Nkap_C domain-containing protein

Overview
NameNkap_C domain-containing protein
Smed IDSMED30005681
Length (bp)940
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nkap_C domain-containing protein (SMED30005681) t-SNE clustered cells

Violin plots show distribution of expression levels for Nkap_C domain-containing protein (SMED30005681) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nkap_C domain-containing protein (SMED30005681) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nkap_C domain-containing protein (SMED30005681) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005681

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005681SMESG000023380.1 SmedASXL_010227SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30005681SMESG000023380.1 dd_Smed_v4_6988_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v4_6988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005681SMESG000047456.1 SMESG000047455.1 dd_Smed_v6_6988_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Match: NKAP (NFKB activating protein [Source:HGNC Symbol;Acc:HGNC:29873])

HSP 1 Score: 147.517 bits (371), Expect = 1.714e-40
Identity = 75/132 (56.82%), Postives = 96/132 (72.73%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR +
Sbjct:  272 FLENPWKDRTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREM 403          
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Match: NKAP (NFKB activating protein [Source:HGNC Symbol;Acc:HGNC:29873])

HSP 1 Score: 147.132 bits (370), Expect = 2.020e-40
Identity = 75/132 (56.82%), Postives = 96/132 (72.73%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR +
Sbjct:  273 FLENPWKDRTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREM 404          
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Match: NKAPL (NFKB activating protein like [Source:HGNC Symbol;Acc:HGNC:21584])

HSP 1 Score: 144.05 bits (362), Expect = 2.928e-39
Identity = 71/119 (59.66%), Postives = 88/119 (73.95%), Query Frame = 2
Query:  401 IKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            + ++ ++IGP+ P     +    + +G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  271 VADTMDLIGPEAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILASFR 389          
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 52.373 bits (124), Expect = 2.442e-7
Identity = 21/38 (55.26%), Postives = 32/38 (84.21%), Query Frame = -1
Query:  821 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 934
            PP ++YL+ IDQ+++ Q IE++EV++G ETNN Y+IKN
Sbjct:   96 PPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKN 133          
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Match: PLSCR1 (phospholipid scramblase 1 [Source:HGNC Symbol;Acc:HGNC:9092])

HSP 1 Score: 52.7582 bits (125), Expect = 2.931e-7
Identity = 21/38 (55.26%), Postives = 32/38 (84.21%), Query Frame = -1
Query:  821 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 934
            PP ++YL+ IDQ+++ Q IE++EV++G ETNN Y+IKN
Sbjct:   89 PPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKN 126          
BLAST of Nkap_C domain-containing protein vs. Ensembl Celegans
Match: let-504 (pep chromosome:WBcel235:I:4129469:4132292:-1 gene:WBGene00002696.1 transcript:E01A2.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-504)

HSP 1 Score: 115.546 bits (288), Expect = 8.956e-29
Identity = 65/138 (47.10%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  404 KNSDEIIGP--QIPEGLI---PKLPSHM---------------DFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            K S++I+G      EG +   P LP H+               ++GK LL GEGA MAAY A  +RIPRRGEIG++S +I ++E +GYVMSGSRH  MEA R+RKENQ+++A+EKRIL +++     KKE   L+ FR
Sbjct:  357 KQSEKIVGTIGTWKEGSMSPTPILPEHIKQRDQGGGYDVEKPGNYGKDLLKGEGAGMAAYAARGERIPRRGEIGLSSGEIAEYEKVGYVMSGSRHKAMEATRLRKENQVFTAEEKRILNSVSVEAKKKKEEAVLDQFR 494          
BLAST of Nkap_C domain-containing protein vs. Ensembl Celegans
Match: let-504 (pep chromosome:WBcel235:I:4129567:4132224:-1 gene:WBGene00002696.1 transcript:E01A2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:let-504)

HSP 1 Score: 115.546 bits (288), Expect = 8.956e-29
Identity = 65/138 (47.10%), Postives = 88/138 (63.77%), Query Frame = 2
Query:  404 KNSDEIIGP--QIPEGLI---PKLPSHM---------------DFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            K S++I+G      EG +   P LP H+               ++GK LL GEGA MAAY A  +RIPRRGEIG++S +I ++E +GYVMSGSRH  MEA R+RKENQ+++A+EKRIL +++     KKE   L+ FR
Sbjct:  357 KQSEKIVGTIGTWKEGSMSPTPILPEHIKQRDQGGGYDVEKPGNYGKDLLKGEGAGMAAYAARGERIPRRGEIGLSSGEIAEYEKVGYVMSGSRHKAMEATRLRKENQVFTAEEKRILNSVSVEAKKKKEEAVLDQFR 494          
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Match: CG6066 (gene:FBgn0039488 transcript:FBtr0085131)

