Rapunzel

Overview
NameRapunzel (AIZ98416.1)
Smed IDSMED30005670
Length (bp)1379
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rapunzel (SMED30005670) t-SNE clustered cells

Violin plots show distribution of expression levels for Rapunzel (SMED30005670) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rapunzel (SMED30005670) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rapunzel (SMED30005670) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005670

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30005670SMESG000052592.1 SmedASXL_004544SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30005670SMESG000052592.1 dd_Smed_v6_279_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30005670SMESG000052592.1 OX_Smed_1.0.21273ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30005670SMESG000052592.1 dd_Smed_v6_279_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30005670SMESG000052592.1 dd_Smed_v4_279_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rapunzel vs. TrEMBL
Match: A0A0A7NXM5 (Rapunzel (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 0.000e+0
Identity = 209/210 (99.52%), Postives = 210/210 (100.00%), Query Frame = 3
Query:  150 MNGVQGVVQXXXXXXXXXXXXTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWKK 779
            MNGVQGVVQLFKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW+K
Sbjct:    1 MNGVQGVVQLFKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWEK 210          

HSP 2 Score: 343.584 bits (880), Expect = 0.000e+0
Identity = 160/160 (100.00%), Postives = 160/160 (100.00%), Query Frame = 2
Query:  773 EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNV 1252
            EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNV
Sbjct:  209 EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNV 368          
BLAST of Rapunzel vs. TrEMBL
Match: A0A1I8HCC0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.174e-35
Identity = 57/172 (33.14%), Postives = 87/172 (50.58%), Query Frame = 2
Query:  770 MEKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHG-RNIIVSSVD-------QSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRAL-PLCSDADTRASVAWGSNVWF 1258
            MEK L     ++ +++ + K+KY+ Q   D+  ++  +   SN+ F    Y F A K++ R WF L YK++SG   H V  C G  RFRTHG RN++V+S D       Q  G+AA+    R    +G+       G H++ W       +   C+DA    S+ WG +VWF
Sbjct: 1708 MEKLLI----RMMRLENEIKSKYHSQMTSDIGGVILNNRHLSNKDFSGHMYRFLADKFDHRNWFSLAYKDVSGGDKHWVSFCGGDLRFRTHGSRNVVVASADKRSSRFSQPRGNAALDDAQR----VGS-------GSHAESWTNLIRSKIGNSCADAAFVGSICWGCDVWF 1864          

HSP 2 Score: 86.2705 bits (212), Expect = 2.174e-35
Identity = 46/186 (24.73%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  216 LTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW 773
            +TQ++ V   +F+ +++++ ++      ES EM  ++++FA ++ ++D   ++   +KR I+W   ++ +A+ E  II    +L+     P ++RE     FI  ++ N  A    L++A++  + + + NL  A   Y +N R  V  F++ M +LI +  Q+E AY  + +  + A    +++W
Sbjct: 1521 VTQVAEVVSKVFTFVTSVIDLIQHLQGTESAEMKFLREQFAQVHAKLDSISLQLDDVKRLIEWRTTRVMYANYETFIIAASSILNNYVAAPESSREVLKRQFIAAFQHNPLAPLK-LYQAIVEKDFVIAENLAAAVVHYTQNHRRHVINFLLAMQRLIMRGAQLEIAYEKMVH-GDGAGNVAKTVW 1704          

HSP 3 Score: 92.4337 bits (228), Expect = 6.981e-34
Identity = 63/198 (31.82%), Postives = 99/198 (50.00%), Query Frame = 2
Query:  770 MEKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTH-GRNIIVSSVD-------QSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRAL-PLCSDADTRASVAWGSNVWF-INTRLVVYQKNCVRGSSSCYNTYLF 1333
            MEK L     +++Q++    +KY+ Q   D+  ++  +   SN+ F    Y F A K++ R W  L YK++SG   H V  C G  RFRTH GRN++V+S +       +++G+AA+    R    +G+       G H++ W       +   CSDA    S+ WG +VWF + +   VY+K   RG     NT +F
Sbjct: 2456 MEKMLT----RMQQVENGVLSKYHSQMTSDIGRVILDNRHLSNKDFSGHMYRFLADKFDRRYWIALSYKDVSGGDKHWVSYCGGDARFRTHGGRNVVVASSNPGSSRFTRAKGNAALDAAQR----VGS-------GSHAESWTNLIRSKIGNSCSDAAFVGSICWGCDVWFTMRSDRYVYRKMSNRGD---INTVVF 2635          

