Phosphatidylinositol 4 phosphate 5 kinase type 1

Overview
NamePhosphatidylinositol 4 phosphate 5 kinase type 1
Smed IDSMED30005638
Length (bp)3118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 4 phosphate 5 kinase type 1 (SMED30005638) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 4 phosphate 5 kinase type 1 (SMED30005638) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 4 phosphate 5 kinase type 1 (SMED30005638) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 4 phosphate 5 kinase type 1 (SMED30005638) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005638

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30005638SMESG000017265.1 SmedASXL_015873SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30005638SMESG000017265.1 dd_Smed_v4_10693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30005638SMESG000017265.1 dd_Smed_v4_10693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30005638SMESG000017265.1 Contig33941newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30005638SMESG000017265.1 Contig33941uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30005638SMESG000017265.1 Contig22544newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30005638SMESG000017265.1 Contig22544uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Match: PIP5K1A (phosphatidylinositol-4-phosphate 5-kinase type 1 alpha [Source:HGNC Symbol;Acc:HGNC:8994])

HSP 1 Score: 350.903 bits (899), Expect = 4.101e-109
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   51 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 325          

HSP 2 Score: 56.9954 bits (136), Expect = 1.558e-7
Identity = 38/121 (31.40%), Postives = 53/121 (43.80%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            RE  + +   S  TRR A     +ST +ESIQ    +     +D++++                               KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP
Sbjct:  325 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDQFV-------------------------------KKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIP 414          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Match: PIP5K1A (phosphatidylinositol-4-phosphate 5-kinase type 1 alpha [Source:HGNC Symbol;Acc:HGNC:8994])

HSP 1 Score: 348.977 bits (894), Expect = 9.897e-109
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   50 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 324          

HSP 2 Score: 113.235 bits (282), Expect = 1.732e-25
Identity = 62/131 (47.33%), Postives = 81/131 (61.83%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS--LDQPQIL 2144
            RE  + +   S  TRR A     +ST +ESIQ    +     +D+     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP   L +P +L
Sbjct:  324 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDH---MGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGRPDVL 451          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Match: PIP5K1A (phosphatidylinositol-4-phosphate 5-kinase type 1 alpha [Source:HGNC Symbol;Acc:HGNC:8994])

HSP 1 Score: 350.903 bits (899), Expect = 1.000e-108
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   51 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 325          

HSP 2 Score: 111.694 bits (278), Expect = 9.691e-25
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            RE  + +   S  TRR A     +ST +ESIQ    +     +D+     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP
Sbjct:  325 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDH---MGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIP 442          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Match: PIP5K1A (phosphatidylinositol-4-phosphate 5-kinase type 1 alpha [Source:HGNC Symbol;Acc:HGNC:8994])

HSP 1 Score: 350.132 bits (897), Expect = 1.399e-108
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   50 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 324          

HSP 2 Score: 111.309 bits (277), Expect = 1.081e-24
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            RE  + +   S  TRR A     +ST +ESIQ    +     +D+     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP
Sbjct:  324 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDH---MGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIP 441          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Match: PIP5K1A (phosphatidylinositol-4-phosphate 5-kinase type 1 alpha [Source:HGNC Symbol;Acc:HGNC:8994])

HSP 1 Score: 350.517 bits (898), Expect = 1.920e-108
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   63 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 337          

HSP 2 Score: 111.309 bits (277), Expect = 1.191e-24
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            RE  + +   S  TRR A     +ST +ESIQ    +     +D+     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP
Sbjct:  337 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDH---MGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIP 454          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Celegans
Match: ppk-1 (PIP Kinase [Source:UniProtKB/TrEMBL;Acc:O01759])

HSP 1 Score: 367.081 bits (941), Expect = 1.328e-114
Identity = 166/285 (58.25%), Postives = 221/285 (77.54%), Query Frame = 3
Query:  135 KSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            K K+GHRRI+++G V+YKK  T+ + +A+QLGI  ++    +   RD+LL+DF  V+ + FP  G   TPSH   DF F+T+APIAFRYFR+ F +   D+L SIC + L+ELSNAGASGSIFY++ DD+FIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKF+GL+CYQ++GKNIR ++MNNL+P ++ +HEKYD+KGSTYKR AN+ E+ KP PTLKDLDF +NH + ++++    EALM +I RDC V+ESF IMDYSLL+GIHN++  ++ R E  +E
Sbjct:   64 KEKLGHRRIDEQGGVSYKKVPTNALMQAIQLGISNSIGSLASLPNRDVLLQDFEKVDIVAFPAAGSTITPSHSFGDFRFRTYAPIAFRYFRNLFHIKPADFLRSICTEPLKELSNAGASGSIFYVSQDDQFIIKTVQHKEADFLQKLLPGYYMNLNQNPRTLLPKFFGLFCYQSLGKNIRLLVMNNLLPQTVTMHEKYDMKGSTYKRMANKAERAKPHPTLKDLDFLENHKDGIFIDPTALEALMKSISRDCLVMESFKIMDYSLLVGIHNVELGIKERAEQNRE 348          

HSP 2 Score: 103.99 bits (258), Expect = 1.506e-22
Identity = 47/78 (60.26%), Postives = 56/78 (71.79%), Query Frame = 3
Query: 1899 IPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQ 2132
            +P GG+PARN  GDRL+L++GIIDILQ+YR++KKMEH  KAI  D   ISV NP FYA RF  F    VFKK  +L Q
Sbjct:  385 VPHGGVPARNSNGDRLVLYLGIIDILQNYRLLKKMEHTWKAILHDGDTISVHNPNFYASRFLTFMTEKVFKKGTALKQ 462          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Celegans
Match: ppk-2 (PIP Kinase [Source:UniProtKB/TrEMBL;Acc:Q9BL73])

HSP 1 Score: 107.457 bits (267), Expect = 1.804e-24
Identity = 75/234 (32.05%), Postives = 122/234 (52.14%), Query Frame = 3
Query:  342 PSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELR-ELSNAGASGSI--FYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQ-HPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNL-----RMRKENEQEQKNHALSSP 1013
            PSH    +  K + P  FR  R+ F VD  +YL S+   E   +L +  A  S   F+I+ D +F+IK++  +  + L  +L  Y+  +++   +TLLP++ GLY     G     ++M N+      +H K+DLKGST  R+A++ EK K  PTLKD DF +  +  L L  +  + L+  +  D   L    +MDYSLL+GIH+ ++       R  ++N +E  +    +P
Sbjct:   79 PSH----YKVKEYCPNVFRNLREQFGVDNFEYLRSLTSYEPEPDLLDGSAKDSTPRFFISYDKKFVIKSMDSEAVAELHSVLRNYHQYVVEKQGKTLLPQYLGLYRLTIEGSETYLIVMRNVFGRKYGVHTKFDLKGSTVSRAASDKEKAKDLPTLKDNDFLE-QNWKLNLPPEAGKLLIEMLTSDTEWLTRMHLMDYSLLVGIHDCERAAQEAANRPVEQNSEESGDELAPTP 307          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Celegans
Match: ppk-3 (PIP Kinase [Source:UniProtKB/TrEMBL;Acc:G5ED98])

HSP 1 Score: 69.3218 bits (168), Expect = 1.472e-11
Identity = 56/175 (32.00%), Postives = 84/175 (48.00%), Query Frame = 3
Query:  462 LRELSNA-------GASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYY----INLIQHPRTLLPKFYGL----YCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKN-HDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGI 938
            +R LSN+       G SGS FY T DD F++K +   E     K  P Y+     +  +   T L K YG+    Y  +T    +  ++M  L  +  + + +DLKGS   R A+ T K+     L D +F K+  ++ LY+   +  A+   I  D   L S  IMDYSLL+G+
Sbjct: 1249 IRSLSNSTFWTPQGGKSGSFFYRTQDDRFVVKQMSRFEIQSFVKFAPNYFDYLTTSATESKLTTLCKVYGVFRIGYKSKTTTLKVDILVMEYLFYNHNVSQVWDLKGSLRNRLAS-TGKSANEMVLLDENFVKDLWNQQLYVLPHSKAAMNQAISNDSHFLSSQYIMDYSLLVGV 1422          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Match: PIP5K59B (gene:FBgn0034789 transcript:FBtr0071900)

HSP 1 Score: 366.311 bits (939), Expect = 8.967e-113
Identity = 178/293 (60.75%), Postives = 220/293 (75.09%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTM-GKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQK 992
            K  KE+ KIGHRR+ + G +TYKK  TS+I  ++QLGI+ TV    +K KRD+L+ DF  +E++ FP  G   TP+H  S+F +K +APIAFRYFRD F +   D++ S+C   LRELSN GASGSIFY+T DDEFIIKTVQHKE  FLQKLLP YY+NL Q+PRTLLPKF+GLYC QT   KNIR V+MNNL+P S+++H KYDLKGST+KR AN+ E+ K SPT KDLDF + H   ++LE +TY AL+ TIQRDC VLESF IMDYSLLLG+HNLD  L   KE + EQ+
Sbjct:   52 KADKER-KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL---KEKQSEQR 340          