HSP 1 Score: 147.902 bits (372), Expect = 1.078e-40
Identity = 76/118 (64.41%), Postives = 93/118 (78.81%), Query Frame = 2
Query:  407 NSDEIIGPQI-PEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++DE +GP + P G +    +  DFGKALLPGEGAAMAAYIA+ KRIPRRGEIG+TS++I  FES+GYVMSGSRH RMEAVRIRKENQ+YSADEKR LA  ++ E  K+E + L  F+
Sbjct:  337 HNDEDVGPSLRPGGSL----NQKDFGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSDEIANFESVGYVMSGSRHRRMEAVRIRKENQLYSADEKRALAMFSKEERQKRENKILSQFK 450          
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076302)

HSP 1 Score: 50.447 bits (119), Expect = 4.469e-7
Identity = 20/40 (50.00%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            P  ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +
Sbjct:   11 PRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL 50          
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076303)

HSP 1 Score: 51.2174 bits (121), Expect = 5.244e-7
Identity = 20/40 (50.00%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            P  ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +
Sbjct:  110 PRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL 149          
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Match: scramb1 (gene:FBgn0052056 transcript:FBtr0076301)

HSP 1 Score: 50.8322 bits (120), Expect = 6.962e-7
Identity = 19/37 (51.35%), Postives = 29/37 (78.38%), Query Frame = -1
Query:  815 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 925
            ++YLT IDQL+V+Q +E++E  +G ETNN + IKN +
Sbjct:  197 LEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNAL 233          
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Match: scramb2 (gene:FBgn0035390 transcript:FBtr0073005)

HSP 1 Score: 49.6766 bits (117), Expect = 1.124e-6
Identity = 20/38 (52.63%), Postives = 30/38 (78.95%), Query Frame = -1
Query:  821 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 934
            P  ++YLTA+DQL+V Q IE +E+++G ET N +K+KN
Sbjct:   52 PQGLEYLTALDQLLVSQKIEKLELLTGFETKNRFKVKN 89          
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Match: nkap (NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-030131-8064])

HSP 1 Score: 144.821 bits (364), Expect = 1.829e-40
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  410 SDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
             + ++GP  P   + +    +DFG ALLPGEGAAMA ++   KRIPRRGEIG+TS +I +FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  200 GEHVVGPDAPLTHLSQDDKPLDFGHALLPGEGAAMAEFVKAGKRIPRRGEIGLTSNEIAEFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILSSFR 315          
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Match: nkap (NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-030131-8064])

HSP 1 Score: 144.436 bits (363), Expect = 6.595e-40
Identity = 70/116 (60.34%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  410 SDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
             + ++GP  P   + +    +DFG ALLPGEGAAMA ++   KRIPRRGEIG+TS +I +FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  240 GEHVVGPDAPLTHLSQDDKPLDFGHALLPGEGAAMAEFVKAGKRIPRRGEIGLTSNEIAEFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILSSFR 355          
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Match: plscr3a (phospholipid scramblase 3a [Source:ZFIN;Acc:ZDB-GENE-060531-17])

HSP 1 Score: 53.5286 bits (127), Expect = 6.207e-8
Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQ++V Q IE++E I G ETNN Y+IKN M
Sbjct:   12 PPGLEYLTQIDQILVHQKIELLEAIIGFETNNQYEIKNSM 51          
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 53.1434 bits (126), Expect = 8.366e-8
Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQL+V+Q +E+ EVI G ETNN Y +KN M
Sbjct:   12 PPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSM 51          
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-71m22.1 (si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-193])

HSP 1 Score: 53.1434 bits (126), Expect = 8.366e-8
Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQL+V+Q +E+ EVI G ETNN Y +KN M
Sbjct:   12 PPGLEYLTQIDQLLVQQKVELAEVILGWETNNKYIVKNSM 51          
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Match: nkap (NFKB activating protein [Source:NCBI gene;Acc:448165])

HSP 1 Score: 139.813 bits (351), Expect = 1.792e-38
Identity = 69/114 (60.53%), Postives = 85/114 (74.56%), Query Frame = 2
Query:  416 EIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            E +GP+ P   + +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TS++I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  F+
Sbjct:  202 EFVGPEAPITHLSQDDRPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSDEIASFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILSSFK 315          
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Match: nkap (NFKB activating protein [Source:NCBI gene;Acc:448165])

