SMED30005641
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30005641 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 2
Alignments
SMED30005641 aligns in the following genomic locations:
Homology
BLAST of SMED30005641 vs. Planmine SMEST
Match: SMESG000046718.1 (SMESG000046718.1) HSP 1 Score: 65.0846 bits (157), Expect = 2.624e-13 Identity = 27/34 (79.41%), Postives = 29/34 (85.29%), Query Frame = -3 Query: 2 LTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 103 LTED LLALPQKVNH + HLC QQGMHLIK+QD Sbjct: 102 LTEDHLLALPQKVNHASSFHLCQQQGMHLIKVQD 135 HSP 2 Score: 54.299 bits (129), Expect = 1.295e-9 Identity = 23/34 (67.65%), Postives = 28/34 (82.35%), Query Frame = -3 Query: 2 LTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 103 L EDQLLALP KVN +AV LC +QGM+L+K+QD Sbjct: 227 LIEDQLLALPGKVNQNQAVKLCQEQGMNLVKVQD 260
BLAST of SMED30005641 vs. Planmine SMEST
Match: SMESG000031111.1 (SMESG000031111.1) HSP 1 Score: 53.5286 bits (127), Expect = 2.412e-9 Identity = 24/36 (66.67%), Postives = 28/36 (77.78%), Query Frame = -3 Query: 2 AYLTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 109 A + EDQL+ALP KVN AV LC QQGM+LI+IQD Sbjct: 85 ASIGEDQLIALPNKVNQPTAVQLCRQQGMNLIRIQD 120
BLAST of SMED30005641 vs. Planmine SMEST
Match: SMESG000046618.1 (SMESG000046618.1) HSP 1 Score: 50.8322 bits (120), Expect = 1.819e-8 Identity = 20/34 (58.82%), Postives = 27/34 (79.41%), Query Frame = -3 Query: 2 LTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 103 +TEDQL+ALP K N ++AV LC GM+L+K+QD Sbjct: 11 ITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQD 44
BLAST of SMED30005641 vs. Planmine SMEST
Match: SMESG000046618.1 (SMESG000046618.1) HSP 1 Score: 50.447 bits (119), Expect = 2.775e-8 Identity = 20/34 (58.82%), Postives = 27/34 (79.41%), Query Frame = -3 Query: 2 LTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 103 +TEDQL+ALP K N ++AV LC GM+L+K+QD Sbjct: 78 ITEDQLIALPNKANQQQAVQLCQNNGMNLVKVQD 111
BLAST of SMED30005641 vs. Planmine SMEST
Match: SMESG000008789.1 (SMESG000008789.1) HSP 1 Score: 43.8986 bits (102), Expect = 5.794e-6 Identity = 18/36 (50.00%), Postives = 27/36 (75.00%), Query Frame = -3 Query: 2 AYLTEDQLLALPQKVNHEKAVHLCHQQGMHLIKIQD 109 A L E+QL+ALP K+N + A++ C Q ++L+KIQD Sbjct: 12 AILLENQLVALPNKLNKKDALNFCKSQSLNLVKIQD 47 The following BLAST results are available for this feature:
BLAST of SMED30005641 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30005641 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30005641 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30005641 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30005641 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30005641 ID=SMED30005641|Name=SMED30005641|organism=Schmidtea mediterranea sexual|type=transcript|length=351bpback to top Annotated Terms
The following terms have been associated with this transcript:
|