HSP 2 Score: 127.102 bits (318), Expect = 1.565e-29
Identity = 63/112 (56.25%), Postives = 83/112 (74.11%), Query Frame = 3
Query: 1794 SRSKST--RRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS 2123
            SR+KS   +R+ A ST +ESIQA  E ++    DEE +P GGIPAR++ G+RL+L++GIIDILQSYR+ KK+EH  K+I  D   +SV  P+FYAQRFQ+F A  VF+KIPS
Sbjct:  368 SRNKSVNRQRLVAHSTAMESIQAESEPID----DEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPS 475          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Match: PIP5K59B (gene:FBgn0034789 transcript:FBtr0304923)

HSP 1 Score: 366.311 bits (939), Expect = 1.716e-112
Identity = 178/293 (60.75%), Postives = 220/293 (75.09%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTM-GKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQK 992
            K  KE+ KIGHRR+ + G +TYKK  TS+I  ++QLGI+ TV    +K KRD+L+ DF  +E++ FP  G   TP+H  S+F +K +APIAFRYFRD F +   D++ S+C   LRELSN GASGSIFY+T DDEFIIKTVQHKE  FLQKLLP YY+NL Q+PRTLLPKF+GLYC QT   KNIR V+MNNL+P S+++H KYDLKGST+KR AN+ E+ K SPT KDLDF + H   ++LE +TY AL+ TIQRDC VLESF IMDYSLLLG+HNLD  L   KE + EQ+
Sbjct:   52 KADKER-KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL---KEKQSEQR 340          

HSP 2 Score: 127.102 bits (318), Expect = 1.740e-29
Identity = 63/112 (56.25%), Postives = 83/112 (74.11%), Query Frame = 3
Query: 1794 SRSKST--RRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS 2123
            SR+KS   +R+ A ST +ESIQA  E ++    DEE +P GGIPAR++ G+RL+L++GIIDILQSYR+ KK+EH  K+I  D   +SV  P+FYAQRFQ+F A  VF+KIPS
Sbjct:  368 SRNKSVNRQRLVAHSTAMESIQAESEPID----DEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPS 475          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Match: PIP5K59B (gene:FBgn0034789 transcript:FBtr0290095)

HSP 1 Score: 365.925 bits (938), Expect = 2.278e-112
Identity = 178/293 (60.75%), Postives = 220/293 (75.09%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTM-GKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQK 992
            K  KE+ KIGHRR+ + G +TYKK  TS+I  ++QLGI+ TV    +K KRD+L+ DF  +E++ FP  G   TP+H  S+F +K +APIAFRYFRD F +   D++ S+C   LRELSN GASGSIFY+T DDEFIIKTVQHKE  FLQKLLP YY+NL Q+PRTLLPKF+GLYC QT   KNIR V+MNNL+P S+++H KYDLKGST+KR AN+ E+ K SPT KDLDF + H   ++LE +TY AL+ TIQRDC VLESF IMDYSLLLG+HNLD  L   KE + EQ+
Sbjct:   52 KADKER-KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL---KEKQSEQR 340          

HSP 2 Score: 152.91 bits (385), Expect = 9.663e-38
Identity = 80/159 (50.31%), Postives = 113/159 (71.07%), Query Frame = 3
Query: 1794 SRSKST--RRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFV--HMAMRQNPDRKRTSSVRKENLIPSDKE 2258
            SR+KS   +R+ A ST +ESIQA  E ++    DEE +P GGIPAR++ G+RL+L++GIIDILQSYR+ KK+EH  K+I  D   +SV  P+FYAQRFQ+F A  VF+KIPSLD P+I G+H R+FR  V  ++A++ +P ++++ S   +  I SD E
Sbjct:  368 SRNKSVNRQRLVAHSTAMESIQAESEPID----DEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPSLDLPEIKGNH-RKFRTLVTSYIALKHSPSKRKSLSKAIQRSIDSDNE 521          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Match: PIP5K59B (gene:FBgn0034789 transcript:FBtr0304921)

HSP 1 Score: 366.311 bits (939), Expect = 3.088e-112
Identity = 178/293 (60.75%), Postives = 220/293 (75.09%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTM-GKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQK 992
            K  KE+ KIGHRR+ + G +TYKK  TS+I  ++QLGI+ TV    +K KRD+L+ DF  +E++ FP  G   TP+H  S+F +K +APIAFRYFRD F +   D++ S+C   LRELSN GASGSIFY+T DDEFIIKTVQHKE  FLQKLLP YY+NL Q+PRTLLPKF+GLYC QT   KNIR V+MNNL+P S+++H KYDLKGST+KR AN+ E+ K SPT KDLDF + H   ++LE +TY AL+ TIQRDC VLESF IMDYSLLLG+HNLD  L   KE + EQ+
Sbjct:   52 KADKER-KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL---KEKQSEQR 340          

HSP 2 Score: 152.91 bits (385), Expect = 1.059e-37
Identity = 80/159 (50.31%), Postives = 113/159 (71.07%), Query Frame = 3
Query: 1794 SRSKST--RRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFV--HMAMRQNPDRKRTSSVRKENLIPSDKE 2258
            SR+KS   +R+ A ST +ESIQA  E ++    DEE +P GGIPAR++ G+RL+L++GIIDILQSYR+ KK+EH  K+I  D   +SV  P+FYAQRFQ+F A  VF+KIPSLD P+I G+H R+FR  V  ++A++ +P ++++ S   +  I SD E
Sbjct:  368 SRNKSVNRQRLVAHSTAMESIQAESEPID----DEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPSLDLPEIKGNH-RKFRTLVTSYIALKHSPSKRKSLSKAIQRSIDSDNE 521          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Match: PIP5K59B (gene:FBgn0034789 transcript:FBtr0339762)

HSP 1 Score: 365.925 bits (938), Expect = 4.416e-112
Identity = 178/293 (60.75%), Postives = 220/293 (75.09%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTM-GKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQK 992
            K  KE+ KIGHRR+ + G +TYKK  TS+I  ++QLGI+ TV    +K KRD+L+ DF  +E++ FP  G   TP+H  S+F +K +APIAFRYFRD F +   D++ S+C   LRELSN GASGSIFY+T DDEFIIKTVQHKE  FLQKLLP YY+NL Q+PRTLLPKF+GLYC QT   KNIR V+MNNL+P S+++H KYDLKGST+KR AN+ E+ K SPT KDLDF + H   ++LE +TY AL+ TIQRDC VLESF IMDYSLLLG+HNLD  L   KE + EQ+
Sbjct:   52 KADKER-KIGHRRVGEGGEITYKKIQTSQIMGSIQLGIQHTVGSLASKPKRDLLMMDFWEIESITFPPEGSSLTPAHHYSEFRYKIYAPIAFRYFRDLFGIQPDDFMMSMCTSPLRELSNPGASGSIFYLTTDDEFIIKTVQHKEGEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCLQTSNAKNIRLVVMNNLLPSSVKMHLKYDLKGSTFKRKANKAERAKKSPTYKDLDFMEQHPNGIFLEAETYAALIKTIQRDCTVLESFKIMDYSLLLGVHNLDVAL---KEKQSEQR 340          

HSP 2 Score: 154.066 bits (388), Expect = 5.579e-38
Identity = 80/163 (49.08%), Postives = 113/163 (69.33%), Query Frame = 3
Query: 1776 SFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFV--HMAMRQNPDRKRTSSVRKENLIPSDKE 2258
            S N    RS + +R+ A ST +ESIQA  E ++    DEE +P GGIPAR++ G+RL+L++GIIDILQSYR+ KK+EH  K+I  D   +SV  P+FYAQRFQ+F A  VF+KIPSLD P+I G+H R+FR  V  ++A++ +P ++++ S   +  I SD E
Sbjct:  368 SRNNAAYRSVNRQRLVAHSTAMESIQAESEPID----DEEDVPPGGIPARSEKGERLLLYIGIIDILQSYRLKKKLEHTFKSIIHDGETVSVCRPSFYAQRFQNFMAKTVFRKIPSLDLPEIKGNH-RKFRTLVTSYIALKHSPSKRKSLSKAIQRSIDSDNE 525          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Match: pip5k1cb (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma b [Source:ZFIN;Acc:ZDB-GENE-110408-21])