HSP 1 Score: 140.584 bits (353), Expect = 1.884e-38
Identity = 69/114 (60.53%), Postives = 85/114 (74.56%), Query Frame = 2
Query:  416 EIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            E +GP+ P   + +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TS++I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  F+
Sbjct:  231 EFVGPEAPITHLSQDDRPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSDEIASFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILSSFK 344          
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 54.299 bits (129), Expect = 8.463e-8
Identity = 22/40 (55.00%), Postives = 33/40 (82.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQ++V Q +E++EV++G ETNN Y+IKN +
Sbjct:  103 PPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSL 142          
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Match: insyn1 (inhibitory synaptic factor 1 [Source:Xenbase;Acc:XB-GENE-5931898])

HSP 1 Score: 54.299 bits (129), Expect = 8.866e-8
Identity = 22/40 (55.00%), Postives = 33/40 (82.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQ++V Q +E++EV++G ETNN Y+IKN +
Sbjct:  108 PPGLEYLTQIDQILVHQQVELLEVLTGFETNNKYEIKNSL 147          
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000012543.1 (phospholipid scramblase 2 [Source:NCBI gene;Acc:100489273])

HSP 1 Score: 53.1434 bits (126), Expect = 1.834e-7
Identity = 21/40 (52.50%), Postives = 33/40 (82.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YL+ IDQ++V Q +E++EV++G ETNN Y+IKN +
Sbjct:   68 PPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSL 107          
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Match: Nkap (NFKB activating protein [Source:MGI Symbol;Acc:MGI:1914300])

HSP 1 Score: 147.517 bits (371), Expect = 1.138e-40
Identity = 75/130 (57.69%), Postives = 95/130 (73.08%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR
Sbjct:  273 FLENPWKDRSKAEEPSDLIGPEAPKTLASQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFR 402          
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Match: Nkapl (NFKB activating protein-like [Source:MGI Symbol;Acc:MGI:1913957])

HSP 1 Score: 141.739 bits (356), Expect = 1.024e-38
Identity = 72/116 (62.07%), Postives = 86/116 (74.14%), Query Frame = 2
Query:  410 SDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            S ++IGP+ P     +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR
Sbjct:  267 SMDLIGPEAPVIHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFR 382          
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 51.6026 bits (122), Expect = 4.295e-7
Identity = 20/43 (46.51%), Postives = 34/43 (79.07%), Query Frame = -1
Query:  806 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIMYKI 934
            PP ++YL  IDQL++ Q +E++EV++G ETNN ++IKN + ++
Sbjct:   94 PPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQM 136          
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Match: Plscr2 (phospholipid scramblase 2 [Source:MGI Symbol;Acc:MGI:1270860])

HSP 1 Score: 51.6026 bits (122), Expect = 4.295e-7
Identity = 20/43 (46.51%), Postives = 34/43 (79.07%), Query Frame = -1
Query:  806 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIMYKI 934
            PP ++YL  IDQL++ Q +E++EV++G ETNN ++IKN + ++
Sbjct:   94 PPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQM 136          
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Match: Plscr1 (phospholipid scramblase 1 [Source:MGI Symbol;Acc:MGI:893575])

HSP 1 Score: 50.8322 bits (120), Expect = 8.976e-7
Identity = 21/37 (56.76%), Postives = 30/37 (81.08%), Query Frame = -1
Query:  815 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 925
            ++YL  IDQL+V Q IE++EV++G ETNN Y+IKN +
Sbjct:  108 LEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSL 144          
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D0F4|NKAP_MOUSE (NF-kappa-B-activating protein OS=Mus musculus OX=10090 GN=Nkap PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 7.959e-40
Identity = 75/130 (57.69%), Postives = 95/130 (73.08%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR
Sbjct:  273 FLENPWKDRSKAEEPSDLIGPEAPKTLASQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFR 402          
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4V7C9|NKAP_RAT (NF-kappa-B-activating protein OS=Rattus norvegicus OX=10116 GN=Nkap PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.561e-40
Identity = 75/132 (56.82%), Postives = 96/132 (72.73%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR +
Sbjct:  273 FLENPWKDRSKTEEPSDLIGPEAPKTLASQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREM 404          
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8N5F7|NKAP_HUMAN (NF-kappa-B-activating protein OS=Homo sapiens OX=9606 GN=NKAP PE=1 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 9.699e-40
Identity = 75/132 (56.82%), Postives = 96/132 (72.73%), Query Frame = 2
Query:  371 FIES-MKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            F+E+  K + + +   ++IGP+ P+ L  +    +++G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E + L  FR +
Sbjct:  273 FLENPWKDRTKAEEPSDLIGPEAPKTLTSQDDKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREM 404          
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VB74|NKAP_DROME (NKAP family protein CG6066 OS=Drosophila melanogaster OX=7227 GN=CG6066 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.080e-39
Identity = 76/118 (64.41%), Postives = 93/118 (78.81%), Query Frame = 2
Query:  407 NSDEIIGPQI-PEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++DE +GP + P G +    +  DFGKALLPGEGAAMAAYIA+ KRIPRRGEIG+TS++I  FES+GYVMSGSRH RMEAVRIRKENQ+YSADEKR LA  ++ E  K+E + L  F+
Sbjct:  337 HNDEDVGPSLRPGGSL----NQKDFGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSDEIANFESVGYVMSGSRHRRMEAVRIRKENQLYSADEKRALAMFSKEERQKRENKILSQFK 450          
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5M9Q1|NKAPL_HUMAN (NKAP-like protein OS=Homo sapiens OX=9606 GN=NKAPL PE=1 SV=3)

