), Postives = 136/233 (58.37%), Query Frame = 2
Query:  530 LYICEYCLKYMKLEDSFLCHQSQCP-QKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLD-----YPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK 1210
            L++CEYC KY   +  F+ H + CP Q + PGK  Y+    ++  + G++ +L+CQ LCL  KL+LD+K++Y+ V  + FY++ E        +G+FSK+ +S    NLACIL  PP+QR+G G  LI FSY+L+++E +I  PE PLS  G + Y  YW  ++  +L++     Y   ++ED+S  T + ++D+   L+  N +      G+  QI  +SL  +L+    K+
Sbjct:  100 LFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLFCQCLCLFTKLYLDNKSMYFKVDHYEFYIVYETG--STKPMGFFSKDLVSYQQNNLACILIFPPYQRRGLGLLLIEFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDLSIVTGMRVNDVILTLKHLNCI------GENNQIYLQSLNSWLKLHGTKR 324          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8T4])

HSP 1 Score: 415.231 bits (1066), Expect = 6.971e-144
Identity = 206/391 (52.69%), Postives = 282/391 (72.12%), Query Frame = 2
Query:   98 IVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDV--NSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPI-QIDKSCLKWLPPIK 1258
            +V+R D+S   A II+ ++    +  Y+VHYHG +RRLDEWV    +D+  N    I ++       L  +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T++K+I+  ++G YEI+TWYFSPYP++Y K  KL+ICEYC+KYMK E +F  H  +C  +QPPGKEIYRK ++SV+E+DG E+KLYCQN+CLLAKLFLDHKTLY+DV PF+FY+L EVDREG H+VGYFSKEK S D  N+ACILTLPP+QRKGYGKFLI FSYEL+KIE+ +GSPEKPLSDLG LSYRSYW +V+   L ++  + SI+D+S  T I+ +DI   L+S N++KY+ +    + ++ K +  ++++   +KP+  +D SCL+W PP K
Sbjct:    1 MVQRPDNSWLSAEIIQSKVEDDGKTVYYVHYHGFNRRLDEWVEAARVDLQQNDDKPIIDDK------LDVDGPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKIKFIDKAQFGKYEIDTWYFSPYPDEYGKLNKLWICEYCIKYMKFEKTFRDHIGKCEMRQPPGKEIYRKGSVSVYEVDGKEQKLYCQNICLLAKLFLDHKTLYFDVEPFLFYILTEVDREGAHMVGYFSKEKESPDGNNVACILTLPPYQRKGYGKFLINFSYELSKIEQTVGSPEKPLSDLGKLSYRSYWSWVLLDILRNFRGTLSIKDLSAMTSITQEDIIGTLQSLNMVKYW-KGQHVICVTPKLVEEHVKSAQYRKPVLTVDNSCLRWAPPGK 383          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO34934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMW6])

HSP 1 Score: 273.478 bits (698), Expect = 2.816e-87
Identity = 139/283 (49.12%), Postives = 185/283 (65.37%), Query Frame = 2
Query:  431 TRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLC---HQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLL-------DYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            TR+K I+ ++ G + I+ WYFSPYP+++     +Y+C++CLK++K   SF C   H  +C    PPG EIYR   +S FEIDG + K Y QNLCLLAK+FLDHKTLYYD  PF+FY++ E D  G H+VGYFSKEK S ++YN+ACILTLP +QRKGYGK LI FSYEL+K E   G+PEKPLSDLG LSYRSYW   I   L+       + P+ +I +I   T I  +D+ S L+   L+ YY   G+ +    K ++       +K+ I+ID +CL W P
Sbjct:  192 TRMKNIQMVQLGKFRIKPWYFSPYPQEFTNLPMVYLCDFCLKFVK---SFHCLKRHMVKCNLFHPPGNEIYRNGTISFFEIDGRKNKQYAQNLCLLAKMFLDHKTLYYDTDPFLFYIMTESDGAGFHIVGYFSKEKESTEDYNVACILTLPQYQRKGYGKLLIEFSYELSKFEGKTGTPEKPLSDLGLLSYRSYWSQTILEILVGLKSEDGNPPSITINEICELTSIRKEDVVSTLQHLGLIHYY--KGQYILSLGKEVLEGHRRAMSKRKIRIDSNCLHWNP 469          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S982])