HSP 4 Score: 82.0333 bits (201), Expect = 6.981e-34
Identity = 49/184 (26.63%), Postives = 95/184 (51.63%), Query Frame = 3
Query:  225 ISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNII-TLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW 773
            ++ V   + S + AI+ ++      ES EM  M+++F  ++ ++D   ++ + +KR I+W   ++ +A+ E+ I+ T H + S +       RE     F+  +  N  AA   L++A++  +   S NL  A   Y +N R  V  F++ M +L+ +  Q+E AY  + +  + A+  TQ+LW
Sbjct: 2271 VAQVVSKVLSFVIAIINLIGGLGAQESAEMKFMREQFKEVHAKLDSISLQLEEVKRLIEWQTTRVTYANYESFIVATTHLLDSYVGANDAMTREVHKRQFLTAFRKNPIAALK-LYQAVVETDLTISDNLGVAVVHYTQNHRRNVMNFLLAMQRLVMRGAQLEIAYEKMVH-GDHAATVTQALW 2452          
BLAST of Rapunzel vs. TrEMBL
Match: V4B6X2 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237783 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 4.237e-34
Identity = 56/196 (28.57%), Postives = 106/196 (54.08%), Query Frame = 3
Query:  225 ISSVAGPIFSAISAILTVVFMFIEI--------ESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLK--------YNNEEASKFTQ 764
             ++V G + +A++  L +V  F+          ES E+  +K+ +  ++NR DK  ++F  +KR IDWS +QI ++DIE  I  +++    + +  I   +T A+ F+  +E +Y+ +G  L+  ++N  +++   L  A   Y E DR + Q FM+G+++L+ +A ++E  Y  LK        Y N+  ++FT 
Sbjct:   49 FTNVIGKLATAVTPFLGIVGPFVSFIMGFFGHSESAELKAIKRLYTEVDNRFDKVDLQFIEVKRLIDWSKIQIQYSDIEQKINAVNQEFENIYKFSIGAVKTTASAFVKNFESDYQNSGSKLYDGIMNEGRVFGDGLFTAIIKYSEYDRGKSQTFMLGLLQLLMKAAKLELTYHQLKGHTAALHDYQNQWRTRFTH 244          

HSP 2 Score: 73.9442 bits (180), Expect = 4.237e-34
Identity = 38/105 (36.19%), Postives = 60/105 (57.14%), Query Frame = 2
Query:  791 LKDKLEQIDTDTKNKYNEQYQKDLDNLLATH--YSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMA 1099
            ++ K+   D    ++Y+ Q  KD+DN L  H   + +N  F  + Y F   KY+WR+W  + Y +++G   H V  C G  +FR HGRN++V+SVD+ +G   MA
Sbjct:  245 IRIKMMSTDNSIVSQYHTQSGKDIDNYLIKHPKNTMNNNDFNNMLYGFLTKKYSWRDWLTITYNDITGSNVHYVGECGGYLKFRNHGRNVVVASVDRRKGHINMA 349          
BLAST of Rapunzel vs. TrEMBL
Match: A0A1I8HMN9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 7.408e-34
Identity = 57/172 (33.14%), Postives = 88/172 (51.16%), Query Frame = 2
Query:  770 MEKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHG-RNIIVSSVD-------QSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALP-LCSDADTRASVAWGSNVWF 1258
            MEK L     ++ +++ + K+KY+ Q   D+  ++  +   SN+ F    Y F A K++ R WF L YK++SG   H V  C G  RFRTHG RN++V+S D       Q  G+AA+     + Q +G+       G H++ W       +   C+DA    S+ WG +VWF
Sbjct: 1603 MEKLLI----RMMRLENEIKSKYHSQMTSDIGGVILNNRHLSNKDFSGHMYRFLADKFDHRNWFSLAYKDVSGGDKHWVSFCGGDLRFRTHGSRNVVVASADKRSSRFSQPRGNAAL----DDAQRVGS-------GSHAESWTNLIRSKIGNSCADAAFVGSICWGCDVWF 1759          