HSP 1 Score: 144.05 bits (362), Expect = 1.406e-38
Identity = 71/119 (59.66%), Postives = 88/119 (73.95%), Query Frame = 2
Query:  401 IKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            + ++ ++IGP+ P     +    + +G ALLPGEGAAMA Y+   KRIPRRGEIG+TSE+I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  271 VADTMDLIGPEAPIIHTSQDEKPLKYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSEEIGSFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILASFR 389          
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Match: T1EDY4 (Nkap_C domain-containing protein OS=Helobdella robusta OX=6412 GN=20194786 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.626e-44
Identity = 83/132 (62.88%), Postives = 101/132 (76.52%), Query Frame = 2
Query:  371 FIESMKKKHEIKNSDEIIGPQIPEGLIPKLP-SHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            F+   KKK ++ N  E++GP+ PE +I     + MDFGKALLPGEGAAMAAYIA+ KRIPRRGEIG+TS +I +FE +GYVMSGSRH RMEAVR+RKENQIYSADEKR LA  N  E +KKE   L  F+++
Sbjct:  134 FVWVEKKKPKLNNETEVVGPE-PENVIEAGGLTRMDFGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSNEIQEFEDVGYVMSGSRHRRMEAVRLRKENQIYSADEKRALAKFNHEERMKKEGHILTQFKQL 264          
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Match: A0A0R3T546 (Nkap_C domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2183 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 4.406e-44
Identity = 83/143 (58.04%), Postives = 106/143 (74.13%), Query Frame = 2
Query:  353 DEEEQNFIESMK--------KKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++E ++FI  MK        K+ E + + +IIGP +P          +D+GKALLPGEGAAMAAYIA+ KRIPRRGEIG+TSE+I++FES+GYVMSGSRH+RMEAVR+RKENQIYSADEKR L + N TE  K+EA+    F+
Sbjct:  171 EDEAKSFIRQMKQKKAEIERKRQEEEEATDIIGPVLPGQSADAANQRIDYGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSEEIEKFESVGYVMSGSRHHRMEAVRLRKENQIYSADEKRALESFNHTERAKREAKLQAQFK 313          
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Match: A0A0R3SSN6 (Nkap_C domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8328 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 3.359e-43
Identity = 82/143 (57.34%), Postives = 106/143 (74.13%), Query Frame = 2
Query:  353 DEEEQNFIESMK--------KKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++E ++FI  MK        K+ E + + +IIGP +P          +D+GKALLPGEGAAMAAYIA+ KRIPRRGEIG+TS++I++FES+GYVMSGSRH+RMEAVR+RKENQIYSADEKR L + N TE  K+EA+    F+
Sbjct:  165 EDEAKSFIRQMKQKKAELERKRQEEEEATDIIGPVLPGQNADAANQRIDYGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSDEIEKFESVGYVMSGSRHHRMEAVRLRKENQIYSADEKRALESFNHTERAKREAKLQAQFK 307          
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Match: R7T804 (Nkap_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171424 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.133e-42
Identity = 79/122 (64.75%), Postives = 92/122 (75.41%), Query Frame = 2
Query:  401 IKNSDEIIGPQIPEGLIP-KLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            I N  E+ GP +PE  I  K+ + +D+GKALLPGEGAAMAAYIAD KRIPRRGEIG+TS +I  FE  GYVMSGSRH RMEAVR+RKENQ+YSADEKR LA  N  E  K+E + L  FR +
Sbjct:   76 ISNETEVCGP-MPEIEISDKIKTQLDYGKALLPGEGAAMAAYIADGKRIPRRGEIGLTSNEITSFEDTGYVMSGSRHRRMEAVRLRKENQVYSADEKRALANFNHEERTKRENKILSQFREL 196          
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Match: A0A0R3UFQ5 (Nkap_C domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5971 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 1.978e-42
Identity = 83/144 (57.64%), Postives = 106/144 (73.61%), Query Frame = 2
Query:  353 DEEEQNFIESMK--------KKHEIKNSDEIIGPQIPEGLIPKLPSH-MDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++E ++FI  MK        K+ E + + EIIGP +P     +  +  +D+GKALLPGEGAAMAAYIA+ KRIPRRGEIG+TSE+I++FE  GYVMSGSRH+RMEAVR+RKENQIYSADEKR L + N TE  K+EA+    F+
Sbjct:  170 EDEARSFIRQMKAKKAELERKRQEEEQATEIIGPVLPGANGAESSAQRLDYGKALLPGEGAAMAAYIAEGKRIPRRGEIGLTSEEIEKFEKSGYVMSGSRHHRMEAVRLRKENQIYSADEKRALESFNHTERAKREAKLQAQFK 313          
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Match: NKAP (NFKB activating protein [Source:HGNC Symbol;Acc:HGNC:29873])