HSP 1 Score: 172.94 bits (437), Expect = 1.127e-52
Identity = 78/116 (67.24%), Postives = 97/116 (83.62%), Query Frame = 2
Query:  683 LYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYL 1030
            +YCQNLCLLAKLFLDHKTLYYDV PF+FYVL + D++GCHLVGYFSKEK     YN++CI+T+P +QR+G+G+ LI FSY L++IE   GSPEKPLSDLG +SYRSYW+ V+  Y+
Sbjct:   16 IYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDKKGCHLVGYFSKEKSCQQKYNVSCIMTMPHYQRQGFGRLLIDFSYLLSRIEGQSGSPEKPLSDLGLISYRSYWKSVMLEYM 131          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO29009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4V3])

HSP 1 Score: 100.138 bits (248), Expect = 2.277e-25
Identity = 58/128 (45.31%), Postives = 76/128 (59.38%), Query Frame = 2
Query:  884 RKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYL--LDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPI---QIDKSCLKWLPP 1252
            ++GYGK LI FSY L+K E  +GSPEKPLSDLG +SYRSYW+ ++  YL    Y   SI+DIS  T I  +DI S L+   L+KY+   GK L +    L          +P    +ID +CL+W PP
Sbjct:    2 KQGYGKMLIDFSYLLSKTECKVGSPEKPLSDLGLISYRSYWKNIVLKYLHCYGYDTISIKDISQETAIHPNDIVSTLQYLGLLKYW--KGKHLVLRSPELFEEFAKRVAARPANYQEIDPTCLQWSPP 127          
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Match: EDO39739 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S983])

HSP 1 Score: 85.1149 bits (209), Expect = 2.631e-20
Identity = 37/76 (48.68%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  437 VKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEI 664
            V+    I++G +EI TWY SPYP++Y +  KL+ICE+CLKYMK       H ++C    PP  EIYRK+++SVFE+
Sbjct:   32 VRSPALIQFGRHEIHTWYSSPYPQEYARLSKLFICEFCLKYMKSSSIVQRHITKCGWFHPPANEIYRKDDISVFEV 107          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat8 (lysine acetyltransferase 8 [Source:NCBI gene;Acc:101155932])

HSP 1 Score: 405.601 bits (1041), Expect = 4.974e-138
Identity = 204/397 (51.39%), Postives = 280/397 (70.53%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I   Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++ +    +    +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H S C  +QPPGKEIYR+ N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   91 VEIGVTYLCQRADKTWHTAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKSRLALTKTVKDAVRKSTEVGGVGDLGDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSHCQWRQPPGKEIYRRSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENSVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTMCLKWAPP 485          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat8 (lysine acetyltransferase 8 [Source:NCBI gene;Acc:101155932])

HSP 1 Score: 404.831 bits (1039), Expect = 8.848e-138
Identity = 204/397 (51.39%), Postives = 280/397 (70.53%), Query Frame = 2
Query:   77 ILINENYIVKRKDDSLCKATIIECRIS-TSNQNEYFVHYHGNDRRLDEWVPYENIDVNS--KFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK-PIQIDKSCLKWLPP 1252
            + I   Y+ +R D +   A +I+ R++    + E++VHY G +RRLDEWV    + +    K  +++ +    +    +  + ++TR+QKRK +EI H +    A MD  T  LEKEH+A T+VKY++ I+ G +EI+ WYFSP+PEDY K  KL+ICEYCLKYMK E +F  H S C  +QPPGKEIYR+ N+SV+E+DG + K+YCQNLCLLAKLFLDHKTLY+DV PF+FY+L EV+++G H+VGYFSKEK S D  N+ACILTLPP+QR+GYGKFLIAFSYEL+K+E  +GSPEKPLSDLG LSYRSYW +V+   L D+  + SI+D+S  T I+  DI S L+S N++KY+ +    + ++ K +  +L++   KK PI +D  CLKW PP
Sbjct:   91 VEIGVTYLCQRADKTWHTAEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKSRLALTKTVKDAVRKSTEVGGVGDLGDQPERKITRNQKRKHDEINHVQKT-YAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSHCQWRQPPGKEIYRRSNISVYEVDGRDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLENSVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQSDIISTLQSLNMVKYW-KGQHVICVTPKLVEEHLKSAQYKKPPITVDTLCLKWAPP 485          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: ENSORLT00000020927.2 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:101165809])