HSP 2 Score: 86.2705 bits (212), Expect = 7.408e-34
Identity = 46/186 (24.73%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  216 LTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW 773
            +TQ++ V   +F+ +++++ ++      ES EM  ++++FA ++ ++D   ++   +KR I+W   ++ +A+ E  II    +L+     P ++RE     FI  ++ N  A    L++A++  + + + NL  A   Y +N R  V  F++ M +LI +  Q+E AY  + +  + A    +++W
Sbjct: 1416 VTQVAEVVSKVFTFVTSVIDLIQHLQGTESAEMKFLREQFAQVHAKLDSISLQLDDVKRLIEWRTTRVMYANYETFIIAASSILNNYVAAPESSREVLKRQFIAAFQHNPLAPLK-LYQAIVEKDFVIAENLAAAVVHYTQNHRRHVINFLLAMQRLIMRGAQLEIAYEKMVH-GDGAGNVAKTVW 1599          
BLAST of Rapunzel vs. TrEMBL
Match: V4AXV0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238695 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 7.492e-34
Identity = 56/197 (28.43%), Postives = 107/197 (54.31%), Query Frame = 3
Query:  222 QISSVAGPIFSAISAILTVVFMFIEI--------ESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLK--------YNNEEASKFTQ 764
            + ++V G + +A++  L +V  F+          ES E+  +K+ +  ++NR DK  ++F  +KR IDWS +Q+ ++DIE  I  ++K    + +   A  +T  + F++ YE +Y+ +G  L+  ++N  +++   L  A   Y E DR + Q FM+G+++L+ +A ++E  Y  LK        Y N+  ++FT 
Sbjct:   48 KFTNVIGKLATAVTPFLGIVGPFVSFIMGFFGQSESAELKAIKRLYTEVDNRFDKVDLQFIEVKRMIDWSKIQVQYSDIEQKINAVNKAFENIYKFSTAAVKTTTSAFVSNYESDYQNSGSKLYDGIMNEGRVFGDGLFTAVVKYSEYDRVKSQTFMLGLLQLLMKAAKLELTYHQLKGHKAALHDYQNQWRTRFTH 244          

HSP 2 Score: 72.0182 bits (175), Expect = 7.492e-34
Identity = 40/113 (35.40%), Postives = 63/113 (55.75%), Query Frame = 2
Query:  791 LKDKLEQIDTDTKNKYNEQYQKDLDNLLATH--YSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQI 1123
            ++ K+   D+   ++Y+ Q  KD+DN L  H   + +N  F    Y F + KY WR+WF + Y +++G   H V  C G  +FR HGRN++V+SVD  +G     HIN  + +
Sbjct:  245 IRIKMMSTDSSIVSQYHTQSGKDIDNYLIKHQKNTMNNNDFNNALYAFLSKKYFWRDWFTVTYNDITGSNVHYVGECGGHIKFRNHGRNVVVASVDSRKG-----HINMGQAL 352          
BLAST of Rapunzel vs. Planmine SMEST
Match: SMESG000052592.1 (SMESG000052592.1)

HSP 1 Score: 456.062 bits (1172), Expect = 0.000e+0
Identity = 256/258 (99.22%), Postives = 257/258 (99.61%), Query Frame = 3
Query:    6 MKSLXXXXXXXXXXXXXXXPETIDNELILYRGLPQIKTSLTEKEKSQIMNGVQGVVQXXXXXXXXXXXXTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWKK 779
            MKSLIFPIFIFVFVIGS VPETIDNELILYRGLPQIKTSLTEKEKSQIMNGVQGVVQLFKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW+K
Sbjct:    1 MKSLIFPIFIFVFVIGSAVPETIDNELILYRGLPQIKTSLTEKEKSQIMNGVQGVVQLFKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWEK 258          