HSP 1 Score: 145.976 bits (367), Expect = 1.162e-40
Identity = 71/113 (62.83%), Postives = 86/113 (76.11%), Query Frame = 2
Query:  419 IIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            ++GP+ P   + +    +DFG ALLPGEGAAMA Y+   KRIPRRGEIG+TS++I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  234 VVGPEAPLTHMSQDDRPLDFGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSDEIADFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILSSFR 346          
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 52.373 bits (124), Expect = 1.473e-7
Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQL+V Q IE+ EVI G ETNN Y +KN +
Sbjct:   49 PPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTL 88          
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-71m22.1 (phospholipid scramblase 1-like [Source:NCBI gene;Acc:103030773])

HSP 1 Score: 52.7582 bits (125), Expect = 1.494e-7
Identity = 24/40 (60.00%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQL+V Q IE+ EVI G ETNN Y +KN +
Sbjct:   49 PPGLEYLTQIDQLLVHQKIELAEVILGWETNNKYLVKNTL 88          
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 51.9878 bits (123), Expect = 2.646e-7
Identity = 21/40 (52.50%), Postives = 31/40 (77.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN M
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSM 141          
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Match: plscr3b (phospholipid scramblase 2-like [Source:NCBI gene;Acc:103046260])

HSP 1 Score: 51.9878 bits (123), Expect = 2.646e-7
Identity = 21/40 (52.50%), Postives = 31/40 (77.50%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT IDQ+++ Q +E++E I G ETNN Y++KN M
Sbjct:  102 PPGLEYLTQIDQVLIHQKVELLEAIIGFETNNQYEVKNSM 141          
BLAST of Nkap_C domain-containing protein vs. Ensembl Sea Lamprey
Match: nkap (NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-030131-8064])

HSP 1 Score: 140.584 bits (353), Expect = 1.553e-39
Identity = 72/122 (59.02%), Postives = 87/122 (71.31%), Query Frame = 2
Query:  392 KHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            K   +N++  IGP  P   +      M++G ALLPGEGAAMA ++   KRIPRRGEIG+TS++I  FES GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ N+ E  K+E   L  FR
Sbjct:  201 KQRSENAEFFIGPLPPLSAMDGGDRPMNYGHALLPGEGAAMAEFVKAGKRIPRRGEIGLTSDEIASFESQGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNKEERSKRENRILAGFR 322          
BLAST of Nkap_C domain-containing protein vs. Ensembl Sea Lamprey
Match: nkap (NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-030131-8064])

HSP 1 Score: 140.969 bits (354), Expect = 2.184e-39
Identity = 72/124 (58.06%), Postives = 88/124 (70.97%), Query Frame = 2
Query:  392 KHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            K   +N++  IGP  P   +      M++G ALLPGEGAAMA ++   KRIPRRGEIG+TS++I  FES GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ N+ E  K+E   L  FR +
Sbjct:  236 KQRSENAEFFIGPLPPLSAMDGGDRPMNYGHALLPGEGAAMAEFVKAGKRIPRRGEIGLTSDEIASFESQGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNKEERSKRENRILAGFREM 359          
BLAST of Nkap_C domain-containing protein vs. Ensembl Sea Lamprey
Match: nkap (NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-030131-8064])

HSP 1 Score: 140.584 bits (353), Expect = 2.579e-39
Identity = 72/122 (59.02%), Postives = 87/122 (71.31%), Query Frame = 2
Query:  392 KHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            K   +N++  IGP  P   +      M++G ALLPGEGAAMA ++   KRIPRRGEIG+TS++I  FES GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ N+ E  K+E   L  FR
Sbjct:  223 KQRSENAEFFIGPLPPLSAMDGGDRPMNYGHALLPGEGAAMAEFVKAGKRIPRRGEIGLTSDEIASFESQGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNKEERSKRENRILAGFR 344          
BLAST of Nkap_C domain-containing protein vs. Ensembl Nematostella
Match: EDO43491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYN3])