HSP 1 Score: 357.451 bits (916), Expect = 1.092e-109
Identity = 169/278 (60.79%), Postives = 215/278 (77.34%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSI-RIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            KIGHRR++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGSIFY+T DDEFI+KTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P + R+H K+DLKGSTYKR A++ E+ K  PT KDLDF ++  + L L+VDTY AL+ T+QRDC VLESF IMDYSLLLG+HN++Q  R R+
Sbjct:   55 KIGHRRVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSIFYVTRDDEFILKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRIVVMNNVLPRVFRMHLKFDLKGSTYKRRASKKEREKNRPTYKDLDFMQDVQDGLLLDVDTYNALLKTLQRDCLVLESFKIMDYSLLLGVHNVEQAERERQ 332          

HSP 2 Score: 92.8189 bits (229), Expect = 1.034e-18
Identity = 50/102 (49.02%), Postives = 65/102 (63.73%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSL 2126
            A +ST +ESIQ      +   +D+     GGIPA +  G+RL+LF+GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F +  VFKK  SL
Sbjct:  349 ALYSTAMESIQGGAACGDSIDTDDT---MGGIPAVSGKGERLLLFIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPNFYADRFFRFMSANVFKKSTSL 447          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma a [Source:ZFIN;Acc:ZDB-GENE-050208-358])

HSP 1 Score: 354.369 bits (908), Expect = 3.188e-109
Identity = 170/286 (59.44%), Postives = 215/286 (75.17%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  +  ++ E  Q N
Sbjct:   62 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRMVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQELPDGLMLDTDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAAK-EQQMEGSQGN 346          

HSP 2 Score: 97.0561 bits (240), Expect = 4.092e-20
Identity = 57/144 (39.58%), Postives = 82/144 (56.94%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSS----VRKENL 2240
            A ++T +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL       S  +R R  + +     P    ++S    +R EN+
Sbjct:  357 ALYTTAMESIQGASACGEGIDTDDT---MGGIPAVNGRGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFLRFMSSTVFRKTSSLKS-----SPSKRGRGGLAVGKYCGPGAAWSASQLPFMRDENI 492          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma a [Source:ZFIN;Acc:ZDB-GENE-050208-358])

HSP 1 Score: 354.755 bits (909), Expect = 3.192e-109
Identity = 170/286 (59.44%), Postives = 215/286 (75.17%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  +  ++ E  Q N
Sbjct:   62 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRMVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQELPDGLMLDTDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAAK-EQQMEGSQGN 346          

HSP 2 Score: 97.0561 bits (240), Expect = 4.427e-20
Identity = 57/144 (39.58%), Postives = 82/144 (56.94%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSS----VRKENL 2240
            A ++T +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL       S  +R R  + +     P    ++S    +R EN+
Sbjct:  357 ALYTTAMESIQGASACGEGIDTDDT---MGGIPAVNGRGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFLRFMSSTVFRKTSSLKS-----SPSKRGRGGLAVGKYCGPGAAWSASQLPFMRDENI 492          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma a [Source:ZFIN;Acc:ZDB-GENE-050208-358])

HSP 1 Score: 355.14 bits (910), Expect = 4.877e-109
Identity = 170/286 (59.44%), Postives = 215/286 (75.17%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  +  ++ E  Q N
Sbjct:   62 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRMVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQELPDGLMLDTDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAAK-EQQMEGSQGN 346          

HSP 2 Score: 97.0561 bits (240), Expect = 4.775e-20
Identity = 57/144 (39.58%), Postives = 82/144 (56.94%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSS----VRKENL 2240
            A ++T +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL       S  +R R  + +     P    ++S    +R EN+
Sbjct:  357 ALYTTAMESIQGASACGEGIDTDDT---MGGIPAVNGRGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFLRFMSSTVFRKTSSLKS-----SPSKRGRGGLAVGKYCGPGAAWSASQLPFMRDENI 492          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma a [Source:ZFIN;Acc:ZDB-GENE-050208-358])

HSP 1 Score: 355.14 bits (910), Expect = 5.115e-109
Identity = 170/286 (59.44%), Postives = 215/286 (75.17%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  +  ++ E  Q N
Sbjct:   62 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRMVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQELPDGLMLDTDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNIDQAAK-EQQMEGSQGN 346          

HSP 2 Score: 97.0561 bits (240), Expect = 4.560e-20
Identity = 57/144 (39.58%), Postives = 82/144 (56.94%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSS----VRKENL 2240
            A ++T +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL       S  +R R  + +     P    ++S    +R EN+
Sbjct:  357 ALYTTAMESIQGASACGEGIDTDDT---MGGIPAVNGRGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFLRFMSSTVFRKTSSLKS-----SPSKRGRGGLAVGKYCGPGAAWSASQLPFMRDENI 492          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Match: PIP5K1B (phosphatidylinositol-4-phosphate 5-kinase, type I, beta [Source:NCBI gene;Acc:100380056])

HSP 1 Score: 336.65 bits (862), Expect = 4.208e-105
Identity = 168/287 (58.54%), Postives = 210/287 (73.17%), Query Frame = 3
Query:  171 GTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVK 1028
            G  TYKK T+S I+  +QLGI  TV    +K  RD+L++DF VVE++  P  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN GASGSIF++T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ G NIR V+MNN++P S+R++ KYDLKGSTYKR A+  E+ K SPT KDLDF ++  E LY + +TY ALM T+QRDCRVLESF IMDYSLLLG+H L       KE E E  ++++ +   +V+
Sbjct:   17 GEKTYKKTTSSAIKGTIQLGIGYTVGNLTSKPDRDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSLCSEPLIELSNPGASGSIFFVTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGINIRIVVMNNVLPRSVRMNYKYDLKGSTYKRRASRKEREKSSPTYKDLDFLQDTPEGLYFDPETYSALMKTLQRDCRVLESFKIMDYSLLLGVHVLGST---SKEKEGESSHYSIDNKRPSVQ 300          

HSP 2 Score: 103.219 bits (256), Expect = 1.579e-22
Identity = 51/97 (52.58%), Postives = 67/97 (69.07%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKI 2117
            +ST LESIQ P + V+    +      GGIPA+N  G+R++LFMGIIDILQSYR+MKK+EH+ KA+  D  ++SV  P+FYA RF  F    VFKK+
Sbjct:  304 YSTALESIQGPGKDVDSFIKEST---MGGIPAKNHRGERMLLFMGIIDILQSYRLMKKLEHSWKALVYDGDSVSVHRPSFYADRFLKFMNARVFKKV 397          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Match: pip5k1c (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [Source:NCBI gene;Acc:100145583])

HSP 1 Score: 339.347 bits (869), Expect = 1.455e-104
Identity = 172/287 (59.93%), Postives = 215/287 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK-ENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF     E L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HN++Q  R R+ E  Q Q +
Sbjct:   27 KIGHRGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVRMHFKYDLKGSTYKRRASKKEREKRCPTFKDLDFMNEAPEGLLLDNDTFNALVKTLQRDCLVLESFKIMDYSLLLGVHNMEQQERERQTEGAQSQAD 313          

HSP 2 Score: 96.6709 bits (239), Expect = 4.571e-20
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query: 1773 ESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            E    Q    +   + A +ST +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA+RF  F  N VF+
Sbjct:  306 EGAQSQADEKRPVGQKALYSTAMESIQGGAAHGESIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMTNTVFR 415          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Match: pip5k1c (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [Source:NCBI gene;Acc:100145583])

HSP 1 Score: 338.961 bits (868), Expect = 1.598e-104
Identity = 172/287 (59.93%), Postives = 215/287 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK-ENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF     E L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HN++Q  R R+ E  Q Q +
Sbjct:   27 KIGHRGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVRMHFKYDLKGSTYKRRASKKEREKRCPTFKDLDFMNEAPEGLLLDNDTFNALVKTLQRDCLVLESFKIMDYSLLLGVHNMEQQERERQTEGAQSQAD 313          

HSP 2 Score: 97.0561 bits (240), Expect = 4.155e-20
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query: 1773 ESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            E    Q    +   + A +ST +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA+RF  F  N VF+
Sbjct:  306 EGAQSQADEKRPVGQKALYSTAMESIQGGAAHGESIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMTNTVFR 415          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Match: pip5k1c (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [Source:NCBI gene;Acc:100145583])

HSP 1 Score: 341.273 bits (874), Expect = 2.154e-104
Identity = 172/287 (59.93%), Postives = 215/287 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK-ENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF     E L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HN++Q  R R+ E  Q Q +
Sbjct:   51 KIGHRGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVRMHFKYDLKGSTYKRRASKKEREKRCPTFKDLDFMNEAPEGLLLDNDTFNALVKTLQRDCLVLESFKIMDYSLLLGVHNMEQQERERQTEGAQSQAD 337          

HSP 2 Score: 97.8265 bits (242), Expect = 3.176e-20
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query: 1773 ESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            E    Q    +   + A +ST +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA+RF  F  N VF+
Sbjct:  330 EGAQSQADEKRPVGQKALYSTAMESIQGGAAHGESIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMTNTVFR 439          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Match: pip5k1c (phosphatidylinositol-4-phosphate 5-kinase, type I, gamma [Source:NCBI gene;Acc:100145583])

