50S ribosomal protein L3, putative

Overview
Name50S ribosomal protein L3, putative
Smed IDSMED30005659
Length (bp)1179
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 50S ribosomal protein L3, putative (SMED30005659) t-SNE clustered cells

Violin plots show distribution of expression levels for 50S ribosomal protein L3, putative (SMED30005659) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 50S ribosomal protein L3, putative (SMED30005659) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 50S ribosomal protein L3, putative (SMED30005659) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005659

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005659h1SMcG0016747 SmedASXL_005272SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30005659h1SMcG0016747 Contig35125uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005659h1SMcG0016747 Contig35125newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30005659h1SMcG0016747 dd_Smed_v4_2057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30005659h1SMcG0016747 dd_Smed_v4_2057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30005659h1SMcG0016747 dd_Smed_v4_2057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005659h1SMcG0016747 Contig23753newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Match: MRPL3 (mitochondrial ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10379])

HSP 1 Score: 150.984 bits (380), Expect = 1.739e-41
Identity = 106/330 (32.12%), Postives = 163/330 (49.39%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL--FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D   A    +   LK   WP H + P  + R GLIA K+G++P WTK G++ ++T+ QV D   L Y   +       T                        VG  T     F  A S L  + + G+ P++ +  F ++++A I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGA+  G    V    KMPG MGN  R   G+++ R++ K+N++Y+NG  PG  +    + D+ L    D     P  PT + + DE+ +      +D + +++ +   PSI ++
Sbjct:   65 DEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLS----------------------VGGKTVS--RFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLP-FPTYFPDGDEEEL-----PEDLYDENVCQPGAPSITFA 363          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Match: MRPL3 (mitochondrial ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10379])

HSP 1 Score: 150.214 bits (378), Expect = 2.644e-41
Identity = 106/330 (32.12%), Postives = 163/330 (49.39%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL--FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D   A    +   LK   WP H + P  + R GLIA K+G++P WTK G++ ++T+ QV D   L Y   +       T                        VG  T     F  A S L  + + G+ P++ +  F ++++A I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGA+  G    V    KMPG MGN  R   G+++ R++ K+N++Y+NG  PG  +    + D+ L    D     P  PT + + DE+ +      +D + +++ +   PSI ++
Sbjct:   50 DEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLS----------------------VGGKTVS--RFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLP-FPTYFPDGDEEEL-----PEDLYDENVCQPGAPSITFA 348          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Match: MRPL3 (mitochondrial ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10379])

HSP 1 Score: 150.214 bits (378), Expect = 4.598e-41
Identity = 106/330 (32.12%), Postives = 163/330 (49.39%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL--FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D   A    +   LK   WP H + P  + R GLIA K+G++P WTK G++ ++T+ QV D   L Y   +       T                        VG  T     F  A S L  + + G+ P++ +  F ++++A I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGA+  G    V    KMPG MGN  R   G+++ R++ K+N++Y+NG  PG  +    + D+ L    D     P  PT + + DE+ +      +D + +++ +   PSI ++
Sbjct:   77 DEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLS----------------------VGGKTVS--RFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLP-FPTYFPDGDEEEL-----PEDLYDENVCQPGAPSITFA 375          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Match: MRPL3 (mitochondrial ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10379])

HSP 1 Score: 95.1301 bits (235), Expect = 9.099e-23
Identity = 62/178 (34.83%), Postives = 87/178 (48.88%), Query Frame = 3
Query:  366 IIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL--FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPG 887
            ++P WTK G++ ++T+ QV D   L Y   +       T                        VG  T     F  A S L  + + G+ P++ +  F ++++A I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGA+  G    V    KMPG
Sbjct:    1 MMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLS----------------------VGGKTVS--RFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPG 154          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Match: MRPL3 (mitochondrial ribosomal protein L3 [Source:HGNC Symbol;Acc:HGNC:10379])

HSP 1 Score: 53.9138 bits (128), Expect = 4.825e-8
Identity = 32/99 (32.32%), Postives = 52/99 (52.53%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNY----IPPKEVENMFN 479
            D  L++EN   + +   D   A    +   LK   WP H + P  + R GLIA K+G++P WTK G++ ++T+ Q   ++   Y    +PPK+   +FN
Sbjct:   50 DEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHVVTLLQKATSILEFYRELGLPPKQTVKIFN 147          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Celegans
Match: mrps-18C (Putative 39S ribosomal protein L3, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P49404])

HSP 1 Score: 138.658 bits (348), Expect = 5.472e-37
Identity = 97/317 (30.60%), Postives = 151/317 (47.63%), Query Frame = 3
Query:  129 TPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMK--FNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIG--GGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPT 1067
            TP PW     ++      S +  S  T    + ++EK    +  + F+  Q    S        P  ++R GL+  KIG++P WT +G R+L T+ +V +N  ++   P   E  + +     +  FN   P W          VGA   DP ++   Y   F + G+  + KL  FLV+EDA+   G  L  +H+ +G ++  T ++ + GFQG M R    G P T  TTK+HRR G++G  G   +   K+MPG MG   R + G++IVR++    V+Y+ G  PG I     L D     + ++R K   MPT
Sbjct:   40 TPAPWLPPVKESVP---KSSVGISQGTKNLLETVIEKETLAASTIAFQNSQETNVSV----VDIPDSSRRVGLVVRKIGMLPQWTNEGNRILCTVLEVDENHVVSITSP---EAWYKSSAVGKRKAFNRHGPMWRVT-------VGAGNDDPTKYTLGYRRQFVRAGIPVKEKLGCFLVTEDALPSAGQPLDARHFGVGQYVTATGKTIDWGFQGGMHRWGMRGQP-TRRTTKSHRRIGSVGSVGDARIWPGKRMPGHMGYEWRTVSGLEIVRINVDKQVIYVKGSVPGDIGETILLKDC---LQEEKRLKSGPMPT 335          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Fly
Match: mRpL3 (gene:FBgn0030686 transcript:FBtr0074090)