HSP 1 Score: 130.183 bits (326), Expect = 5.065e-38
Identity = 65/96 (67.71%), Postives = 73/96 (76.04%), Query Frame = 2
Query:  476 FGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            FG ALLPGEG AMA Y+   KRIPRRGEIG+TS++I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA  N  E  K+E + L  FR +
Sbjct:    1 FGGALLPGEGEAMAEYVKAGKRIPRRGEIGLTSDEIATFEDQGYVMSGSRHRRMEAVRLRKENQIYSADEKRALAMFNYEERSKRENKILSDFREL 96          
BLAST of Nkap_C domain-containing protein vs. Ensembl Nematostella
Match: EDO46109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR56])

HSP 1 Score: 48.1358 bits (113), Expect = 3.063e-6
Identity = 18/35 (51.43%), Postives = 28/35 (80.00%), Query Frame = -1
Query:  821 IDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 925
            ++YLT +DQL+++Q +E++E  +G ETNN YKI N
Sbjct:   87 LEYLTMVDQLLIKQQVELLEAFTGFETNNKYKITN 121          
BLAST of Nkap_C domain-containing protein vs. Ensembl Medaka
Match: NKAPL (NFKB activating protein [Source:NCBI gene;Acc:101160419])

HSP 1 Score: 144.436 bits (363), Expect = 1.173e-39
Identity = 72/115 (62.61%), Postives = 86/115 (74.78%), Query Frame = 2
Query:  413 DEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFR 757
            + I+GP+ P   + +    +DFG ALLPGEGAAMA Y+   KRIPRRGEIG+TS +I  FE  GYVMSGSRH RMEAVR+RKENQIYSADEKR LA+ NQ E  K+E++ L  FR
Sbjct:  279 EHIVGPEAPLTHMSQDERPLDFGHALLPGEGAAMAEYVKAGKRIPRRGEIGLTSNEIADFEKSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRESKILSSFR 393          
BLAST of Nkap_C domain-containing protein vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 48.9062 bits (115), Expect = 2.931e-6
Identity = 19/38 (50.00%), Postives = 28/38 (73.68%), Query Frame = -1
Query:  821 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 934
            PP ++YL  IDQ+++ Q +E++E   G ETNN Y+IKN
Sbjct:   68 PPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKN 105          
BLAST of Nkap_C domain-containing protein vs. Ensembl Medaka
Match: plscr3b (phospholipid scramblase 2 [Source:NCBI gene;Acc:101157328])

HSP 1 Score: 48.9062 bits (115), Expect = 2.931e-6
Identity = 19/38 (50.00%), Postives = 28/38 (73.68%), Query Frame = -1
Query:  821 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKN 934
            PP ++YL  IDQ+++ Q +E++E   G ETNN Y+IKN
Sbjct:   68 PPGLEYLAQIDQILIHQKVELLEAFIGFETNNQYEIKN 105          
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Match: SMESG000023380.1 (SMESG000023380.1)

HSP 1 Score: 382.489 bits (981), Expect = 1.779e-134
Identity = 248/250 (99.20%), Postives = 249/250 (99.60%), Query Frame = 2
Query:   14 MGHNXXXXXXXXXXXXXXXXXXXCYKESDSYSRSDYWERRRLQRIRIETTSNSKFWVRSPEPDPLYFNIIHINDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDEEEQNFIESMKKKHEIKNSDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 763
            MGHNRKRTSSSGSSSEYKRSKLSCYKESDSYSRSDYWERRRLQRIRIETTSNSKFWVRSPEPDPLYFNIIHINDEKK KKNKKNRKHSRSHVQKVSKKKSKKSNKKKHSSSSLDEEEQNFIESMKKKHEIKN+DEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV
Sbjct:    1 MGHNRKRTSSSGSSSEYKRSKLSCYKESDSYSRSDYWERRRLQRIRIETTSNSKFWVRSPEPDPLYFNIIHINDEKKVKKNKKNRKHSRSHVQKVSKKKSKKSNKKKHSSSSLDEEEQNFIESMKKKHEIKNTDEIIGPQIPEGLIPKLPSHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVMSGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV 250          
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Match: SMESG000047455.1 (SMESG000047455.1)

HSP 1 Score: 54.299 bits (129), Expect = 1.792e-9
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = -1
Query:  866 PHPPCIDYLTAIDQLIVEQNIEMIE 940
            PHPPCIDYLTAIDQLIVEQNIEMIE
Sbjct:   57 PHPPCIDYLTAIDQLIVEQNIEMIE 81          
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 49.2914 bits (116), Expect = 1.176e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            P  ++YLT IDQL++ Q +E+ E++SG ETNN Y +KNI 
Sbjct:   10 PIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIF 49          
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Match: SMESG000050651.1 (SMESG000050651.1)