HSP 2 Score: 403.675 bits (1036), Expect = 0.000e+0
Identity = 187/188 (99.47%), Postives = 187/188 (99.47%), Query Frame = 2
Query:  773 EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNVWFINTRLVVYQKNCVRGSSSCYNTYLFA 1336
            EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGR LPLCSDADTRASVAWGSNVWFINTRLVVYQKNCVRGSSSCYNTYLFA
Sbjct:  257 EKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRVLPLCSDADTRASVAWGSNVWFINTRLVVYQKNCVRGSSSCYNTYLFA 444          
BLAST of Rapunzel vs. Planmine SMEST
Match: SMESG000052591.1 (SMESG000052591.1)

HSP 1 Score: 237.269 bits (604), Expect = 4.602e-104
Identity = 108/187 (57.75%), Postives = 139/187 (74.33%), Query Frame = 2
Query:  776 KKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNVWFINTRLVVYQKNCVRGSSSCYNTYLFA 1336
            ++   LK  +E +D DTK ++  QYQ DLD  L T  S +NE+F  + Y++ +TKYNWR+WFV+VY  +SGFKDH V TCQGT+RFRT+GRNIIVSSVD+ +G +A +HI RNKQIIG+Y+      E+S+ WV +  + LP C+DADTR SVAWGSNVWF NT LVVY+KNCV   S C+NT+LFA
Sbjct:  236 ERFKTLKATMEAVDLDTKEQFRNQYQMDLDEYLMTRESLTNEQFNQVLYNYLSTKYNWRDWFVVVYAPISGFKDHTVSTCQGTYRFRTNGRNIIVSSVDKEDGISAGSHIERNKQIIGSYSDWKSDKEYSRGWVSFMDKLLPNCNDADTRLSVAWGSNVWFTNTNLVVYKKNCVNDKSPCFNTFLFA 422          

HSP 2 Score: 160.614 bits (405), Expect = 4.602e-104
Identity = 88/234 (37.61%), Postives = 136/234 (58.12%), Query Frame = 3
Query:   78 NELILYRGLPQIKTSLTEKEKSQIMNGVQGVVQXXXXXXXXXXXXTLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLWKK 779
            NE + +R  P  KT LT  E + +  G+Q + Q+ KF  EK+F K    ++ +    F+  S+ +   F+  E+ + E    KK    L  R  +W  +F  ++  IDW+ VQINF D+EN I+T+ ++ +    +    +E  A  F+++YE NYKA GD+L+  M+NI Q +S NL RA+Q + + DR +VQ FMV + KL+ QAV IEA +  LKY N+E  KF  S+W++
Sbjct:    3 NEFLNHRPFPTNKTYLTGSEMTNLYFGIQAITQMEKFYGEKDFNKVGKLMADITDETFNVSSSTIFTAFLSGELHATETESFKKASLLLKTRTSRWKEDFNEVRYSIDWAVVQINFEDLENRILTVQRLSTEFMSIDDNEKEFSAKQFLHSYEANYKATGDLLYSVMININQSFSGNLFRASQKFTQFDRKKVQTFMVELAKLLVQAVNIEANFANLKYENDENVKFLNSMWRE 236          
BLAST of Rapunzel vs. Planmine SMEST
Match: SMESG000004912.1 (SMESG000004912.1)

HSP 1 Score: 95.9005 bits (237), Expect = 7.942e-29
Identity = 51/187 (27.27%), Postives = 102/187 (54.55%), Query Frame = 3
Query:  213 TLTQISSVAGPIFSAISAILTVVFMFIEIESPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEASKFTQSLW 773
            T   I+    P+  AI +   ++ +  E +S E+  MK++F  LN ++D    +F+ +KR +DW+ V+I +   E ++  L  ++  + + P + R      F+ +Y+  Y  A + L++  +N  +++S NL+ A + Y ++ R Q+++F +G ++LI + +++E  Y+ LK N     KF Q  W
Sbjct:   57 TGKAIAKWGKPLLEAIGSFAKIIMVQFESDSKELTFMKEQFKILNEKMDYVDQQFEEVKRLMDWNVVKIQYGKYEMHVYMLQHLIQIIADSPASLRHITIDKFLLSYDQVYDNAAENLYQGFINQNKVFSENLVLAIRKYTKDHRYQIEKFFMGNIQLIIKCLEVETFYINLK-NFTSIEKFWQVKW 242          