HSP 1 Score: 189.889 bits (481), Expect = 1.802e-56
Identity = 122/328 (37.20%), Postives = 179/328 (54.57%), Query Frame = 3
Query:  204 LTDENKQALLEKRLDVSHALNFERQQILKASEWPRHE--YTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLR---AKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGIT-PGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            +T ENKQ + E   +        +  ++K +    +E  +TP   +RCG+IA KIG  P W K G+R+  T+ Q++DN  + YIPP+E          Y+      PT     + G   VG+ T +P      Y+G+F   GV P++ LARF+VS +A + PGT L++ H+R+GDF+DV  ++ + GFQGV+ RH F G P +HG TK HRR G IGGG    R     KMPG MGNR R I+G+++ R++ KYNV+++ G +  GP     ++ DT L  R ++    P  PT Y E  +D        DD + + +  F   SI Y
Sbjct:   54 MTAENKQFVNEVGTNNFGVPAVIKDSLVKTAGPTANEAVWTP-NLRRCGVIARKIGQYPLWLKNGERIRTTLLQIVDNHVIKYIPPEE----------YLP--AQVPTVANLHKRGCILVGSETTNPALLTKEYAGIFRNSGVLPKKNLARFIVSPEAQLAPGTPLNVNHFRVGDFVDVRGKTVDHGFQGVVKRHGFKGMPASHGVTKTHRRAGNIGGGGEKGRVWPGTKMPGHMGNRWRIIKGLRVWRINTKYNVMWVQGSSVAGPTGGLVYIYDTILPTRKNKEA--PPFPTFYGEPQQD-------GDDVWYEQVHNFKSESITY 359          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Zebrafish
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030131-8227])

HSP 1 Score: 176.792 bits (447), Expect = 1.562e-51
Identity = 107/313 (34.19%), Postives = 164/313 (52.40%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDF 1124
            D  LT++N   L +   +    +  +R   LK   WPRHE+    ++R GL+A K+G++P W+K G+R ++TM QV D   + ++  ++             +N      V         VG     P      Y  +F   G+ P++KL  F V+++A+I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P +HG TK HRRPGA+G G +   V +  KMPG MGN      G++I R++ KYN+LY+NG  PG  +    + DT L  R+ E+ K+   PT +    + +     ++D F
Sbjct:   50 DEHLTEDNASFLKKLTAEEYDQMTKDRLNPLKDEPWPRHEWVE-GSRRVGLVAIKLGMMPVWSKSGERHVVTMLQVKDCHVVKHLSKED-------------YNGHTSALV---------VGGKNVSPFHRPVGYLEIFQNAGIPPKQKLTTFCVTDNAIIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGALGPGGDPAKVFKGTKMPGRMGNVYNTNFGLKIWRVNTKYNILYVNGSVPGHRNCLVKVRDTVLPTRL-EKNKNLPFPTFFADGNEELPEDLYDEDMF 338          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Xenopus
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:549348])

HSP 1 Score: 172.94 bits (437), Expect = 4.185e-50
Identity = 106/326 (32.52%), Postives = 165/326 (50.61%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            D  L++ENKQ L     +  HA    +   LK   WP   + P  + R G+IA K+G++P WTK G R  +TM QV D   + Y P +E +    +                        VG     P     +   L+ + GV P++K++ F VS++A+++PGT L   H+R G F+D+TA++   GFQGVM R  + G P +HG TK HRRPGAI  G    V    KMPG MGN  R    +++ R++ K+N++Y+NG  PG  +    + DT  K    + +++   PT +   ++ +      +D + D + +F +PS+ Y
Sbjct:   40 DEHLSEENKQFLKRVTAEEYHAQTASKLCPLKDEPWPTKPWEP-GSNRVGVIAVKLGMMPIWTKSGDRHAVTMLQVRDCHVVKYTPKEEFDGKTASLT----------------------VGGKNVSPFYKPESAMELYREAGVPPKQKISIFKVSDNAILKPGTPLYAAHFRPGQFVDITAKTIGKGFQGVMKRWGYKGQPASHGQTKTHRRPGAISSGDPARVFPGTKMPGRMGNVYRTSYALKVWRVNTKHNIIYVNGSVPGHTNCLVKVTDT--KLHGKKLSENLPFPTYFADGDEEL-----PEDLYDDEVFQFSEPSVKY 335          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Xenopus
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:549348])

HSP 1 Score: 172.94 bits (437), Expect = 4.553e-50
Identity = 106/326 (32.52%), Postives = 165/326 (50.61%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            D  L++ENKQ L     +  HA    +   LK   WP   + P  + R G+IA K+G++P WTK G R  +TM QV D   + Y P +E +    +                        VG     P     +   L+ + GV P++K++ F VS++A+++PGT L   H+R G F+D+TA++   GFQGVM R  + G P +HG TK HRRPGAI  G    V    KMPG MGN  R    +++ R++ K+N++Y+NG  PG  +    + DT  K    + +++   PT +   ++ +      +D + D + +F +PS+ Y
Sbjct:   45 DEHLSEENKQFLKRVTAEEYHAQTASKLCPLKDEPWPTKPWEP-GSNRVGVIAVKLGMMPIWTKSGDRHAVTMLQVRDCHVVKYTPKEEFDGKTASLT----------------------VGGKNVSPFYKPESAMELYREAGVPPKQKISIFKVSDNAILKPGTPLYAAHFRPGQFVDITAKTIGKGFQGVMKRWGYKGQPASHGQTKTHRRPGAISSGDPARVFPGTKMPGRMGNVYRTSYALKVWRVNTKHNIIYVNGSVPGHTNCLVKVTDT--KLHGKKLSENLPFPTYFADGDEEL-----PEDLYDDEVFQFSEPSVKY 340          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Xenopus
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:549348])

HSP 1 Score: 156.377 bits (394), Expect = 2.355e-44
Identity = 93/285 (32.63%), Postives = 148/285 (51.93%), Query Frame = 3
Query:  318 TPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
             P  + R G+IA K+G++P WTK G R  +TM QV D   + Y P +E +                       +     VG     P     +   L+ + GV P++K++ F VS++A+++PGT L   H+R G F+D+TA++   GFQGVM R  + G P +HG TK HRRPGAI  G    V    KMPG MGN  R    +++ R++ K+N++Y+NG  PG  +    + DT L  +  + +++   PT +   ++ +      +D + D + +F +PS+ Y
Sbjct:   32 CPPGSNRVGVIAVKLGMMPIWTKSGDRHAVTMLQVRDCHVVKYTPKEEFDG----------------------KTASLTVGGKNVSPFYKPESAMELYREAGVPPKQKISIFKVSDNAILKPGTPLYAAHFRPGQFVDITAKTIGKGFQGVMKRWGYKGQPASHGQTKTHRRPGAISSGDPARVFPGTKMPGRMGNVYRTSYALKVWRVNTKHNIIYVNGSVPGHTNCLVKVTDTKLHGK--KLSENLPFPTYFADGDEEL-----PEDLYDDEVFQFSEPSVKY 287          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Mouse
Match: Mrpl3 (mitochondrial ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:2137204])