HSP 1 Score: 48.9062 bits (115), Expect = 2.555e-6
Identity = 21/40 (52.50%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            P  ++YLT IDQL++ Q +E+ E++SG ETNN Y +KNI 
Sbjct:  100 PIGLEYLTLIDQLLIHQQVELFEILSGYETNNRYILKNIF 139          
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Match: SMESG000043802.1 (SMESG000043802.1)

HSP 1 Score: 48.521 bits (114), Expect = 3.181e-6
Identity = 20/40 (50.00%), Postives = 30/40 (75.00%), Query Frame = -1
Query:  815 PPCIDYLTAIDQLIVEQNIEMIEVISGIETNNSYKIKNIM 934
            PP ++YLT +DQ++V Q IE++EV +  ET N Y+IKN +
Sbjct:  181 PPGLEYLTMVDQILVHQQIELLEVFTNWETKNKYQIKNSL 220          
The following BLAST results are available for this feature:
BLAST of Nkap_C domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKAP1.714e-4056.82NFKB activating protein [Source:HGNC Symbol;Acc:HG... [more]
NKAP2.020e-4056.82NFKB activating protein [Source:HGNC Symbol;Acc:HG... [more]
NKAPL2.928e-3959.66NFKB activating protein like [Source:HGNC Symbol;A... [more]
PLSCR12.442e-755.26phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
PLSCR12.931e-755.26phospholipid scramblase 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
let-5048.956e-2947.10pep chromosome:WBcel235:I:4129469:4132292:-1 gene:... [more]
let-5048.956e-2947.10pep chromosome:WBcel235:I:4129567:4132224:-1 gene:... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG60661.078e-4064.41gene:FBgn0039488 transcript:FBtr0085131[more]
scramb14.469e-750.00gene:FBgn0052056 transcript:FBtr0076302[more]
scramb15.244e-750.00gene:FBgn0052056 transcript:FBtr0076303[more]
scramb16.962e-751.35gene:FBgn0052056 transcript:FBtr0076301[more]
scramb21.124e-652.63gene:FBgn0035390 transcript:FBtr0073005[more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkap1.829e-4060.34NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
nkap6.595e-4060.34NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
plscr3a6.207e-860.00phospholipid scramblase 3a [Source:ZFIN;Acc:ZDB-GE... [more]
si:ch211-71m22.18.366e-860.00si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
si:ch211-71m22.18.366e-860.00si:ch211-71m22.1 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkap1.792e-3860.53NFKB activating protein [Source:NCBI gene;Acc:4481... [more]
nkap1.884e-3860.53NFKB activating protein [Source:NCBI gene;Acc:4481... [more]
insyn18.463e-855.00inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
insyn18.866e-855.00inhibitory synaptic factor 1 [Source:Xenbase;Acc:X... [more]
ENSXETT00000012543.11.834e-752.50phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkap1.138e-4057.69NFKB activating protein [Source:MGI Symbol;Acc:MGI... [more]
Nkapl1.024e-3862.07NFKB activating protein-like [Source:MGI Symbol;Ac... [more]
Plscr24.295e-746.51phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr24.295e-746.51phospholipid scramblase 2 [Source:MGI Symbol;Acc:M... [more]
Plscr18.976e-756.76phospholipid scramblase 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D0F4|NKAP_MOUSE7.959e-4057.69NF-kappa-B-activating protein OS=Mus musculus OX=1... [more]
sp|Q4V7C9|NKAP_RAT8.561e-4056.82NF-kappa-B-activating protein OS=Rattus norvegicus... [more]
sp|Q8N5F7|NKAP_HUMAN9.699e-4056.82NF-kappa-B-activating protein OS=Homo sapiens OX=9... [more]
sp|Q9VB74|NKAP_DROME1.080e-3964.41NKAP family protein CG6066 OS=Drosophila melanogas... [more]
sp|Q5M9Q1|NKAPL_HUMAN1.406e-3859.66NKAP-like protein OS=Homo sapiens OX=9606 GN=NKAPL... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1EDY41.626e-4462.88Nkap_C domain-containing protein OS=Helobdella rob... [more]
A0A0R3T5464.406e-4458.04Nkap_C domain-containing protein OS=Rodentolepis n... [more]
A0A0R3SSN63.359e-4357.34Nkap_C domain-containing protein OS=Hymenolepis di... [more]
R7T8041.133e-4264.75Nkap_C domain-containing protein OS=Capitella tele... [more]
A0A0R3UFQ51.978e-4257.64Nkap_C domain-containing protein OS=Mesocestoides ... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKAP1.162e-4062.83NFKB activating protein [Source:HGNC Symbol;Acc:HG... [more]
si:ch211-71m22.11.473e-760.00phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
si:ch211-71m22.11.494e-760.00phospholipid scramblase 1-like [Source:NCBI gene;A... [more]
plscr3b2.646e-752.50phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
plscr3b2.646e-752.50phospholipid scramblase 2-like [Source:NCBI gene;A... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nkap1.553e-3959.02NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
nkap2.184e-3958.06NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
nkap2.579e-3959.02NFKB activating protein [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434915.065e-3867.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461093.063e-651.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
NKAPL1.173e-3962.61NFKB activating protein [Source:NCBI gene;Acc:1011... [more]
plscr3b2.931e-650.00phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
plscr3b2.931e-650.00phospholipid scramblase 2 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Nkap_C domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023380.11.779e-13499.20SMESG000023380.1[more]
SMESG000047455.11.792e-9100.00SMESG000047455.1[more]
SMESG000050651.11.176e-652.50SMESG000050651.1[more]
SMESG000050651.12.555e-652.50SMESG000050651.1[more]
SMESG000043802.13.181e-650.00SMESG000043802.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005681 ID=SMED30005681|Name=Nkap_C domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=940bp
TGATAATTTCTAAATGGGACATAACAGAAAAAGAACTAGCTCATCTGGAT
CAAGTTCTGAATATAAAAGATCCAAACTGAGTTGTTATAAGGAATCAGAT
AGTTATTCTCGTTCTGATTATTGGGAAAGACGAAGACTGCAAAGAATCCG
AATTGAAACTACTTCTAATAGTAAATTTTGGGTCAGATCTCCTGAACCAG
ATCCATTATATTTTAATATAATTCATATTAATGATGAAAAAAAAGGGAAA
AAAAACAAAAAGAATCGCAAACATTCCAGATCACATGTTCAAAAAGTTTC
AAAAAAGAAATCTAAAAAATCTAATAAAAAAAAACATTCATCTTCCAGTT
TAGATGAAGAAGAACAAAATTTCATTGAAAGCATGAAAAAGAAGCATGAA
ATTAAAAATTCCGATGAAATTATAGGTCCCCAAATTCCAGAAGGTCTGAT
TCCAAAATTACCAAGTCACATGGATTTCGGAAAAGCATTGTTACCTGGTG
AGGGTGCTGCTATGGCTGCATATATTGCCGACAATAAAAGAATTCCTAGA
AGAGGAGAAATAGGAGTTACATCCGAAGATATAGATCAATTTGAAAGTTT
AGGATATGTTATGTCCGGTAGTCGCCACAACAGAATGGAGGCAGTTCGTA
TCCGAAAAGAAAATCAGATATATTCTGCAGATGAAAAACGAATATTAGCA
GCTTTAAATCAAACAGAAATGGTCAAAAAAGAAGCAGAAAATTTAGAACA
TTTTCGTCGAGTTCTCAACAAACAATTAAAGAAACCAAACTGATAGTTAA
TTTGATATTTTGTACATAATATTTTTTATTTTGTAGCTATTGTTGGTTTC
TATACCACTGATCACTTCAATCATTTCTATATTTTGCTCGACAATCAGTT
GGTCAATTGCTGTTAAATAATCTATGCAAGGAGGATGCGG
back to top