HSP 1 Score: 316.62 bits (810), Expect = 4.618e-102
Identity = 153/287 (53.31%), Postives = 201/287 (70.03%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK--PIQIDKSCLKWLPP 1252
            KL    Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK N+SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  Y+ ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI   +    K+     ID + LKW PP
Sbjct:  318 KLRLAGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKTNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMAEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKDVLLRYMNNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDDWKAKETKRGNGKTIDPTALKWTPP 602          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: ENSORLT00000029109.1 (histone acetyltransferase KAT7 [Source:NCBI gene;Acc:101165809])

HSP 1 Score: 316.235 bits (809), Expect = 1.268e-101
Identity = 153/287 (53.31%), Postives = 201/287 (70.03%), Query Frame = 2
Query:  404 KLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKK--PIQIDKSCLKWLPP 1252
            KL    Q       I+TI +G YE++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG EIYRK N+SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+GYGK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  Y+ ++     SI++IS  T ++  DI S L++  ++KY+   GK L + R+ LI   +    K+     ID + LKW PP
Sbjct:  344 KLRLAGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKTNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMAEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKDVLLRYMNNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYW--KGKHLVLKRQDLIDDWKAKETKRGNGKTIDPTALKWTPP 628          
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Match: kat7b (lysine acetyltransferase 7 [Source:NCBI gene;Acc:101156686])

HSP 1 Score: 311.997 bits (798), Expect = 7.398e-101
Identity = 149/276 (53.99%), Postives = 200/276 (72.46%), Query Frame = 2
Query:  446 IETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS--SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLI-----HYLENFNNKKPIQIDKSCLKWLPP 1252
            I+TI +G +E++TWY SPYPE+Y +  +LY+CE+CLKYMK +     H ++C  K PPG E+YRK ++SVFE+DG + K+YCQNLCLLAKLFLDHKTLYYDV PF+FYV+ E D  GCHLVGYFSKEK S  NYN++CILT+P + R+G+GK LI FSY L+K+E+ +GSPE+PLSDLG +SYRSYW+ V+  Y+ ++     SI++IS  T ++  DI S L+S  ++KY+   GK L + R+ LI       ++  N+ K   ID S LKW PP
Sbjct:  281 IKTIVFGRFELDTWYHSPYPEEYARLGRLYVCEFCLKYMKSQTILRRHMAKCVWKHPPGDEVYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGFGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYMCNFQGKEISIKEISQETAVNPVDIVSTLQSLQMLKYW--KGKHLVLKRQDLIDEWKAKEIKRGNSNK--TIDPSSLKWTPP 552          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000040171.1 (SMESG000040171.1)

HSP 1 Score: 839.336 bits (2167), Expect = 0.000e+0
Identity = 405/408 (99.26%), Postives = 406/408 (99.51%), Query Frame = 2
Query:   56 MNKNSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLPPIKVKVTGKK 1279
            MNKNSNDILINENYIVKRKDDSLCKATIIECRIST+NQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLPPIKVKVT  K
Sbjct:    1 MNKNSNDILINENYIVKRKDDSLCKATIIECRISTANQNEYFVHYHGNDRRLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEIYHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLPPIKVKVTEDK 408          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000049001.1 (SMESG000049001.1)