HSP 1 Score: 152.91 bits (385), Expect = 2.141e-42
Identity = 107/328 (32.62%), Postives = 164/328 (50.00%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D +      +   LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P KE  N                      +     VG  T        +    +   G+ P++    F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F G P +HG TK HRRPGAI  G    V    KMPG MGN+ R + G+++ R++ K+N++Y+NG  PG  +    + D+ L    D   K+   PT + + DE+ +      +D F + + +  +PSI ++
Sbjct:   50 DEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTP-KEDHN---------------------GKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDS-CKNLPFPTYFPDGDEEEL-----PEDLFDESVWQPSEPSITFA 348          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Mouse
Match: Mrpl3 (mitochondrial ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:2137204])

HSP 1 Score: 148.673 bits (374), Expect = 2.891e-41
Identity = 92/274 (33.58%), Postives = 141/274 (51.46%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLC 1010
            D  L++EN   + +   D +      +   LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P ++     N +   +       +   +    L+F                  +   G+ P++    F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F G P +HG TK HRRPGAI  G    V    KMPG MGN+ R + G+++ R++ K+N++Y+NG  PG  +    +C
Sbjct:   50 DEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKED----HNGKIAALTVGGKTVSRFYKPDSRLEF------------------YRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKVC 300          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Mouse
Match: Mrpl3 (mitochondrial ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:2137204])

HSP 1 Score: 53.5286 bits (127), Expect = 2.955e-8
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  180 TSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKE 461
            +S   D  L++EN   + +   D +      +   LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P ++
Sbjct:   45 SSTWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKED 137          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Mouse
Match: Mrpl3 (mitochondrial ribosomal protein L3 [Source:MGI Symbol;Acc:MGI:2137204])

HSP 1 Score: 53.1434 bits (126), Expect = 3.649e-8
Identity = 31/94 (32.98%), Postives = 49/94 (52.13%), Query Frame = 3
Query:  180 TSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKE 461
            +S   D  L++EN   + +   D +      +   LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P ++
Sbjct:   37 SSTWWDEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTPKED 129          
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Match: sp|Q3ZBX6|RM03_BOVIN (39S ribosomal protein L3, mitochondrial OS=Bos taurus OX=9913 GN=MRPL3 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 2.756e-44
Identity = 110/326 (33.74%), Postives = 165/326 (50.61%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            D  L++EN   + +   D + A    +   LK   WP H + P  + R GL+A K+G++P WTK GK+ ++T+ QV D   L Y P KE  N                      +     VG  T      + +    + + G+ P++K+  F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGAI  G    V    KMPG +GN  R   G+++ R++ K+N++Y+NG  PG  +    + D+ L    D   K+   PT Y  DED  +     +D + + + +   PSI +
Sbjct:   50 DEHLSEENVSFVKQLVSDENKAQLASKLCPLKDEPWPIHPWEP-GSSRVGLVALKLGMMPLWTKDGKKHVVTLLQVQDCHVLKYTP-KENHN---------------------GKMAALTVGGKTVSRFHKSTSILEFYQELGLPPKQKIKMFNVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAISTGDVARVWPGTKMPGQLGNVDRTAFGLKVWRINTKHNIIYVNGSVPGHRNCLVKIKDSVLPAYKD-FCKNLPFPT-YFPDEDEKE---LPEDLYDEEVCQPGAPSITF 347          
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Match: sp|Q99N95|RM03_MOUSE (39S ribosomal protein L3, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl3 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.497e-41
Identity = 107/328 (32.62%), Postives = 164/328 (50.00%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D +      +   LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P KE  N                      +     VG  T        +    +   G+ P++    F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F G P +HG TK HRRPGAI  G    V    KMPG MGN+ R + G+++ R++ K+N++Y+NG  PG  +    + D+ L    D   K+   PT + + DE+ +      +D F + + +  +PSI ++
Sbjct:   50 DEHLSEENLSFVKQLVSDENKTQLTSKLNPLKDEPWPLHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTP-KEDHN---------------------GKIAALTVGGKTVSRFYKPDSRLEFYRDLGLPPKQIHKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGRMGNQNRTVYGLKVWRVNTKHNIIYVNGSVPGHKNCLVKIKDSTLPAYKDS-CKNLPFPTYFPDGDEEEL-----PEDLFDESVWQPSEPSITFA 348          
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Match: sp|P09001|RM03_HUMAN (39S ribosomal protein L3, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL3 PE=1 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.270e-40
Identity = 106/330 (32.12%), Postives = 163/330 (49.39%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL--FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQ--NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D   A    +   LK   WP H + P  + R GLIA K+G++P WTK G++ ++T+ QV D   L Y   +       T                        VG  T     F  A S L  + + G+ P++ +  F ++++A I+PGT L   H+R G ++DVTA++   GFQGVM R  F G P THG TK HRRPGA+  G    V    KMPG MGN  R   G+++ R++ K+N++Y+NG  PG  +    + D+ L    D     P  PT + + DE+ +      +D + +++ +   PSI ++
Sbjct:   50 DEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEP-GSFRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMATLS----------------------VGGKTVS--RFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLP-FPTYFPDGDEEEL-----PEDLYDENVCQPGAPSITFA 348          
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Match: sp|P18665|RM03_RAT (39S ribosomal protein L3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mrpl3 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.407e-40
Identity = 107/328 (32.62%), Postives = 164/328 (50.00%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGG--QNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVY-ETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            D  L++EN   + +   D + A        LK   WP H + P  + R GLIA K+G++P WTK G++  +T+ QV D   L Y P KE  N                      +     VG  TG       +    +   G+ P++    F V+++AVI+ GT L   H+R G ++DVTA++   GFQGVM R  F G P +HG TK HRRPGAI  G    V    KMPG MGN+ R + G+++ R++ K+N++Y+NG + G  +    + D+ L    D     P  PT + + DE+ +      +D + + +++  DPSI ++
Sbjct:   50 DEHLSEENVSFVKQLVSDENKAQLTSLLNPLKDEPWPLHPWEP-GSSRVGLIALKLGMMPLWTKDGQKHAVTLLQVQDCHVLKYTP-KEDHN---------------------GKTATLTVGGKTGSRLYKANSILEFYRDLGLPPKQTTKIFHVTDNAVIKQGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGAISTGDIARVWPGTKMPGKMGNQNRTVYGLKVWRVNTKHNIIYVNG-SVGHRNCLVKIKDSTLPAYKDLGKSLP-FPTYFPDGDEEEL-----PEDLYDESVRQPSDPSITFA 347          
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Match: sp|P49404|RM03_CAEEL (Putative 39S ribosomal protein L3, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mrps-18C PE=3 SV=3)