HSP 1 Score: 338.961 bits (868), Expect = 3.943e-104
Identity = 172/287 (59.93%), Postives = 215/287 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK-ENEQEQKN 995
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF     E L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HN++Q  R R+ E  Q Q +
Sbjct:   27 KIGHRGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSLFYVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNNILPRVVRMHFKYDLKGSTYKRRASKKEREKRCPTFKDLDFMNEAPEGLLLDNDTFNALVKTLQRDCLVLESFKIMDYSLLLGVHNMEQQERERQTEGAQSQAD 313          

HSP 2 Score: 97.0561 bits (240), Expect = 4.570e-20
Identity = 50/113 (44.25%), Postives = 68/113 (60.18%), Query Frame = 3
Query: 1773 ESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            E    Q    +   + A +ST +ESIQ      E   +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA+RF  F  N VF+
Sbjct:  306 EGAQSQADEKRPVGQKALYSTAMESIQGGAAHGESIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYAERFFKFMTNTVFR 415          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Match: Pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha [Source:MGI Symbol;Acc:MGI:107929])

HSP 1 Score: 351.673 bits (901), Expect = 6.922e-110
Identity = 167/283 (59.01%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R    N+ +
Sbjct:   47 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQ 329          

HSP 2 Score: 109.383 bits (272), Expect = 2.292e-24
Identity = 61/131 (46.56%), Postives = 80/131 (61.07%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP--SLDQPQIL 2144
            RE  +     S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP   L +P +L
Sbjct:  321 REPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPYVHLGRPDVL 448          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Match: Pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha [Source:MGI Symbol;Acc:MGI:107929])

HSP 1 Score: 352.443 bits (903), Expect = 1.335e-109
Identity = 167/283 (59.01%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R    N+ +
Sbjct:   47 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQ 329          

HSP 2 Score: 112.079 bits (279), Expect = 5.090e-25
Identity = 74/196 (37.76%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSP 2345
            RE  +     S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP    P       ++FR+    + R  P     +S     L+ S + R     +V  ++E+  D   +LG P+  P
Sbjct:  321 REPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSP------TKKFRSGPSFSRRSGPSGNSCTS----QLMASGEHRA----QVTTKAEVEPD--VHLGRPDVLP 497          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Match: Pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha [Source:MGI Symbol;Acc:MGI:107929])

HSP 1 Score: 352.058 bits (902), Expect = 2.176e-109
Identity = 167/283 (59.01%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R    N+ +
Sbjct:   48 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQ 330          

HSP 2 Score: 112.079 bits (279), Expect = 5.082e-25
Identity = 74/196 (37.76%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSP 2345
            RE  +     S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP    P       ++FR+    + R  P     +S     L+ S + R     +V  ++E+  D   +LG P+  P
Sbjct:  322 REPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSP------TKKFRSGPSFSRRSGPSGNSCTS----QLMASGEHRA----QVTTKAEVEPD--VHLGRPDVLP 498          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Match: Pip5k1a (phosphatidylinositol-4-phosphate 5-kinase, type 1 alpha [Source:MGI Symbol;Acc:MGI:107929])

HSP 1 Score: 352.058 bits (902), Expect = 2.241e-109
Identity = 167/283 (59.01%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R    N+ +
Sbjct:   49 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQ 331          

HSP 2 Score: 112.079 bits (279), Expect = 5.119e-25
Identity = 74/196 (37.76%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSP 2345
            RE  +     S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP    P       ++FR+    + R  P     +S     L+ S + R     +V  ++E+  D   +LG P+  P
Sbjct:  323 REPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSP------TKKFRSGPSFSRRSGPSGNSCTS----QLMASGEHRA----QVTTKAEVEPD--VHLGRPDVLP 499          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Match: Pip5k1b (phosphatidylinositol-4-phosphate 5-kinase, type 1 beta [Source:MGI Symbol;Acc:MGI:107930])

HSP 1 Score: 342.813 bits (878), Expect = 1.006e-106
Identity = 165/266 (62.03%), Postives = 205/266 (77.07%), Query Frame = 3
Query:  180 TYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKE 974
            TYKK  +S I+ A+QLGI  TV    +K +RD+L++DF VVE++  P  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL SIC + L ELSN GASGS+F++T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ G NIR V+MNN++P ++R+H  YDLKGSTYKR A+  E+ KP+PT KDLDF ++  E LY + +TY ALM T+QRDCRVLESF IMDYSLLLGIH LD +L+ ++E
Sbjct:   20 TYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEE 285          

HSP 2 Score: 101.293 bits (251), Expect = 8.690e-22
Identity = 56/115 (48.70%), Postives = 72/115 (62.61%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQ----VELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVR 2159
            +ST +ESIQ P +     +  NP        GGIPA++  G++L+LFMGIIDILQSYR+MKK+EH+ KA+  D   +SV  P+FYA RF  F  + VFKKI      Q LGS  R
Sbjct:  304 YSTAMESIQGPGKSADGIIAENPDT-----MGGIPAKSHKGEKLLLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKI------QALGSRHR 407          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Match: sp|P70182|PI51A_MOUSE (Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Mus musculus OX=10090 GN=Pip5k1a PE=1 SV=2)

HSP 1 Score: 352.058 bits (902), Expect = 1.522e-108
Identity = 167/283 (59.01%), Postives = 212/283 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQE 986
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R    N+ +
Sbjct:   48 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQ 330          

HSP 2 Score: 112.079 bits (279), Expect = 3.555e-24
Identity = 74/196 (37.76%), Postives = 104/196 (53.06%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSP 2345
            RE  +     S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP    P       ++FR+    + R  P     +S     L+ S + R     +V  ++E+  D   +LG P+  P
Sbjct:  322 REPTSNDTQYSADTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSP------TKKFRSGPSFSRRSGPSGNSCTS----QLMASGEHRA----QVTTKAEVEPD--VHLGRPDVLP 498          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Match: sp|D3ZSI8|PI51A_RAT (Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Rattus norvegicus OX=10116 GN=Pip5k1a PE=1 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.215e-108
Identity = 166/275 (60.36%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   47 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQR 321          

HSP 2 Score: 112.849 bits (281), Expect = 1.634e-24
Identity = 64/148 (43.24%), Postives = 85/148 (57.43%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNP 2201
            RE  N +   S  TRR A     +ST +ESIQ    +     +++     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP    P       ++FR+    + R  P
Sbjct:  321 REPMNSETQYSIDTRRPAPQKALYSTAMESIQGEARRGGTVETEDH---MGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSP------TKKFRSGPSFSRRSGP 459          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Match: sp|Q99755|PI51A_HUMAN (Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Homo sapiens OX=9606 GN=PIP5K1A PE=1 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 9.221e-108
Identity = 165/275 (60.00%), Postives = 209/275 (76.00%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV     K +RD+L++DF VVE++ FP  G   TP+H  +DF FKT+AP+AFRYFR+ F +   DYL S+C + L EL ++GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q  GKNIR V+MNNL+P S+++H KYDLKGSTYKR A++ E+ KP PT KDLDF ++  + L+L+ D Y AL  T+QRDC VL+SF IMDYSLL+ IHN+D   R
Sbjct:   63 KIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCLVLQSFKIMDYSLLMSIHNIDHAQR 337          

HSP 2 Score: 111.309 bits (277), Expect = 5.721e-24
Identity = 59/121 (48.76%), Postives = 76/121 (62.81%), Query Frame = 3
Query: 1770 RESFNRQKSRSKSTRRIAA----FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            RE  + +   S  TRR A     +ST +ESIQ    +     +D+     GGIPARN  G+RL+L++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RFQ F  N VFKKIP
Sbjct:  337 REPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARRGGTMETDDH---MGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIP 454          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Match: sp|Q5CZZ9|PI51B_RAT (Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Rattus norvegicus OX=10116 GN=Pip5k1b PE=1 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 8.499e-106
Identity = 165/266 (62.03%), Postives = 205/266 (77.07%), Query Frame = 3
Query:  180 TYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKE 974
            TYKK  +S I+ A+QLGI  TV    +K +RD+L++DF VVE++  P  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL SIC + L ELSN GASGS+F++T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ G NIR V+MNN++P ++R+H  YDLKGSTYKR A+  E+ KP+PT KDLDF ++  E LY + +TY ALM T+QRDCRVLESF IMDYSLLLGIH LD +L+ ++E
Sbjct:   20 TYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEE 285          