HSP 1 Score: 290.426 bits (742), Expect = 1.276e-93
Identity = 167/419 (39.86%), Postives = 232/419 (55.37%), Query Frame = 2
Query:  173 EYFVHYHGNDRRLDEWVPYENIDVN-----SKFEIKEESCSNLLALAT--ECSDGRLTRHQKRKINEIYHGRSIDEAP---------------MD--------------------SITLKLEKEHQAF-TRVKYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPNS-----------------SIEDISTATCISIDDIKSVLESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLP 1249
            EY+VH+   ++RLD+WV  + + ++     +K   K+ S ++L AL +  +CS+        ++   + +   ++ +                MD                    S+ +   +EHQ   TR++ I+ I  G   I+ WYFSPYPE+  +   ++ICE+CLKY K       H  +C  + PPG EIYRK  LS FEIDG + K Y QNLCLLAKLFLDHKTLYYD  PF+FY+LCE D EG H+VGYFSKEK S D+ N+ACILTLPP+QRKGYGK LI FSYEL+K+E   GSPEKPLSDLG LSYRSYW   I   ++D  NS                 S+ D+   T I+  D+ + L + N++  Y+  G+ + +  K ++   +    K+  +ID   L W P
Sbjct:   39 EYYVHFDEYNKRLDDWVSEDRMKMHEMVFPTKKIHKDSSTASLTALVSTNDCSNSPFGEANAQEAENVEYKIRLNSSTSSSALKNEDQMSLVTMDDRNCFSYLQEPVANVLPQTGSMMVTSHQEHQDIVTRMRNIDMIVLGKSRIKPWYFSPYPEELTELDAIFICEFCLKYFKSCFCLQRHLEKCRLRHPPGNEIYRKNPLSFFEIDGRKNKKYAQNLCLLAKLFLDHKTLYYDTDPFLFYILCEYDEEGFHIVGYFSKEKESNDDNNVACILTLPPYQRKGYGKLLIEFSYELSKLENKTGSPEKPLSDLGLLSYRSYWCQTIMEVIIDVANSADGAANSSSSAFDPPSISLNDVVEKTSINPKDLNATLNTMNII--YYSKGQHVIVVTKKMLDKFKASMAKRKYRIDAKLLNWHP 455          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.466e-71
Identity = 137/323 (42.41%), Postives = 188/323 (58.20%), Query Frame = 2
Query:  377 EAPMDSITLKLEKEHQAFTRV------KYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPN-------------------SSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKE---LQISRKSLIHYLENFNNKKP--IQIDKSCLKWLPPI 1255
            + P  SI   + +++  F  +      ++   I+ G + I+TWY +PYP +Y +   LYICEYCLK +K  D ++ H  +C    PPG EIYR  +LSVFE+DG   KLYCQ LCLLAKLFLDHKTLYYDV PF+FYV      +  H++GYFSKEK S   YNL+CI+ LPP+Q+  YG+FLI FSY L++ E   GSPEKPLS LG +SY SYW+  I  Y+L+  +                    +I+ +ST T IS  D+ S ++   L K       +   +Q   + L    E + ++ P  I ID+ CL+W+P I
Sbjct:  624 DPPELSIETHVPEDNSNFNNIDSSVNQRFPPRIQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILNKDDVTVDFYARQKIYKPSKGLAVTIDRVSTETGISPHDVASTIQL--LSKKVDLDNSDRISIQFDWEKLKSEAEKYASRYPKWIPIDEECLRWVPLI 944          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.742e-71
Identity = 137/323 (42.41%), Postives = 188/323 (58.20%), Query Frame = 2
Query:  377 EAPMDSITLKLEKEHQAFTRV------KYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPN-------------------SSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKE---LQISRKSLIHYLENFNNKKP--IQIDKSCLKWLPPI 1255
            + P  SI   + +++  F  +      ++   I+ G + I+TWY +PYP +Y +   LYICEYCLK +K  D ++ H  +C    PPG EIYR  +LSVFE+DG   KLYCQ LCLLAKLFLDHKTLYYDV PF+FYV      +  H++GYFSKEK S   YNL+CI+ LPP+Q+  YG+FLI FSY L++ E   GSPEKPLS LG +SY SYW+  I  Y+L+  +                    +I+ +ST T IS  D+ S ++   L K       +   +Q   + L    E + ++ P  I ID+ CL+W+P I
Sbjct:  626 DPPELSIETHVPEDNSNFNNIDSSVNQRFPPRIQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILNKDDVTVDFYARQKIYKPSKGLAVTIDRVSTETGISPHDVASTIQL--LSKKVDLDNSDRISIQFDWEKLKSEAEKYASRYPKWIPIDEECLRWVPLI 946          
BLAST of Histone acetyltransferase vs. Planmine SMEST
Match: SMESG000062900.1 (SMESG000062900.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.768e-71
Identity = 137/323 (42.41%), Postives = 188/323 (58.20%), Query Frame = 2
Query:  377 EAPMDSITLKLEKEHQAFTRV------KYIETIRYGTYEIETWYFSPYPEDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSVFEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHLVGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGSPEKPLSDLGWLSYRSYWEYVIFTYLLDYPN-------------------SSIEDISTATCISIDDIKSVLESHNLMKYYHRHGKE---LQISRKSLIHYLENFNNKKP--IQIDKSCLKWLPPI 1255
            + P  SI   + +++  F  +      ++   I+ G + I+TWY +PYP +Y +   LYICEYCLK +K  D ++ H  +C    PPG EIYR  +LSVFE+DG   KLYCQ LCLLAKLFLDHKTLYYDV PF+FYV      +  H++GYFSKEK S   YNL+CI+ LPP+Q+  YG+FLI FSY L++ E   GSPEKPLS LG +SY SYW+  I  Y+L+  +                    +I+ +ST T IS  D+ S ++   L K       +   +Q   + L    E + ++ P  I ID+ CL+W+P I