HSP 1 Score: 138.658 bits (348), Expect = 6.961e-36
Identity = 97/317 (30.60%), Postives = 151/317 (47.63%), Query Frame = 3
Query:  129 TPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMK--FNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIG--GGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPT 1067
            TP PW     ++      S +  S  T    + ++EK    +  + F+  Q    S        P  ++R GL+  KIG++P WT +G R+L T+ +V +N  ++   P   E  + +     +  FN   P W          VGA   DP ++   Y   F + G+  + KL  FLV+EDA+   G  L  +H+ +G ++  T ++ + GFQG M R    G P T  TTK+HRR G++G  G   +   K+MPG MG   R + G++IVR++    V+Y+ G  PG I     L D     + ++R K   MPT
Sbjct:   40 TPAPWLPPVKESVP---KSSVGISQGTKNLLETVIEKETLAASTIAFQNSQETNVSV----VDIPDSSRRVGLVVRKIGMLPQWTNEGNRILCTVLEVDENHVVSITSP---EAWYKSSAVGKRKAFNRHGPMWRVT-------VGAGNDDPTKYTLGYRRQFVRAGIPVKEKLGCFLVTEDALPSAGQPLDARHFGVGQYVTATGKTIDWGFQGGMHRWGMRGQP-TRRTTKSHRRIGSVGSVGDARIWPGKRMPGHMGYEWRTVSGLEIVRINVDKQVIYVKGSVPGDIGETILLKDC---LQEEKRLKSGPMPT 335          
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Match: A0A564YZ92 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11000 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 4.271e-96
Identity = 160/376 (42.55%), Postives = 229/376 (60.90%), Query Frame = 3
Query:   87 MTLSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQ--RYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAI-GGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHP---------SMPT----VYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            + LS + +  K  K  YPW N        Q      + D+T EN + L   R + +    F  + I+  +  P   + P +TQRCGL+  K+GI P WTK G+++  T+ Q+ DN A+ Y+PP +++   + +  R Y   N   P+WV Q+RWGLQ VGAM+ DP EF   + GLFT  G+ P+RK++RFLVS DA +EPGT L+I H+R+GD+IDVTAR+ N GFQGV+ R   +GGP  HG+TK HRR G++ G G+ +LR K+M GVMGNR R+ RG+QI+RM+ + N++YL+G TPGP+HSY  L D+WL  R  ER ++P         S+P     V +  E+  D     +D +   + +FDDPSI +
Sbjct:   19 VQLSLLRQLGKLTKFVYPWMNRRKPYWVDQKADPNLNEDVTPENAEFLAADR-EENFVNRFTGKSIMNETNRP---WLPMETQRCGLVGLKLGIYPMWTKDGRKVNCTILQIPDNHAMRYVPPSDLDKYLSLKDPRGYWLTNRHVPSWVNQRRWGLQLVGAMSADPAEFTPEWCGLFTSLGIPPKRKISRFLVSPDAALEPGTPLTINHFRVGDYIDVTARTINRGFQGVIERWGMSGGPAAHGSTKFHRRIGSLAGAGRKILRGKRMHGVMGNRYRSARGLQILRMNPRLNLIYLSGPTPGPVHSYCLLHDSWLINRRHEREENPPPNPTWFPSSLPPESTQVQDASENLFD--EFAEDIYYPTLHRFDDPSITF 388          
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Match: A0A1S8WVY0 (Ribosomal protein L3 (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05596 PE=4 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 1.102e-95
Identity = 165/388 (42.53%), Postives = 231/388 (59.54%), Query Frame = 3
Query:   33 RFLLLSKASNVKSLSIRQMTLSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQI-LKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQ--RYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPG-AIGGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKH-PSMPTVYETDEDW-IDWTTRED---DDFVDHIQKFDDPSIIYS 1169
            R  +  K+ N        +    +    K  K  YPW +        +      D DLT ENK  L  +RL     L  E ++  L   +W + E+ P  TQRCGLIA K+G+ P WTK G+RL  T++QV DN AL Y+PP +++   + +  R Y   +   P+W+ Q+RWGLQ VGA++ DP EF+AA+ GLF + GV P+RK++RFLV+ DA ++PGT L + H+RIGD++DVTAR+ N GFQGV+ R    GGP  HG+TK HRR G A G G  V+R K+M GVMGNR R  RG+ +VR++ K  ++Y+ G TPGP+H Y+ + D WL  R  E   + P +PT + TD+   ID+ + +D   D + D I + DD SI YS
Sbjct:    4 RVYVTFKSQNAAFCGDSALQCQPVRSVGKSSKVIYPWMDRRKPYWISETPDPRSDEDLTPENKSFLETERL-----LQMENKRTPLITEQWEQREWIPNVTQRCGLIAIKLGMYPLWTKTGRRLDCTIFQVPDNHALRYVPPSDIDQYISLRDPRGYWLNSKRIPSWIAQRRWGLQLVGAVSADPLEFSAAWCGLFKEAGVPPKRKVSRFLVTPDAALKPGTPLGVHHFRIGDYVDVTARTINRGFQGVIERWEMRGGPAAHGSTKFHRRMGSAAGTGGRVIRGKRMAGVMGNRFRHARGLMVVRINPKLGLIYVAGATPGPVHCYSLMHDCWLVNRRRELDANPPPVPTWFGTDDALTIDFESTDDFEADLYHDIIHRSDDVSISYS 386          
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Match: A0A0V0J5L4 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR125936 PE=4 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 1.213e-95
Identity = 160/376 (42.55%), Postives = 233/376 (61.97%), Query Frame = 3
Query:   87 MTLSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQ--RYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAI-GGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKH-PSMPTVYETDEDWIDWTTRED------DDFV-----DHIQKFDDPSIIYS 1169
            ++   +    K  K  YPW N        Q    + D  +T ENK+ LL++RL         R  ++      +  + P +TQRCGLIA K+G+ P W K+G+++  T+ QV DN AL Y+PP +++N  + +  R     N   P+W+TQKRWGLQ VGAM+ DP EF   + GLFT  GV P+RK++RFLVS DA ++PGT + +QH+RIGD++DVTAR+ N GFQGV+ R   +GGP  HG+TK HRR G++ G G+ V+R K+MPGVMGNR R++RG+QI+RM+ + N++YL+G TPGP+HS+  L D+WL  R  E  ++ P  PT +  +E+ +     +       DDF      + I ++D+PSI +S
Sbjct:   67 ISFYQVRNLGKLTKFIYPWMNRRKPYWVDQKADPLVDEGITYENKEFLLQERLKSG-----TRSPVISIRNTSK-PWLPLETQRCGLIAIKLGMYPLWDKRGEKIDCTILQVPDNHALRYVPPDQLDNYLSLRDPRGDWLNNQRLPSWITQKRWGLQIVGAMSADPIEFTPEWCGLFTSAGVAPKRKISRFLVSPDAALDPGTPIYMQHFRIGDYVDVTARTINRGFQGVIERWGMSGGPAIHGSTKFHRRVGSLAGAGKKVIRGKRMPGVMGNRYRSLRGLQILRMNPRLNLIYLSGPTPGPVHSFCLLHDSWLMNRQHELVENPPPNPTWFPNEEEAVKADENQHDTIDYFDDFAEDLYHESIHRYDEPSITFS 436          
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Match: A0A419QHP0 (39S ribosomal protein L3 OS=Clonorchis sinensis OX=79923 GN=MRPL3 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 2.342e-95
Identity = 163/386 (42.23%), Postives = 231/386 (59.84%), Query Frame = 3
Query:   39 LLLSKASNVKSLSIRQMTLSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQI-LKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQ--RYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGG-GQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKH-PSMPTVYETDE-DWIDWTTRED---DDFVDHIQKFDDPSIIYS 1169
            +L S  + +    +       +    K  K  YPW +        +      D DLT ENK  L  +RL     L  E ++  L   +W +  + P  TQRCGLIA K+G+ P WTK G+RL  T++QV DN AL Y+PP +++   + +  R Y   N   P+W+ Q+RWGLQ VGA++ DP EF+AA+ GLF + GV P+RK++RFLVS DA ++PGT L + H+RIGD++DVTAR+ N GFQGV+ R   +GGP  HG+TK HRR G+  G G  V+R K+M GVMGNR R  RG+ +VR++ K  ++Y+ G TPGP+H Y+ + D WL  R  E   + P +PT + TD+   ID+ + +D   D + D + + DD SI YS
Sbjct:    1 MLRSAMAQLSKYLLASCQCQPVRSVGKSSKVIYPWMDRRKPYWISETADPRSDEDLTPENKSFLETERL-----LQMENKRTPLITEQWEQRAWIPDVTQRCGLIAIKLGMYPLWTKTGRRLDCTIFQVPDNHALRYVPPSDIDQYISLKDPRGYWLNNKRMPSWIAQRRWGLQLVGAVSADPLEFSAAWCGLFKEAGVPPKRKISRFLVSPDAALKPGTPLGVHHFRIGDYVDVTARTINRGFQGVIERWGMSGGPAGHGSTKFHRRMGSSAGTGGRVIRGKRMAGVMGNRFRHARGLMVVRINPKLGLIYVAGATPGPVHCYSLMHDCWLVNRRRELNDNPPPVPTWFGTDDAPTIDYESTDDFEADLYHDILHRSDDVSISYS 381          
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Match: A0A068YAQ1 (39S ribosomal protein L3 mitochondrial OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000927800 PE=4 SV=2)