HSP 2 Score: 101.679 bits (252), Expect = 6.290e-21
Identity = 52/104 (50.00%), Postives = 69/104 (66.35%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQ----VELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSL 2126
            +ST +ESIQ P +     +  NP        GGIPA++  G++L+LFMGIIDILQSYR+MKK+EH+ KA+  D   +SV  P+FYA RF  F  + VFKKI +L
Sbjct:  304 YSTAMESIQGPGKSADGIIAENPDT-----MGGIPAKSHKGEKLLLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKIQAL 402          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Match: sp|P70181|PI51B_MOUSE (Phosphatidylinositol 4-phosphate 5-kinase type-1 beta OS=Mus musculus OX=10090 GN=Pip5k1b PE=1 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.126e-105
Identity = 165/266 (62.03%), Postives = 205/266 (77.07%), Query Frame = 3
Query:  180 TYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKE 974
            TYKK  +S I+ A+QLGI  TV    +K +RD+L++DF VVE++  P  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL SIC + L ELSN GASGS+F++T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKFYGLYC Q+ G NIR V+MNN++P ++R+H  YDLKGSTYKR A+  E+ KP+PT KDLDF ++  E LY + +TY ALM T+QRDCRVLESF IMDYSLLLGIH LD +L+ ++E
Sbjct:   20 TYKKTASSAIKGAIQLGIGYTVGNLTSKPERDVLMQDFYVVESVFLPSEGSNLTPAHHYPDFRFKTYAPLAFRYFRELFGIKPDDYLYSICSEPLIELSNPGASGSLFFLTSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCMQSGGINIRIVVMNNVLPRAMRMHLTYDLKGSTYKRRASRKEREKPNPTFKDLDFLQDMHEGLYFDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHILDHSLKDKEE 285          

HSP 2 Score: 101.679 bits (252), Expect = 6.516e-21
Identity = 60/167 (35.93%), Postives = 92/167 (55.09%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQ----VELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSV------RKENLIPSDKERQNQSREVIDESE 2297
            +ST +ESIQ P +     +  NP        GGIPA++  G++L+LFMGIIDILQSYR+MKK+EH+ KA+  D   +SV  P+FYA RF  F  + VFKKI                      A++ +P +KR +S+       +E +    +E +++ R+++ E +
Sbjct:  304 YSTAMESIQGPGKSADGIIAENPDT-----MGGIPAKSHKGEKLLLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLKFMNSRVFKKI---------------------QALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ 444          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Match: A0A5K3ESS6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 2.839e-135
Identity = 197/293 (67.24%), Postives = 239/293 (81.57%), Query Frame = 3
Query:  129 KEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHAL 1004
            K   KIGHRR+ D+GTVTYKK  TSEIQ+A+QLGI  ++     K  RD+L +DF VVET+ FPR+G K TP+H LSDF F+TFAP+AFR FRD FQ+DI DYL+S+C QELRELSN GASGSIFYI+ DDEFIIKTVQHKEA+FLQKLLPEYY+NL+QH RTLLPKFYGL+CYQ  GKNIRFV+MNNL+P S+++HE+YDLKGS+YKR AN+ E  K SPTLKDLDF++ H + ++LE DTY+ALM TI+RDCRVLESF IMDYSLLLG+HN DQ  R R   ++   ++ +
Sbjct:   38 KTNKKIGHRRVTDQGTVTYKKTPTSEIQRAIQLGIHHSIGTLQQKQVRDVLFRDFEVVETVDFPRSGTKTTPAHGLSDFRFRTFAPVAFRSFRDHFQLDIRDYLNSLCSQELRELSNPGASGSIFYISADDEFIIKTVQHKEANFLQKLLPEYYMNLVQHTRTLLPKFYGLHCYQCSGKNIRFVVMNNLLPSSVKMHERYDLKGSSYKRKANDRELAKASPTLKDLDFKERHPDGIWLEADTYDALMKTIERDCRVLESFRIMDYSLLLGVHNFDQAERDRNRKKERSSDNGV 330          

HSP 2 Score: 137.502 bits (345), Expect = 3.984e-30
Identity = 68/131 (51.91%), Postives = 91/131 (69.47%), Query Frame = 3
Query: 1746 GNQIIGKPRES---FNRQKSRSK-STRRIAAFSTVLESIQAPVEQVELNPSDE-EYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS 2123
            G  +I   R S   FNR   R+K   +R+ AFST +ESI+A VE VE+ P+D  +    GG+PAR+  GDRL LF+GIIDILQSYR+ KKMEH +K++ +D   +SVTNP+FYA+RFQ+     +F+KIPS
Sbjct:  357 GGDVITASRRSVSPFNRSAFRTKLGNKRLTAFSTAMESIEAKVEPVEIEPTDPGKATLLGGLPARSASGDRLFLFIGIIDILQSYRMAKKMEHTLKSVVIDAETVSVTNPSFYARRFQNALGTCIFRKIPS 487          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Match: A0A5K3ET03 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 7.335e-135
Identity = 197/293 (67.24%), Postives = 239/293 (81.57%), Query Frame = 3
Query:  129 KEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHAL 1004
            K   KIGHRR+ D+GTVTYKK  TSEIQ+A+QLGI  ++     K  RD+L +DF VVET+ FPR+G K TP+H LSDF F+TFAP+AFR FRD FQ+DI DYL+S+C QELRELSN GASGSIFYI+ DDEFIIKTVQHKEA+FLQKLLPEYY+NL+QH RTLLPKFYGL+CYQ  GKNIRFV+MNNL+P S+++HE+YDLKGS+YKR AN+ E  K SPTLKDLDF++ H + ++LE DTY+ALM TI+RDCRVLESF IMDYSLLLG+HN DQ  R R   ++   ++ +
Sbjct:   38 KTNKKIGHRRVTDQGTVTYKKTPTSEIQRAIQLGIHHSIGTLQQKQVRDVLFRDFEVVETVDFPRSGTKTTPAHGLSDFRFRTFAPVAFRSFRDHFQLDIRDYLNSLCSQELRELSNPGASGSIFYISADDEFIIKTVQHKEANFLQKLLPEYYMNLVQHTRTLLPKFYGLHCYQCSGKNIRFVVMNNLLPSSVKMHERYDLKGSSYKRKANDRELAKASPTLKDLDFKERHPDGIWLEADTYDALMKTIERDCRVLESFRIMDYSLLLGVHNFDQAERDRNRKKERSSDNGV 330          

HSP 2 Score: 169.474 bits (428), Expect = 1.288e-40
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 3
Query: 1746 GNQIIGKPRES---FNRQKSRSK-STRRIAAFSTVLESIQAPVEQVELNPSDE-EYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKR 2213
            G  +I   R S   FNR   R+K   +R+ AFST +ESI+A VE VE+ P+D  +    GG+PAR+  GDRL LF+GIIDILQSYR+ KKMEH +K++ +D   +SVTNP+FYA+RFQ+     +F+KIPSLD PQ+ G    RFR   H+AM+Q+  R+R
Sbjct:  357 GGDVITASRRSVSPFNRSAFRTKLGNKRLTAFSTAMESIEAKVEPVEIEPTDPGKATLLGGLPARSASGDRLFLFIGIIDILQSYRMAKKMEHTLKSVVIDAETVSVTNPSFYARRFQNALGTCIFRKIPSLDPPQLFGPKAMRFRRLAHLAMKQSSARRR 517          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Match: A0A5K3EUV8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 8.878e-135
Identity = 197/293 (67.24%), Postives = 239/293 (81.57%), Query Frame = 3
Query:  129 KEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHAL 1004
            K   KIGHRR+ D+GTVTYKK  TSEIQ+A+QLGI  ++     K  RD+L +DF VVET+ FPR+G K TP+H LSDF F+TFAP+AFR FRD FQ+DI DYL+S+C QELRELSN GASGSIFYI+ DDEFIIKTVQHKEA+FLQKLLPEYY+NL+QH RTLLPKFYGL+CYQ  GKNIRFV+MNNL+P S+++HE+YDLKGS+YKR AN+ E  K SPTLKDLDF++ H + ++LE DTY+ALM TI+RDCRVLESF IMDYSLLLG+HN DQ  R R   ++   ++ +
Sbjct:   38 KTNKKIGHRRVTDQGTVTYKKTPTSEIQRAIQLGIHHSIGTLQQKQVRDVLFRDFEVVETVDFPRSGTKTTPAHGLSDFRFRTFAPVAFRSFRDHFQLDIRDYLNSLCSQELRELSNPGASGSIFYISADDEFIIKTVQHKEANFLQKLLPEYYMNLVQHTRTLLPKFYGLHCYQCSGKNIRFVVMNNLLPSSVKMHERYDLKGSSYKRKANDRELAKASPTLKDLDFKERHPDGIWLEADTYDALMKTIERDCRVLESFRIMDYSLLLGVHNFDQAERDRNRKKERSSDNGV 330          