HSP 2 Score: 50.447 bits (119), Expect = 7.942e-29
Identity = 27/93 (29.03%), Postives = 45/93 (48.39%), Query Frame = 2
Query:  791 LKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSV 1069
            L D ++ +       +  Q   D++   A +  +S+E +    Y+F   K+  R W VLVY  L    DHA+  C G  + + +G N+ VSS+
Sbjct:  249 LMDIMKTVSEKISENWEAQSNMDIEEFNAENGKKSHENYAKDLYNFLNDKFRNRIWLVLVYDPLDSGTDHALKACNGISQMQRNGHNVAVSSL 341          
BLAST of Rapunzel vs. Planmine SMEST
Match: SMESG000062792.1 (SMESG000062792.1)

HSP 1 Score: 73.1738 bits (178), Expect = 9.771e-14
Identity = 48/176 (27.27%), Postives = 87/176 (49.43%), Query Frame = 2
Query:  776 KKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIAYDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSVDQSEGDAAMAHINRNKQIIGN----YNSQWQGGEHSKHWVEYWGRALPLCSDADTRASVAWGSNVWFI-NTRLVVYQK 1288
            KK+  +   +E+     K  ++ Q QKD +     +Y + N+ ++   Y+F   K++WREWF++VY  ++G  +H V    G    R+ G NI V+S D+ + +    + N   Q++ N    +N++ +G   S   ++    A+         A + WG+ VWFI N +   Y+K
Sbjct:  240 KKINQISAIMEETINSIKGNWHSQLQKDAEEFNVKNYGKGNKEYLEEFYNFLTDKFSWREWFLVVYNPITGGDNHYVSVYGGIINLRSRGHNIAVASRDKEDNN---FNANLISQVLDNLPRSFNTRGKGLAES-LLMDQLIPAIQRVHKYSLAAVIEWGAGVWFISNNQFRAYKK 411          
BLAST of Rapunzel vs. Planmine SMEST
Match: SMESG000027656.1 (SMESG000027656.1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.607e-10
Identity = 42/171 (24.56%), Postives = 87/171 (50.88%), Query Frame = 3
Query:  216 LTQISSVAGPIFSAISAILTVVFMFIEIE-SPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIITLHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYSVNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVG 725
            L+ +    GP   AISAIL++V MF+  E SPE+  +K+ F  +NN++D    +   ++  I+ S+ +  +      + +++    TL E   +N +     F   YE +++ A   ++ AM      +  N++   + ++  +  ++ +F    ++LIT+ + +E AY+G
Sbjct:   62 LSGVLGSLGPAAMAISAILSIVTMFLPKEDSPELKAIKEGFEKVNNKLDTISSKIGSLENIIELSSARAAYV---KTVTSINNNYETLNEAKKSNSKEGYDYFAKQYENSFEFATANMYDAMTGSTGPFGFNMVNLYKTHVRCNPVKLSQFCTMGLQLITKGLTVEGAYLG 229          
The following BLAST results are available for this feature:
BLAST of Rapunzel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7NXM50.000e+099.52Rapunzel (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1I8HCC02.174e-3533.14MFS domain-containing protein OS=Macrostomum ligna... [more]
V4B6X24.237e-3428.57Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1I8HMN97.408e-3433.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V4AXV07.492e-3428.43Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Rapunzel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Rapunzel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052592.10.000e+099.22SMESG000052592.1[more]
SMESG000052591.14.602e-10457.75SMESG000052591.1[more]
SMESG000004912.17.942e-2927.27SMESG000004912.1[more]
SMESG000062792.19.771e-1427.27SMESG000062792.1[more]
SMESG000027656.12.607e-1024.56SMESG000027656.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30005670
GenBankAIZ98416.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005670 ID=SMED30005670|Name=Rapunzel|organism=Schmidtea mediterranea sexual|type=transcript|length=1379bp
CAAAAATGAAATCTCTAATATTTCCGATTTTTATTTTTGTGTTTGTCATC
GGTTCTGTGGTTCCGGAAACTATTGACAATGAGCTCATTCTTTATCGTGG
CCTGCCACAGATTAAAACAAGTCTTACGGAAAAGGAGAAGAGTCAAATTA
TGAATGGAGTGCAAGGAGTCGTTCAGCTTTTCAAATTTCTTGAAGAAAAG
AATTTCTTTAAAACCTTAACACAAATTTCGTCAGTTGCCGGGCCAATTTT
CAGCGCAATTTCCGCTATTTTAACAGTGGTTTTCATGTTTATTGAAATCG
AGTCTCCGGAAATGGCGTTAATGAAAAAGGAATTCGCAAATTTGAATAAC
AGAATTGACAAATGGGGGGTCGAATTTCAAATTATTAAAAGGAAAATCGA
CTGGAGTGCGGTTCAGATAAATTTTGCCGACATAGAAAACAACATCATAA
CCCTTCACAAAATGTTGTCGACCTTGCCGGAAGTACCGATTGCAAATCGA
GAGACCCAAGCGGCTTTGTTTATAAATACTTATGAAATAAATTATAAAGC
CGCCGGGGATATTTTACACCGTGCCATGCTAAATATCGAACAGATTTATT
CTGTTAATTTGTTAAGAGCTGCTCAATTGTACATGGAAAATGATAGGAAT
CAAGTTCAAGAATTTATGGTCGGAATGATGAAACTGATCACTCAAGCAGT
GCAGATCGAGGCAGCCTATGTCGGACTCAAATATAATAATGAAGAAGCAT
CCAAATTCACACAGTCATTATGGAAAAAAAGTTAGCAGTTCTAAAAGACA
AACTGGAACAAATAGACACAGACACAAAAAACAAATACAATGAACAATAT
CAGAAGGATCTCGACAATTTACTGGCAACCCATTATTCTCAATCCAATGA
AAGATTTGTAACAATTGCATACGACTTTTTTGCAACGAAATACAACTGGA
GAGAATGGTTCGTTTTGGTATATAAAGAATTATCGGGATTCAAGGATCAC
GCTGTTGTAACGTGTCAGGGAACTCATCGGTTTAGAACACACGGCAGAAA
TATAATTGTGTCCAGCGTCGACCAATCGGAAGGTGATGCTGCAATGGCTC
ACATCAACAGGAACAAGCAAATTATTGGTAATTACAATTCTCAATGGCAG
GGTGGGGAGCATTCAAAACATTGGGTTGAATATTGGGGTCGGGCATTACC
CCTCTGTTCTGACGCCGATACCAGAGCTTCGGTGGCATGGGGAAGTAATG
TTTGGTTTATAAATACTAGATTAGTTGTTTATCAAAAGAACTGTGTCAGA
GGTAGCTCATCTTGTTATAATACTTATCTTTTTGCTTAAAGGTTTCAGAT
ATTCAATAAATATCTCTATGAAAAAAAAA
back to top