protein sequence of SMED30005681-orf-1

>SMED30005681-orf-1 ID=SMED30005681-orf-1|Name=SMED30005681-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=260bp
MGHNRKRTSSSGSSSEYKRSKLSCYKESDSYSRSDYWERRRLQRIRIETT
SNSKFWVRSPEPDPLYFNIIHINDEKKGKKNKKNRKHSRSHVQKVSKKKS
KKSNKKKHSSSSLDEEEQNFIESMKKKHEIKNSDEIIGPQIPEGLIPKLP
SHMDFGKALLPGEGAAMAAYIADNKRIPRRGEIGVTSEDIDQFESLGYVM
SGSRHNRMEAVRIRKENQIYSADEKRILAALNQTEMVKKEAENLEHFRRV
LNKQLKKPN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040466NKAP
IPR009269NKAP_C
IPR005552Scramblase
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007219Notch signaling pathway
GO:0045892negative regulation of transcription, DNA-templated
GO:0046638positive regulation of alpha-beta T cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009269NF-kappa-B-activating protein, C-terminalPFAMPF06047Nkap_Ccoord: 153..252
e-value: 1.6E-43
score: 147.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..106
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 20..34
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..118
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..19
IPR040466NF-kappa-B-activating proteinPANTHERPTHR13087NF-KAPPA B ACTIVATING PROTEINcoord: 75..256