HSP 1 Score: 299.286 bits (765), Expect = 5.845e-95
Identity = 163/375 (43.47%), Postives = 225/375 (60.00%), Query Frame = 3
Query:   93 LSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQ--RYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGG-GQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKH-PSMPTVY-------------ETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            LS + +  K  K  YPW N        Q      D D+++EN + L  +R      L  +R      +      + P +TQRCGLIA K+GI P WTK GK++  T+ QV DN AL Y+PP +++   + +  R Y   N   P+WV Q+RWGLQ VGAM+ DP EF A + GLFT  GV P+RK++RFLVS DA +EPGT ++I H+R+GD++DVTAR+ N GFQGV+ R   +GGP  HG+TK HRR G++ G G+ +LR K+M GVMGNR R+ RG+QI+RM+ + N++YL+G T GP+HS+  L D+WL  R  +R +  P  PT +             E  +D  D     DD F   I +FD+PSI +
Sbjct:   21 LSCVRQLGKLTKFIYPWMNRRKPYWVDQKADPCCDEDVSNENLEFLAAER----QKLLVDRFTPTNFTAEANRPWLPMQTQRCGLIAIKLGIYPMWTKTGKKVDCTILQVPDNHALRYVPPSDLDRYLSLKDPRGYWLTNRHVPSWVNQRRWGLQIVGAMSADPVEFTAEWCGLFTSAGVPPKRKISRFLVSPDAALEPGTPITINHFRVGDYVDVTARTINRGFQGVIERWGMSGGPAAHGSTKFHRRIGSVAGSGRKILRGKRMHGVMGNRYRSSRGLQILRMNPRLNLIYLSGPTVGPVHSFCLLHDSWLINRWHKRNEDPPPNPTWFPSSLPSPPSSSPEEGLQDLFD--EFADDIFHSSIHRFDEPSITF 389          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Cavefish
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:103046956])