protein sequence of SMED30005670-orf-1

>SMED30005670-orf-1 ID=SMED30005670-orf-1|Name=SMED30005670-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=190bp
MEKKLAVLKDKLEQIDTDTKNKYNEQYQKDLDNLLATHYSQSNERFVTIA
YDFFATKYNWREWFVLVYKELSGFKDHAVVTCQGTHRFRTHGRNIIVSSV
DQSEGDAAMAHINRNKQIIGNYNSQWQGGEHSKHWVEYWGRALPLCSDAD
TRASVAWGSNVWFINTRLVVYQKNCVRGSSSCYNTYLFA*
back to top

protein sequence of SMED30005670-orf-2

>SMED30005670-orf-2 ID=SMED30005670-orf-2|Name=SMED30005670-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
KMKSLIFPIFIFVFVIGSVVPETIDNELILYRGLPQIKTSLTEKEKSQIM
NGVQGVVQLFKFLEEKNFFKTLTQISSVAGPIFSAISAILTVVFMFIEIE
SPEMALMKKEFANLNNRIDKWGVEFQIIKRKIDWSAVQINFADIENNIIT
LHKMLSTLPEVPIANRETQAALFINTYEINYKAAGDILHRAMLNIEQIYS
VNLLRAAQLYMENDRNQVQEFMVGMMKLITQAVQIEAAYVGLKYNNEEAS
KFTQSLWKKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000067goblet cell
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0002075pigment cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.783
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 5..24