Sbjct:  624 DPPELSIETHVPEDNSNFNNIDSSVNQRFPPRIQIGRHVIDTWYSAPYPSEYARLNVLYICEYCLKPIKSYDVYVMHMQKCTFYFPPGNEIYRNGDLSVFEVDGYVSKLYCQQLCLLAKLFLDHKTLYYDVEPFLFYVAVISKNKSSHIIGYFSKEKRSTHKYNLSCIMVLPPYQKYNYGRFLIDFSYLLSRKEGQCGSPEKPLSILGRISYESYWKSKILPYILNKDDVTVDFYARQKIYKPSKGLAVTIDRVSTETGISPHDVASTIQL--LSKKVDLDNSDRISIQFDWEKLKSEAEKYASRYPKWIPIDEECLRWVPLI 944          
The following BLAST results are available for this feature:
BLAST of Histone acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KAT82.410e-14252.78lysine acetyltransferase 8 [Source:HGNC Symbol;Acc... [more]
KAT82.410e-14252.78lysine acetyltransferase 8 [Source:HGNC Symbol;Acc... [more]
KAT81.797e-13652.62lysine acetyltransferase 8 [Source:HGNC Symbol;Acc... [more]
KAT73.833e-10353.13lysine acetyltransferase 7 [Source:HGNC Symbol;Acc... [more]
KAT74.383e-10353.13lysine acetyltransferase 7 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mys-24.982e-9439.73Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
mys-25.960e-9439.73Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
mys-12.784e-9341.75Histone acetyltransferase Tip60 homolog [Source:U... [more]
lsy-121.563e-6238.81Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
lsy-121.563e-6238.81Histone acetyltransferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mof4.784e-11541.87gene:FBgn0014340 transcript:FBtr0070829[more]
Tip601.504e-9351.59gene:FBgn0026080 transcript:FBtr0070668[more]
Tip601.504e-9351.59gene:FBgn0026080 transcript:FBtr0333186[more]
enok1.060e-8851.07gene:FBgn0034975 transcript:FBtr0343339[more]
enok1.060e-8851.07gene:FBgn0034975 transcript:FBtr0072250[more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat86.205e-14052.14K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
kat86.205e-14052.14K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
kat86.205e-14052.14K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
kat82.394e-13448.94K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
kat87.308e-13147.38K(lysine) acetyltransferase 8 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat82.143e-13952.02K(lysine) acetyltransferase 8 [Source:NCBI gene;Ac... [more]
kat89.262e-13552.09K(lysine) acetyltransferase 8 [Source:NCBI gene;Ac... [more]
kat83.699e-13452.09K(lysine) acetyltransferase 8 [Source:NCBI gene;Ac... [more]
kat71.723e-10153.13lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
kat72.226e-10153.13lysine acetyltransferase 7 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kat81.691e-14252.78K(lysine) acetyltransferase 8 [Source:MGI Symbol;A... [more]
Kat73.498e-10253.13K(lysine) acetyltransferase 7 [Source:MGI Symbol;A... [more]
Kat78.548e-10253.13K(lysine) acetyltransferase 7 [Source:MGI Symbol;A... [more]
Kat78.826e-10253.13K(lysine) acetyltransferase 7 [Source:MGI Symbol;A... [more]
Kat79.965e-10253.13K(lysine) acetyltransferase 7 [Source:MGI Symbol;A... [more]
back to top
BLAST of Histone acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H7Z6|KAT8_HUMAN1.157e-14152.78Histone acetyltransferase KAT8 OS=Homo sapiens OX=... [more]
sp|Q9D1P2|KAT8_MOUSE1.183e-14152.78Histone acetyltransferase KAT8 OS=Mus musculus OX=... [more]
sp|Q5XI06|KAT8_RAT1.348e-14152.78Histone acetyltransferase KAT8 OS=Rattus norvegicu... [more]
sp|Q8LI34|MYST1_ORYSJ8.429e-11646.95Putative MYST-like histone acetyltransferase 1 OS=... [more]
sp|O02193|MOF_DROME4.796e-11441.87Males-absent on the first protein OS=Drosophila me... [more]
back to top
BLAST of Histone acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NS704.700e-16457.52Histone acetyltransferase OS=Schistocephalus solid... [more]
A0A0X3PHZ09.929e-16357.52Histone acetyltransferase (Fragment) OS=Schistocep... [more]
A0A0R3UEN42.479e-16257.25Histone acetyltransferase OS=Mesocestoides corti O... [more]