HSP 1 Score: 186.422 bits (472), Expect = 2.984e-55
Identity = 116/338 (34.32%), Postives = 177/338 (52.37%), Query Frame = 3
Query:  165 AKFQYTSKIQ-----DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDP 1154
            A FQ    I+     D  LT++N Q +     +    L  +R   LK   WPRHE+   +++R GL+A K+G++P WTK G R ++TM QVLD   + +IP +E +                       R     VG     P         +F   GV P++KL  F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F+G P +HG TK HRRPG++G G +   V +  KMPG MGN      G+++ R++ K N+LY+NG  PG  +    + DT L  R+ E+ ++P  PT +   E+ +      +D + +++ +F +P
Sbjct:   38 AGFQCIRTIKNSTWWDEHLTEDNAQFMRRSVSEEYKQLTSDRLNPLKDEPWPRHEWVE-QSRRVGLVALKLGMMPIWTKSGDRHVVTMVQVLDCHVIKHIPKEEYDG----------------------RTAALVVGGKNISPFHKADETLEIFRNAGVPPKQKLTTFRVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFSGQPASHGQTKTHRRPGSLGPGGDPAKVFKGTKMPGRMGNVYNTEFGLKVWRVNTKDNILYVNGSVPGHRNCLVKVRDTILPQRL-EKNRNPPFPTFFADGEEEL-----PEDLYDENVFQFVEP 346          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Cavefish
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:103046956])

HSP 1 Score: 186.422 bits (472), Expect = 2.984e-55
Identity = 116/338 (34.32%), Postives = 177/338 (52.37%), Query Frame = 3
Query:  165 AKFQYTSKIQ-----DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDP 1154
            A FQ    I+     D  LT++N Q +     +    L  +R   LK   WPRHE+   +++R GL+A K+G++P WTK G R ++TM QVLD   + +IP +E +                       R     VG     P         +F   GV P++KL  F V+++AVI+PGT L   H+R G ++DVTA++   GFQGVM R  F+G P +HG TK HRRPG++G G +   V +  KMPG MGN      G+++ R++ K N+LY+NG  PG  +    + DT L  R+ E+ ++P  PT +   E+ +      +D + +++ +F +P
Sbjct:   38 AGFQCIRTIKNSTWWDEHLTEDNAQFMRRSVSEEYKQLTSDRLNPLKDEPWPRHEWVE-QSRRVGLVALKLGMMPIWTKSGDRHVVTMVQVLDCHVIKHIPKEEYDG----------------------RTAALVVGGKNISPFHKADETLEIFRNAGVPPKQKLTTFRVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGFSGQPASHGQTKTHRRPGSLGPGGDPAKVFKGTKMPGRMGNVYNTEFGLKVWRVNTKDNILYVNGSVPGHRNCLVKVRDTILPQRL-EKNRNPPFPTFFADGEEEL-----PEDLYDENVFQFVEP 346          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Sea Lamprey
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:ZFIN;Acc:ZDB-GENE-030131-8227])

HSP 1 Score: 167.548 bits (423), Expect = 4.131e-49
Identity = 110/323 (34.06%), Postives = 166/323 (51.39%), Query Frame = 3
Query:  204 LTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAI--GGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            L++EN   L          L   R   LK   W RH +TP  ++R GL+A K+GI+P WTK G++  +T+ QV D   L ++  +E + +           TD           +  VG     P   +  +       GV P++K++ F VS+ A+++PGT L   H+R G ++DVTA++   GFQGVM R  ++G P THG TK HRR GAI   G   V    KMPG MGN  R   G+++ R++ KYNVLY++G  PG  +    + DT L  R+ +  ++P  PT +   E+ +      ++ F + +  FD PSI +
Sbjct:   28 LSEENNAFLRRHIKQEFTELTAARLNPLKDEPWSRHTWTP-GSRRVGLVAVKLGIMPAWTKSGEKQPVTVLQVQDCHVLQHLSKEEYDGV-----------TD-----------VLLVGGKNVSPFSHSRVHLERCRLAGVPPKQKVSVFEVSKHALVKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMKRWGYSGQPATHGQTKTHRRMGAIAAAGPARVWPGTKMPGRMGNIYRTEHGLKVWRVNTKYNVLYVHGSIPGHKNCLVKVRDTILHNRL-KFNENPPFPTYFADGEEELP-----EELFDEELFNFDQPSITF 321          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Yeast
Match: MRPL9 (Mitochondrial ribosomal protein of the large subunit [Source:SGD;Acc:S000003452])

HSP 1 Score: 99.7525 bits (247), Expect = 1.454e-24
Identity = 72/236 (30.51%), Postives = 118/236 (50.00%), Query Frame = 3
Query:  333 QRCGLIAYKIGIIPHWTKK-GKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVS-EDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLK 1025
            +RCGLI  K G++P++ K  G+R   T+ +V +NV +      EV   F  Q   + + + + + V+++  G                     F    V P+  +A F V  E  +I PGT L    ++ G ++DV + S   GF GVM R+ F G   +HGT+  HR  G+ G  Q+   VL  +KMPG MGN    I+ ++++++D + NV+++ G   GP +S+  + D   K
Sbjct:   57 KRCGLITRKKGMMPYFDKSTGERSAATILEV-NNVEVIMHRTSEVNGYFACQ---VGYGSRHLSKVSRQMLGH--------------------FASKVVNPKEHVAEFRVKDEKGLIPPGTLLKPSFFKEGQYVDVRSVSKGKGFTGVMKRYGFKGLRASHGTSIMHRHGGSYGQNQDPGRVLPGRKMPGHMGNEHVTIQNVKVLKVDDENNVIWVKGSVAGPKNSFVKIQDAIKK 268          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Nematostella
Match: EDO33905 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQV4])