HSP 2 Score: 169.474 bits (428), Expect = 1.387e-40
Identity = 82/161 (50.93%), Postives = 110/161 (68.32%), Query Frame = 3
Query: 1746 GNQIIGKPRES---FNRQKSRSK-STRRIAAFSTVLESIQAPVEQVELNPSDE-EYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKR 2213
            G  +I   R S   FNR   R+K   +R+ AFST +ESI+A VE VE+ P+D  +    GG+PAR+  GDRL LF+GIIDILQSYR+ KKMEH +K++ +D   +SVTNP+FYA+RFQ+     +F+KIPSLD PQ+ G    RFR   H+AM+Q+  R+R
Sbjct:  357 GGDVITASRRSVSPFNRSAFRTKLGNKRLTAFSTAMESIEAKVEPVEIEPTDPGKATLLGGLPARSASGDRLFLFIGIIDILQSYRMAKKMEHTLKSVVIDAETVSVTNPSFYARRFQNALGTCIFRKIPSLDPPQLFGPKAMRFRRLAHLAMKQSSARRR 517          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Match: A0A183T4D6 (PIPK domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS11334 PE=4 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 8.910e-135
Identity = 200/295 (67.80%), Postives = 244/295 (82.71%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            ++ G +  E K  K   K+GHRR+ ++GTVTYKK  TSEIQ+A+QLGI+ ++++   K  RD+L +DF VVET+ FPR+G K TP+H+LSDF F+TFAP+AFR FRD F++DI DYL+S+C QELRELSN GASGSIFYI+ DDEFI+KTVQHKEA FLQKLLPEYY+NL+QH RTLLPKFYGL+CYQ+ GKNIRFV+MNNL+P SI++HEKYDLKGS+YKR A+E E  K SPTLKDLDF++ H E + LE DTY+ALM TI+RDCRVLESF IMDYS LLGIHNLDQ  R R+
Sbjct:   23 SRSGRWETESKRAK---KLGHRRVTEQGTVTYKKTPTSEIQRAIQLGIQHSISILQQKPVRDVLFRDFEVVETVDFPRSGSKTTPAHNLSDFRFRTFAPVAFRSFRDTFELDIRDYLNSLCSQELRELSNPGASGSIFYISTDDEFILKTVQHKEADFLQKLLPEYYMNLVQHTRTLLPKFYGLHCYQSGGKNIRFVVMNNLLPSSIKMHEKYDLKGSSYKRKASERELAKSSPTLKDLDFKERHPEGILLEADTYDALMKTIERDCRVLESFRIMDYSFLLGIHNLDQAERDRQ 314          

HSP 2 Score: 106.686 bits (265), Expect = 3.581e-20
Identity = 56/124 (45.16%), Postives = 80/124 (64.52%), Query Frame = 3
Query: 1686 NQSNAIDGGSPAAVSPESSIGNQIIGKPRES---FNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAIS 2048
            N+++A   G   + +P S  GN     P ++   F R   R+K  +RI A+ST +ESI+A  E VE+ P +  +I  GGIPAR+K GDRL L++GIIDILQSYR++KKMEH +K++  D   +S
Sbjct:  350 NRASAF--GEARSTTPSSFTGNLRNTTPPKTASPFLRNPFRAKFQKRITAYSTAMESIEAKAEPVEVEPDERSHILMGGIPARSKSGDRLFLYIGIIDILQSYRVIKKMEHTLKSVVTDGVCLS 471          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Match: A0A0X3PYS8 (Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha OS=Schistocephalus solidus OX=70667 GN=PI51A PE=4 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 9.559e-135
Identity = 200/295 (67.80%), Postives = 244/295 (82.71%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            ++ G +  E K  K   K+GHRR+ ++GTVTYKK  TSEIQ+A+QLGI+ ++++   K  RD+L +DF VVET+ FPR+G K TP+H+LSDF F+TFAP+AFR FRD F++DI DYL+S+C QELRELSN GASGSIFYI+ DDEFI+KTVQHKEA FLQKLLPEYY+NL+QH RTLLPKFYGL+CYQ+ GKNIRFV+MNNL+P SI++HEKYDLKGS+YKR A+E E  K SPTLKDLDF++ H E + LE DTY+ALM TI+RDCRVLESF IMDYS LLGIHNLDQ  R R+
Sbjct:   27 SRSGRWETESKRAK---KLGHRRVTEQGTVTYKKTPTSEIQRAIQLGIQHSISILQQKPVRDVLFRDFEVVETVDFPRSGSKTTPAHNLSDFRFRTFAPVAFRSFRDTFELDIRDYLNSLCSQELRELSNPGASGSIFYISTDDEFILKTVQHKEADFLQKLLPEYYMNLVQHTRTLLPKFYGLHCYQSGGKNIRFVVMNNLLPSSIKMHEKYDLKGSSYKRKASERELAKSSPTLKDLDFKERHPEGILLEADTYDALMKTIERDCRVLESFRIMDYSFLLGIHNLDQAERDRQ 318          

HSP 2 Score: 137.887 bits (346), Expect = 4.825e-30
Identity = 71/149 (47.65%), Postives = 96/149 (64.43%), Query Frame = 3
Query: 1686 NQSNAIDGGSPAAVSPESSIGNQIIGKPRES---FNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS 2123
            N+++A   G   + +P S  GN     P ++   F R   R+K  +RI A+ST +ESI+A  E VE+ P +  +I  GGIPAR+K GDRL L++GIIDILQSYR++KKMEH +K++  D   +SVTNP FYA RFQ      VF+KI S
Sbjct:  354 NRASAF--GEARSTTPSSFTGNLRNTTPPKTASPFLRNPFRAKFQKRITAYSTAMESIEAKAEPVEVEPDERSHILMGGIPARSKSGDRLFLYIGIIDILQSYRVIKKMEHTLKSVVTDGETVSVTNPAFYAHRFQTALGRFVFRKIQS 500          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Match: pip5k1ca (phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like [Source:NCBI gene;Acc:103021640])

HSP 1 Score: 356.681 bits (914), Expect = 5.323e-110
Identity = 172/291 (59.11%), Postives = 218/291 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSS 1010
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFI+KTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L++DTY AL+ T+QRDC VLESF IMDYSLLLG+HNLDQ      E EQ+ +    SS
Sbjct:   67 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVTKDDEFIVKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNILPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQDIADGLLLDLDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNLDQ-----AEREQQTEGSQGSS 352          

HSP 2 Score: 95.9005 bits (237), Expect = 7.325e-20
Identity = 50/102 (49.02%), Postives = 67/102 (65.69%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSL 2126
            A +ST LESIQ      E   +++     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL
Sbjct:  362 ALYSTALESIQGASACAEDIDTEDT---MGGIPAVNSKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFFRFMSSTVFRKSTSL 460          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Match: pip5k1cb (phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like [Source:NCBI gene;Acc:103026952])

HSP 1 Score: 354.369 bits (908), Expect = 8.238e-110
Identity = 172/291 (59.11%), Postives = 217/291 (74.57%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSI-RIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSS 1010
            KIGHRR++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGSIFY+T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR ++MNN++P + R+H K+DLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HNLDQ        E+EQ+     S
Sbjct:   40 KIGHRRVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSIFYVTRDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCIQSGGKNIRILVMNNVLPRVFRMHLKFDLKGSTYKRRASKKEREKSRPTFKDLDFLQEVPDGLLLDTDTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNLDQ-------AEREQQTEGCQS 323          

HSP 2 Score: 84.7297 bits (208), Expect = 1.940e-16
Identity = 46/97 (47.42%), Postives = 61/97 (62.89%), Query Frame = 3
Query: 1821 AAFSTVLESI-QAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVF 2108
            A +ST +ESI    V    ++  D      GGIPA +  G+RL+LF+GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F ++ VF
Sbjct:  334 ALYSTAMESILGGAVCGDSIDTEDT----MGGIPAVSGKGERLLLFVGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPNFYADRFFKFMSSTVF 426          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Match: pip5k1ca (phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like [Source:NCBI gene;Acc:103021640])

HSP 1 Score: 357.066 bits (915), Expect = 1.140e-109
Identity = 172/291 (59.11%), Postives = 218/291 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSS 1010
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFI+KTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L++DTY AL+ T+QRDC VLESF IMDYSLLLG+HNLDQ      E EQ+ +    SS
Sbjct:   67 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVTKDDEFIVKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNILPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQDIADGLLLDLDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNLDQ-----AEREQQTEGSQGSS 352          

HSP 2 Score: 96.2857 bits (238), Expect = 6.897e-20
Identity = 50/102 (49.02%), Postives = 67/102 (65.69%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSL 2126
            A +ST LESIQ      E   +++     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL
Sbjct:  362 ALYSTALESIQGASACAEDIDTEDT---MGGIPAVNSKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFFRFMSSTVFRKSTSL 460          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Match: pip5k1ca (phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like [Source:NCBI gene;Acc:103021640])