A0A0R3X7351.993e-15955.23Histone acetyltransferase OS=Hydatigena taeniaefor... [more]
A0A068Y9X67.804e-15855.93Histone acetyltransferase OS=Echinococcus multiloc... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat84.390e-13751.39lysine acetyltransferase 8 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000046538.13.467e-10153.66histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
kat7b4.005e-10152.43histone acetyltransferase KAT7-like [Source:NCBI g... [more]
kat7b5.222e-10152.43histone acetyltransferase KAT7-like [Source:NCBI g... [more]
ENSAMXT00000046151.17.279e-10153.66histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kat7b3.005e-9853.85K(lysine) acetyltransferase 7b [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000007004.15.896e-9758.61pep scaffold:Pmarinus_7.0:GL480995:3484:21994:1 ge... [more]
kat5b9.335e-9149.16K(lysine) acetyltransferase 5b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ESA12.669e-8636.32Catalytic subunit of the histone acetyltransferase... [more]
SAS36.076e-6753.52Histone acetyltransferase catalytic subunit of NuA... [more]
SAS21.019e-4335.62Histone acetyltransferase (HAT) catalytic subunit ... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO398846.971e-14452.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349342.816e-8749.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397381.127e-5267.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO290092.277e-2545.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397392.631e-2048.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kat84.974e-13851.39lysine acetyltransferase 8 [Source:NCBI gene;Acc:1... [more]
kat88.848e-13851.39lysine acetyltransferase 8 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000020927.24.618e-10253.31histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
ENSORLT00000029109.11.268e-10153.31histone acetyltransferase KAT7 [Source:NCBI gene;A... [more]
kat7b7.398e-10153.99lysine acetyltransferase 7 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Histone acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040171.10.000e+099.26SMESG000040171.1[more]
SMESG000049001.11.276e-9339.86SMESG000049001.1[more]
SMESG000062900.12.466e-7142.41SMESG000062900.1[more]
SMESG000062900.12.742e-7142.41SMESG000062900.1[more]
SMESG000062900.12.768e-7142.41SMESG000062900.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005691 ID=SMED30005691|Name=Histone acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1304bp
ATATAAATCTTATATGTTATAAAAGTTTGTATCTTCAGTCTACGTATATT
AAAATATGAATAAGAACTCGAATGATATTCTTATTAACGAAAATTATATT
GTTAAACGAAAAGATGATAGTTTATGTAAAGCAACAATTATTGAATGTCG
AATCTCCACATCAAATCAGAATGAATATTTTGTCCATTATCATGGCAACG
ATCGTCGTCTTGATGAATGGGTTCCCTACGAAAACATCGATGTTAACTCA
AAATTTGAAATTAAAGAAGAATCTTGTTCAAATTTATTAGCTTTGGCAAC
CGAATGCAGTGACGGGAGATTAACTCGACATCAAAAGAGAAAAATTAATG
AAATTTATCATGGCCGATCCATAGATGAAGCTCCGATGGATTCAATAACA
TTGAAATTGGAAAAGGAGCATCAAGCCTTTACTAGAGTGAAATATATTGA
AACCATTCGGTATGGAACATATGAAATAGAGACATGGTATTTTTCTCCCT
ATCCAGAAGATTATCGAAAATTTCAGAAATTGTACATCTGTGAGTATTGT
CTGAAATATATGAAATTAGAGGACTCGTTTTTGTGCCATCAATCACAATG
CCCACAAAAACAGCCTCCTGGAAAAGAAATTTACCGCAAGGAAAATTTAT
CTGTTTTTGAAATTGATGGCAATGAAAAGAAACTTTATTGCCAAAACCTT
TGTTTATTGGCCAAATTATTTCTGGATCACAAAACGTTATATTATGATGT
TGCCCCTTTTATGTTTTATGTACTGTGTGAAGTCGACAGAGAAGGTTGTC
ATTTGGTTGGTTATTTTTCCAAGGAAAAGATATCAATTGATAACTATAAT
CTCGCATGCATTTTAACTCTTCCCCCATTTCAAAGAAAAGGTTATGGAAA
GTTTTTGATCGCTTTTAGCTACGAATTAGCCAAAATTGAGAAAATGATTG
GAAGTCCTGAAAAGCCTTTGTCAGATCTCGGTTGGCTGAGTTACCGCAGC
TATTGGGAATATGTAATATTCACTTATTTGTTGGATTATCCAAACAGTAG
TATCGAAGATATCAGTACCGCGACCTGTATTTCAATTGATGACATCAAAA
GTGTTCTGGAAAGTCACAATTTGATGAAATATTATCACAGACACGGAAAG
GAGTTGCAAATTAGCCGCAAATCATTGATTCATTATTTAGAAAACTTCAA
TAACAAAAAGCCAATCCAGATAGATAAATCATGCCTCAAGTGGTTGCCAC
CGATTAAAGTTAAAGTTACAGGTAAAAAATAAAAATTTCATGTTGTACAT
TAAT
back to top