HSP 1 Score: 141.739 bits (356), Expect = 1.051e-39
Identity = 87/283 (30.74%), Postives = 140/283 (49.47%), Query Frame = 3
Query:  330 TQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTG-DPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLR---AKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            ++R G +  K+G+   W K G+RL +T+ Q+ D   +               R         P    Q       VGA+   +  +   A  G F ++ V P+RK+  F V+ DA++ PGT ++  H+  G ++ +   + + GFQGVM R    G P +HG +K HR+ GA GGGQ+  R    KKM G MGN+   +  +++ R++ KYNVLY+ G  PGP   +  + D W ++        P  PT  +  E  +     E+D + ++IQ+F++ SI Y
Sbjct:    6 SKRTGAVGVKLGMSALWLKDGRRLPVTLIQIKDCEVVQA-------------RVAKGHGGRDPQTELQ-------VGAVNKLELNQIGKAQFGHFKRFSVRPKRKVCSFPVTPDALLTPGTPITAAHFYPGQYVKIQGVTKDKGFQGVMKRWGMGGQPASHGQSKTHRKMGATGGGQDPGRVWPGKKMAGHMGNKNCTLHAVRVHRINTKYNVLYVQGQCPGPTGGFLKISDAWKRH-----PHAPPFPTHMDEPEKAL-----EEDLYAENIQRFNEESINY 258          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Nematostella
Match: EDO25704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVQ6])

HSP 1 Score: 83.1889 bits (204), Expect = 9.906e-19
Identity = 48/141 (34.04%), Postives = 75/141 (53.19%), Query Frame = 3
Query:  588 NAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAG-GPDTHGTTKNHRRPGAIGGGQ---NVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSY 998
            N A  G F K G T +RK+  F   E+   + G  ++++H+  G+F+DV+  S   GFQGV+ RH F G G  THG     R PG+IG       V +  +M G MG     ++ ++++++    N+L + G  PG  +SY
Sbjct:   61 NKALDGHFKKAGATAKRKVVEFQGFEEE-YKLGDSITVEHFEEGEFVDVSGISKGKGFQGVVKRHGFGGVGQATHGQHNRLRAPGSIGAASYPARVFKGMRMAGRMGGEKVKVQNLRVLKVVADKNLLVVKGAIPGHKNSY 200          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Medaka
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:101164412])

HSP 1 Score: 177.563 bits (449), Expect = 5.972e-52
Identity = 116/328 (35.37%), Postives = 164/328 (50.00%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS 1169
            +  LT++N++ +     +       ER   LK   WPRHE+T   ++R GL+A K+G+ P WTK G+R  +TM QV D   +  +  +E +                             VG     P   +     LF   GV P++K+  F VS++A+I+PGT L   H+R G ++DVTA+S   GFQGVM R  F G P +HG TK HRRPGA G G +   V + KKMPG MGN      G++I R++ KYNVLY++G  PG  +    + DT L  R      +P  PT +  +E  +D     DD FV       +PS+  S
Sbjct:   43 EEHLTEDNQKYMRHSMAEEYRRQTAERLCPLKDEPWPRHEWTE-GSRRVGLVAIKLGMAPIWTKSGERHAVTMLQVQDCHVIRCMSKEEYDG----------------------HSAALAVGGKNVSPFYRSEKAMELFRNAGVPPKQKVTIFKVSDNAIIKPGTPLYAAHFRPGQYVDVTAKSIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGASGPGGDPAKVFKGKKMPGKMGNVFVTAYGLKIWRVNTKYNVLYVHGSVPGHTNCVLKVRDTVLPTR-RSTILNPPFPTYFTEEEGDLDEDLYNDDLFVH-----TEPSVTLS 341          
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Medaka
Match: mrpl3 (mitochondrial ribosomal protein L3 [Source:NCBI gene;Acc:101164412])