HSP 1 Score: 356.681 bits (914), Expect = 1.873e-109
Identity = 172/291 (59.11%), Postives = 218/291 (74.91%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSS 1010
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFI+KTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L++DTY AL+ T+QRDC VLESF IMDYSLLLG+HNLDQ      E EQ+ +    SS
Sbjct:   67 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVTKDDEFIVKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNILPRVVRMHLKYDLKGSTYKRRASKKEREKAKPTFKDLDFMQDIADGLLLDLDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNLDQ-----AEREQQTEGSQGSS 352          

HSP 2 Score: 96.2857 bits (238), Expect = 7.244e-20
Identity = 55/134 (41.04%), Postives = 77/134 (57.46%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSS 2222
            A +ST LESIQ      E   +++     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P+FYA RF  F ++ VF+K  SL       S  +R R  + +     P    ++S
Sbjct:  362 ALYSTALESIQGASACAEDIDTEDT---MGGIPAVNSKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPSFYADRFFRFMSSTVFRKSTSLKS-----SPSKRGRGSLAVPKHSGPGAAWSAS 487          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Match: pip5k1cb (phosphatidylinositol 4-phosphate 5-kinase type-1 gamma-like [Source:NCBI gene;Acc:103026952])

HSP 1 Score: 356.681 bits (914), Expect = 3.644e-109
Identity = 169/275 (61.45%), Postives = 212/275 (77.09%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSI-RIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KIGHRR++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGSIFY+T DDEFIIKTVQHKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR ++MNN++P + R+H K+DLKGSTYKR A++ E+ K  PT KDLDF +   + L L+ DT+ AL+ T+QRDC VLESF IMDYSLLLG+HNLDQ  R
Sbjct:   55 KIGHRRVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSIFYVTRDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCIQSGGKNIRILVMNNVLPRVFRMHLKFDLKGSTYKRRASKKEREKSRPTFKDLDFLQEVPDGLLLDTDTFSALVKTLQRDCLVLESFKIMDYSLLLGVHNLDQAER 329          

HSP 2 Score: 84.3445 bits (207), Expect = 3.111e-16
Identity = 47/103 (45.63%), Postives = 63/103 (61.17%), Query Frame = 3
Query: 1803 KSTRRIAAFSTVLESI-QAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVF 2108
            K   + A +ST +ESI    V    ++  D      GGIPA +  G+RL+LF+GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F ++ VF
Sbjct:  343 KPAAQRALYSTAMESILGGAVCGDSIDTEDT----MGGIPAVSGKGERLLLFVGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPNFYADRFFKFMSSTVF 441          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Match: pip5k1ab (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha, b [Source:ZFIN;Acc:ZDB-GENE-041111-123])

HSP 1 Score: 326.635 bits (836), Expect = 2.762e-103
Identity = 156/261 (59.77%), Postives = 202/261 (77.39%), Query Frame = 3
Query:  189 KKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMR 968
            + T+S ++ A++LGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H  SDF FKT+AP+AFRYFR+ F +   DYL S+C + L EL+N GASGS+F++T DDEFIIKTV HKEA FLQKLLP YY+NL Q+ RTLLPKFYGLYC Q+ GKNIR V+MNNL+P ++++H K+DLKGSTYKR A+  E+ K +PT KDLDF ++H + L L+ DTY A+  T+QRDC VLESF IMDYSLL+G+HNLDQ+ R R
Sbjct:    1 QTTSSALRGAIELGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYSDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELTNPGASGSVFFVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNVRTLLPKFYGLYCVQSGGKNIRLVVMNNLLPRAMKMHIKFDLKGSTYKRRASRKEREKSNPTFKDLDFIQDHPDGLLLDSDTYNAMSKTLQRDCLVLESFKIMDYSLLIGVHNLDQSQRER 261          

HSP 2 Score: 49.6766 bits (117), Expect = 2.138e-6
Identity = 21/44 (47.73%), Postives = 30/44 (68.18%), Query Frame = 3
Query: 1989 IMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            ++KK+EH+ KA+  D   +SV  P+FYA+RF  F  N VF+K P
Sbjct:  312 LIKKLEHSWKALVHDGDTVSVHRPSFYAERFLKFMCNQVFRKTP 355          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Match: pip5k1ab (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha, b [Source:ZFIN;Acc:ZDB-GENE-041111-123])

HSP 1 Score: 326.635 bits (836), Expect = 7.370e-103
Identity = 156/261 (59.77%), Postives = 202/261 (77.39%), Query Frame = 3
Query:  189 KKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMR 968
            + T+S ++ A++LGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H  SDF FKT+AP+AFRYFR+ F +   DYL S+C + L EL+N GASGS+F++T DDEFIIKTV HKEA FLQKLLP YY+NL Q+ RTLLPKFYGLYC Q+ GKNIR V+MNNL+P ++++H K+DLKGSTYKR A+  E+ K +PT KDLDF ++H + L L+ DTY A+  T+QRDC VLESF IMDYSLL+G+HNLDQ+ R R
Sbjct:    1 QTTSSALRGAIELGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYSDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELTNPGASGSVFFVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNVRTLLPKFYGLYCVQSGGKNIRLVVMNNLLPRAMKMHIKFDLKGSTYKRRASRKEREKSNPTFKDLDFIQDHPDGLLLDSDTYNAMSKTLQRDCLVLESFKIMDYSLLIGVHNLDQSQRER 261          

HSP 2 Score: 102.449 bits (254), Expect = 2.059e-23
Identity = 49/100 (49.00%), Postives = 68/100 (68.00%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            A +ST +ESIQA           E+ +  GG+PA+N  G+RL+L++GIIDILQSYR++KK+EH+ KA+  D   +SV  P+FYA+RF  F  N VF+K P
Sbjct:  286 ALYSTAMESIQAESRTGATTHQTEDCM--GGVPAKNSKGERLVLYLGIIDILQSYRLIKKLEHSWKALVHDGDTVSVHRPSFYAERFLKFMCNQVFRKTP 383          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Match: pip5k1ab (phosphatidylinositol-4-phosphate 5-kinase, type I, alpha, b [Source:ZFIN;Acc:ZDB-GENE-041111-123])

HSP 1 Score: 319.701 bits (818), Expect = 1.232e-100
Identity = 153/251 (60.96%), Postives = 195/251 (77.69%), Query Frame = 3
Query:  219 LQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMR 968
            ++LGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H  SDF FKT+AP+AFRYFR+ F +   DYL S+C + L EL+N GASGS+F++T DDEFIIKTV HKEA FLQKLLP YY+NL Q+ RTLLPKFYGLYC Q+ GKNIR V+MNNL+P ++++H K+DLKGSTYKR A+  E+ K +PT KDLDF ++H + L L+ DTY A+  T+QRDC VLESF IMDYSLL+G+HNLDQ+ R R
Sbjct:    1 IELGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYSDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELTNPGASGSVFFVTSDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNVRTLLPKFYGLYCVQSGGKNIRLVVMNNLLPRAMKMHIKFDLKGSTYKRRASRKEREKSNPTFKDLDFIQDHPDGLLLDSDTYNAMSKTLQRDCLVLESFKIMDYSLLIGVHNLDQSQRER 251          

HSP 2 Score: 93.9745 bits (232), Expect = 1.037e-20
Identity = 40/71 (56.34%), Postives = 55/71 (77.46%), Query Frame = 3
Query: 1908 GGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIP 2120
            GG+PA+N  G+RL+L++GIIDILQSYR++KK+EH+ KA+  D   +SV  P+FYA+RF  F  N VF+K P
Sbjct:  288 GGVPAKNSKGERLVLYLGIIDILQSYRLIKKLEHSWKALVHDGDTVSVHRPSFYAERFLKFMCNQVFRKTP 358          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003871.1 (pep scaffold:Pmarinus_7.0:GL484476:49:10994:1 gene:ENSPMAG00000003543.1 transcript:ENSPMAT00000003871.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 8.301e-12
Identity = 58/182 (31.87%), Postives = 83/182 (45.60%), Query Frame = 3
Query:  432 DYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYY---INLIQHPR-TLLPKFYGLY------CYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPT-LKDLD---FRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLG 935
            D++ S+ H  +   +  G SGS FY T D+ FI+K +   E     +  P Y+    N +   R T L K  G+Y            K    ++M NL    ++ + +DLKGS   R+  + E +K  P  L  LD    R   D+ LY+      AL   I RD   L S  I+DYSLL+G
Sbjct:  106 DFIHSLSHC-MPWQARGGKSGSAFYETQDERFILKQMSRLEVQSFLEFAPHYFHYITNAVTQKRPTALAKILGVYRIGFKNSQTNTEKKQDLLVMENLFYGRKMTQVFDLKGSLRNRNV-KAELSKEGPCELVLLDENLLRVVRDDPLYVRPHCKAALTAAILRDAHFLSSHLIIDYSLLVG 285          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Match: pip5kl1 (phosphatidylinositol-4-phosphate 5-kinase-like 1 [Source:ZFIN;Acc:ZDB-GENE-060526-248])