protein sequence of SMED30005691-orf-1

>SMED30005691-orf-1 ID=SMED30005691-orf-1|Name=SMED30005691-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MNKNSNDILINENYIVKRKDDSLCKATIIECRISTSNQNEYFVHYHGNDR
RLDEWVPYENIDVNSKFEIKEESCSNLLALATECSDGRLTRHQKRKINEI
YHGRSIDEAPMDSITLKLEKEHQAFTRVKYIETIRYGTYEIETWYFSPYP
EDYRKFQKLYICEYCLKYMKLEDSFLCHQSQCPQKQPPGKEIYRKENLSV
FEIDGNEKKLYCQNLCLLAKLFLDHKTLYYDVAPFMFYVLCEVDREGCHL
VGYFSKEKISIDNYNLACILTLPPFQRKGYGKFLIAFSYELAKIEKMIGS
PEKPLSDLGWLSYRSYWEYVIFTYLLDYPNSSIEDISTATCISIDDIKSV
LESHNLMKYYHRHGKELQISRKSLIHYLENFNNKKPIQIDKSCLKWLPPI
KVKVTGKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0072487MSL complex
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR040706Zf-MYST
IPR036388WH-like_DNA-bd_sf
IPR037906KAT8
IPR002717HAT_MYST-type
IPR025995Tudor-knot
IPR016181Acyl_CoA_acyltransferase
IPR016197Chromo-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0016573histone acetylation
Vocabulary: molecular function
TermDefinition
GO:0016747transferase activity, transferring acyl groups other than amino-acyl groups
GO:0004402histone acetyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 185..398
e-value: 1.1E-89
score: 301.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 1..125
e-value: 6.6E-25
score: 89.8
NoneNo IPR availableGENE3DG3DSA:3.30.60.60coord: 126..183
e-value: 1.5E-24
score: 87.0
NoneNo IPR availablePANTHERPTHR10615HISTONE ACETYLTRANSFERASEcoord: 2..403
NoneNo IPR availableCDDcd18984CBD_MOF_likecoord: 14..56
e-value: 7.62268E-9
score: 49.8627
NoneNo IPR availableCDDcd04301NAT_SFcoord: 237..293
e-value: 8.68859E-4
score: 35.3293
IPR002717Histone acetyltransferase domain, MYST-typePFAMPF01853MOZ_SAScoord: 187..361
e-value: 8.6E-82
score: 273.1
IPR002717Histone acetyltransferase domain, MYST-typePROSITEPS51726MYST_HATcoord: 126..398
score: 67.76
IPR040706MYST, zinc finger domainPFAMPF17772zf-MYSTcoord: 128..182
e-value: 1.4E-21
score: 75.8
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 305..376
e-value: 1.1E-89
score: 301.3
IPR025995RNA binding activity-knot of a chromodomainPFAMPF11717Tudor-knotcoord: 10..62
e-value: 2.4E-15
score: 56.1
IPR037906Histone acetyltransferase KAT8PANTHERPTHR10615:SF82HISTONE ACETYLTRANSFERASE KAT8coord: 2..403
IPR016197Chromo-like domain superfamilySUPERFAMILYSSF54160Chromo domain-likecoord: 7..127
IPR016181Acyl-CoA N-acyltransferaseSUPERFAMILYSSF55729Acyl-CoA N-acyltransferases (Nat)coord: 129..396