HSP 1 Score: 167.548 bits (423), Expect = 5.618e-48
Identity = 107/287 (37.28%), Postives = 149/287 (51.92%), Query Frame = 3
Query:  195 DSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQN---VLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERT 1046
            +  LT++N++ +     +       ER   LK   WPRHE+T   ++R GL+A K+G+ P WTK G+R  +TM QV D   +  +  +E +                             VG     P   +     LF   GV P++K+  F VS++A+I+PGT L   H+R G ++DVTA+S   GFQGVM R  F G P +HG TK HRRPGA G G +   V + KKMPG MGN      G++I R++ KYNVLY++G  PG  H+     +  LK RI  RT
Sbjct:   43 EEHLTEDNQKYMRHSMAEEYRRQTAERLCPLKDEPWPRHEWTE-GSRRVGLVAIKLGMAPIWTKSGERHAVTMLQVQDCHVIRCMSKEEYDG----------------------HSAALAVGGKNVSPFYRSEKAMELFRNAGVPPKQKVTIFKVSDNAIIKPGTPLYAAHFRPGQYVDVTAKSIGKGFQGVMKRWGFKGQPASHGQTKTHRRPGASGPGGDPAKVFKGKKMPGKMGNVFVTAYGLKIWRVNTKYNVLYVHGSVPG--HT-----NCVLKVRIIRRT 299          
BLAST of 50S ribosomal protein L3, putative vs. Planmine SMEST
Match: SMESG000077764.1 (SMESG000077764.1)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 359/360 (99.72%), Postives = 359/360 (99.72%), Query Frame = 3
Query:   87 MTLSSITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 1166
            MTLS ITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY
Sbjct:    1 MTLSLITKSNKFDKTPYPWKNYDYQNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPRHEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPKEVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGLFTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLGFQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLRAKKMPGVMGNRLRAIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPSMPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIY 360          
The following BLAST results are available for this feature:
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRPL31.739e-4132.12mitochondrial ribosomal protein L3 [Source:HGNC Sy... [more]
MRPL32.644e-4132.12mitochondrial ribosomal protein L3 [Source:HGNC Sy... [more]
MRPL34.598e-4132.12mitochondrial ribosomal protein L3 [Source:HGNC Sy... [more]
MRPL39.099e-2334.83mitochondrial ribosomal protein L3 [Source:HGNC Sy... [more]
MRPL34.825e-832.32mitochondrial ribosomal protein L3 [Source:HGNC Sy... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps-18C5.472e-3730.60Putative 39S ribosomal protein L3, mitochondrial ... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpL31.802e-5637.20gene:FBgn0030686 transcript:FBtr0074090[more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl31.562e-5134.19mitochondrial ribosomal protein L3 [Source:ZFIN;Ac... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mrpl34.185e-5032.52mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
mrpl34.553e-5032.52mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
mrpl32.355e-4432.63mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mrpl32.141e-4232.62mitochondrial ribosomal protein L3 [Source:MGI Sym... [more]
Mrpl32.891e-4133.58mitochondrial ribosomal protein L3 [Source:MGI Sym... [more]
Mrpl32.955e-832.98mitochondrial ribosomal protein L3 [Source:MGI Sym... [more]
Mrpl33.649e-832.98mitochondrial ribosomal protein L3 [Source:MGI Sym... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZBX6|RM03_BOVIN2.756e-4433.7439S ribosomal protein L3, mitochondrial OS=Bos tau... [more]
sp|Q99N95|RM03_MOUSE1.497e-4132.6239S ribosomal protein L3, mitochondrial OS=Mus mus... [more]
sp|P09001|RM03_HUMAN1.270e-4032.1239S ribosomal protein L3, mitochondrial OS=Homo sa... [more]
sp|P18665|RM03_RAT1.407e-4032.6239S ribosomal protein L3, mitochondrial OS=Rattus ... [more]
sp|P49404|RM03_CAEEL6.961e-3630.60Putative 39S ribosomal protein L3, mitochondrial O... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YZ924.271e-9642.55Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1S8WVY01.102e-9542.53Ribosomal protein L3 (Fragment) OS=Opisthorchis vi... [more]
A0A0V0J5L41.213e-9542.55Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A419QHP02.342e-9542.2339S ribosomal protein L3 OS=Clonorchis sinensis OX... [more]
A0A068YAQ15.845e-9543.4739S ribosomal protein L3 mitochondrial OS=Echinoco... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl32.984e-5534.32mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
mrpl32.984e-5534.32mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl34.131e-4934.06mitochondrial ribosomal protein L3 [Source:ZFIN;Ac... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MRPL91.454e-2430.51Mitochondrial ribosomal protein of the large subun... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO339051.051e-3930.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257049.906e-1934.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrpl35.972e-5235.37mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
mrpl35.618e-4837.28mitochondrial ribosomal protein L3 [Source:NCBI ge... [more]
back to top
BLAST of 50S ribosomal protein L3, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077764.10.000e+099.72SMESG000077764.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005659 ID=SMED30005659|Name=50S ribosomal protein L3, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1179bp
TTTGTTAAATGTCTGCAATTACTAATTGTGTAAGATTTCTATTGTTAAGT
AAAGCATCAAATGTTAAATCCTTATCAATTCGTCAAATGACATTATCTTC
AATTACCAAAAGTAATAAATTTGATAAAACTCCATATCCCTGGAAGAATT
ATGATTATCAAAATGCTAAATTTCAATACACTAGTAAAATTCAAGATAGT
GACTTAACAGATGAAAATAAGCAGGCATTACTTGAAAAAAGATTAGATGT
ATCACATGCTTTGAATTTTGAACGTCAACAAATTTTGAAAGCATCTGAAT
GGCCACGCCATGAGTATACTCCATTTAAAACTCAGAGATGTGGATTAATA
GCTTATAAAATTGGTATAATTCCTCATTGGACAAAAAAAGGCAAAAGATT
GTTAATTACAATGTATCAGGTTCTGGATAATGTTGCATTAAATTATATTC
CACCTAAAGAAGTTGAAAATATGTTTAATACCCAACGATATTATATGAAA
TTTAATACTGATTACCCGACATGGGTTACTCAAAAGAGATGGGGATTACA
ATTTGTGGGTGCAATGACTGGAGATCCCGGTGAATTCAATGCTGCATATT
CTGGTTTATTTACCAAATATGGTGTTACACCTCGCAGGAAGCTAGCACGT
TTTTTAGTCAGTGAAGATGCAGTAATCGAGCCAGGAACGGAATTATCTAT
TCAACATTATCGAATTGGGGATTTTATCGACGTTACAGCACGATCTTCTA
ATTTGGGATTTCAAGGTGTAATGGTACGCCACAGATTTGCAGGTGGGCCA
GATACTCATGGAACAACTAAAAACCATCGAAGACCGGGAGCAATTGGAGG
CGGACAAAATGTATTACGAGCCAAGAAAATGCCAGGCGTGATGGGTAACC
GATTGCGGGCAATACGTGGCATTCAGATTGTTCGAATGGATTATAAATAT
AACGTTCTCTATCTAAATGGCATTACTCCTGGACCAATTCACAGTTACGC
TCATTTGTGTGATACATGGCTAAAATACAGAATTGATGAAAGAACTAAAC
ATCCTTCAATGCCAACTGTTTATGAAACAGACGAGGATTGGATTGACTGG
ACCACAAGAGAAGATGATGATTTTGTTGATCACATCCAGAAATTTGATGA
TCCTTCAATAATATATTCTTAGAAAATTT
back to top

protein sequence of SMED30005659-orf-1

>SMED30005659-orf-1 ID=SMED30005659-orf-1|Name=SMED30005659-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MSAITNCVRFLLLSKASNVKSLSIRQMTLSSITKSNKFDKTPYPWKNYDY
QNAKFQYTSKIQDSDLTDENKQALLEKRLDVSHALNFERQQILKASEWPR
HEYTPFKTQRCGLIAYKIGIIPHWTKKGKRLLITMYQVLDNVALNYIPPK
EVENMFNTQRYYMKFNTDYPTWVTQKRWGLQFVGAMTGDPGEFNAAYSGL
FTKYGVTPRRKLARFLVSEDAVIEPGTELSIQHYRIGDFIDVTARSSNLG
FQGVMVRHRFAGGPDTHGTTKNHRRPGAIGGGQNVLRAKKMPGVMGNRLR
AIRGIQIVRMDYKYNVLYLNGITPGPIHSYAHLCDTWLKYRIDERTKHPS
MPTVYETDEDWIDWTTREDDDFVDHIQKFDDPSIIYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR019927Ribosomal_L3_bac/org-type
IPR000597Ribosomal_L3
IPR009000Transl_B-barrel_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000597Ribosomal protein L3PFAMPF00297Ribosomal_L3coord: 220..311
e-value: 1.5E-10
score: 40.6
IPR019927Ribosomal protein L3, bacterial/organelle-typePANTHERPTHR1122950S RIBOSOMAL PROTEIN L3coord: 56..384
NoneNo IPR availablePANTHERPTHR11229:SF839S RIBOSOMAL PROTEIN L3, MITOCHONDRIALcoord: 56..384
IPR009000Translation protein, beta-barrel domain superfamilySUPERFAMILYSSF50447Translation proteinscoord: 110..337