HSP 1 Score: 60.8474 bits (146), Expect = 2.746e-10
Identity = 50/157 (31.85%), Postives = 78/157 (49.68%), Query Frame = 3
Query:  360 DFTFKTFAPIAFRYFRDFFQVDITDYLDSI----CHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIR-FVIMNNLV-PSIRIHEKYDLKGSTYKRSANETEKTKPS-PTLKDLDF 809
            DF  +TFA   F  FR    +   DY+ S+    C+  L+ +SN+  S + F++T D  F +KT   +E  FL + L EY  +  ++P TLL K  GL+      +  + F++M ++  P  RI  +YD+KG    R      +  P    LKD +F
Sbjct:   96 DFVLETFAGPVFASFRQLLGLREDDYVGSLASPGCY--LQFISNS-KSKADFFLTNDKRFFLKTQNRREYRFLLRHLREYVQHFEKYPHTLLVKILGLHRISLSNEPKKYFIVMQSVFYPDERIAVRYDIKGCELGRWTQPAPEGSPVIVVLKDNNF 249          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Yeast
Match: MSS4 (Phosphatidylinositol-4-phosphate 5-kinase; involved in actin cytoskeleton organization and cell morphogenesis; multicopy suppressor of stt4 mutation [Source:SGD;Acc:S000002616])

HSP 1 Score: 129.028 bits (323), Expect = 5.789e-31
Identity = 89/257 (34.63%), Postives = 141/257 (54.86%), Query Frame = 3
Query:  228 GIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQE-LRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLY------CYQTMGKN--IRFVIMNNLVPS-IRIHEKYDLKGSTYKRSAN-ETEKTKPS----PTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQ 953
            GI++ V+      K  +   DF   + L F   G + TPS   + F FK + P  FR  R  F +D  DYL S+  +  L EL++ G SGS FY + D ++IIKT+ H E   L+K + EYY ++  +P TL+ +FYGL+       +Q   K+  I F++MNNL P  + IH  YDLKGST+ R  N + E+        P +KDL++ +   +  +  +   +  +  +++D  +L   + MDYSLL+GIH++++
Sbjct:  395 GIRVAVSRCSGIMK-PLTPADFRFTKKLAFDYHGNELTPSSQYA-FKFKDYCPEVFRELRALFGLDPADYLVSLTSKYILSELNSPGKSGSFFYYSRDYKYIIKTIHHSEHIHLRKHIQEYYNHVRDNPNTLICQFYGLHRVKMPISFQNKIKHRKIYFLVMNNLFPPHLDIHITYDLKGSTWGRFTNLDKERLAKDRSYRPVMKDLNWLEEGQKIKFGPLKK-KTFLTQLKKDVELLAKLNTMDYSLLIGIHDINK 648          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Yeast
Match: FAB1 (1-phosphatidylinositol-3-phosphate 5-kinase; vacuolar membrane kinase that generates phosphatidylinositol (3,5)P2, which is involved in vacuolar sorting and homeostasis [Source:SGD;Acc:S000001915])

HSP 1 Score: 66.2402 bits (160), Expect = 2.599e-11
Identity = 54/173 (31.21%), Postives = 75/173 (43.35%), Query Frame = 3
Query:  474 SNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHP----RTLLPKFYGLYCYQT-------MGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLY---LEVDTYEA--LMNTIQRDCRVLESFSIMDYSLLLGIHN 944
            SN G SGS F  T DD FIIK + H E     K  P Y+  + Q       T L K +G Y  Q            +  +IM NL    +    +DLKGS   R   +T K        ++   +N  E +Y   + V  Y+   L  ++  D   L   ++MDYSL++GI N
Sbjct: 2039 SNGGKSGSGFLKTLDDRFIIKELSHAELEAFIKFAPSYFEYMAQAMFHDLPTTLAKVFGFYQIQVKSSISSSKSYKMDVIIMENLFYEKKTTRIFDLKGSMRNRHVEQTGKA------NEVLLDENMVEYIYESPIHVREYDKKLLRASVWNDTLFLAKMNVMDYSLVIGIDN 2205          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Nematostella
Match: EDO41004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5N2])

HSP 1 Score: 362.073 bits (928), Expect = 1.259e-115
Identity = 168/286 (58.74%), Postives = 220/286 (76.92%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKE 974
            KV   KSK+GHRR++++G  TYKK  +S +  A+QLGI  TV     K +RD+L++DF  +ET+ FP  G ++TPSH  SDF FK++AP+AFR+FR+ F +   D++ ++C++ L ELSN GASGS+FY+TCDDEFIIKTVQHKEA FLQKLLP YY+NL Q+ RTLLPKF+GL+CYQ  GKNIR V+MNNL+P   + H KYDLKGSTYKR A++ E+ K  PTLKDLDF  +  E ++LE + Y +L+ T+QRDCRVLESF IMDYS+LLGIHN+D+  R R++
Sbjct:    2 KVTTPKSKLGHRRVDEKGETTYKKTPSSALMSAIQLGIGFTVGRLSAKPERDVLMQDFAQIETVVFPSEGTRETPSHKFSDFKFKSYAPVAFRFFRELFSMRPDDFMMALCNEPLVELSNPGASGSLFYVTCDDEFIIKTVQHKEAEFLQKLLPGYYLNLNQNKRTLLPKFFGLFCYQCGGKNIRLVVMNNLLPRDWKFHFKYDLKGSTYKRRASKAERAKKHPTLKDLDFIVDFPEGIFLEPEIYTSLIKTLQRDCRVLESFKIMDYSILLGIHNIDEAARERQQ 287          

HSP 2 Score: 90.1225 bits (222), Expect = 5.731e-19
Identity = 40/72 (55.56%), Postives = 53/72 (73.61%), Query Frame = 3
Query: 1908 GGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS 2123
            G IPARN  G++L+LF+GIIDILQSYR+ KK+EH  KA+  D   +SV  P+FY +RF +F  + VFKK+P 
Sbjct:  328 GSIPARNAKGEKLLLFVGIIDILQSYRLKKKLEHGWKALVHDGDTVSVHRPSFYCKRFLEFMTSNVFKKLPG 399          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Nematostella
Match: EDO28919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T544])

HSP 1 Score: 281.567 bits (719), Expect = 2.551e-87
Identity = 143/283 (50.53%), Postives = 194/283 (68.55%), Query Frame = 3
Query:  120 KVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDF-FQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMN-NLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLR 962
            KV   KSK+GHRR++++G  TYKK  +S +  A+QLGI  TV     K +RD+L++DF  +ET+ FP  G ++TPSH  SDF FK++AP+AFR+F D  F  D      ++C++ L ELSN GASGS+FY+TCDDEFIIKTVQHKEA FLQKLLP YY+ L+Q      P+FY +      G  ++ ++    L  ++ +H     +GSTYKR A++ E+ K  PTLKDLDF  +  E ++LE + Y +L+ T+QRDCRVLESF IMDYS+LLGIHN+D+  R
Sbjct:    2 KVTTPKSKLGHRRVDEKGETTYKKTPSSALMSAIQLGIGFTVGRLSAKPERDVLMQDFAQIETVVFPSEGTRETPSHKFSDFKFKSYAPVAFRWFYDIRFMPDNM----ALCNEPLVELSNPGASGSLFYVTCDDEFIIKTVQHKEAEFLQKLLPGYYLVLLQRD----PRFYDI-----NGNPLKILVYQVTLCKTVNLHLHKICRGSTYKRRASKAERAKKHPTLKDLDFIVDFPEGIFLEPEIYTSLIKTLQRDCRVLESFKIMDYSILLGIHNIDEAAR 271          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Nematostella
Match: EDO35742 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKP4])

HSP 1 Score: 120.168 bits (300), Expect = 7.407e-29
Identity = 72/208 (34.62%), Postives = 119/208 (57.21%), Query Frame = 3
Query:  333 KDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLI-QHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLD 950
            ++ PSH    F FK + P+ FR  R+ F ++  D  ++     +   S  G SG+ F+++ +  F +K ++ +E   L  +L  Y+ +++ QH  TLLP++  +Y     GK    ++M ++  + ++IH+KYDLKGST  R A+  EKT+ +PT KD DF K+ +  L +  +    L+  I+ D   L S +IMDYSLL+GIH+ D
Sbjct:   75 ENLPSH----FKFKEYCPMVFRNLRERFGIEDKDLAEAFQVPPISSDS-PGRSGAKFFLSQNKRFYVKVIESEEVERLHNILQPYHHHIVEQHANTLLPQYLAMYRVTVDGKESYMLVMTSVFSTRLKIHKKYDLKGSTVDRQASLKEKTRDNPTFKDNDFTKD-NVKLVIGDEAKAVLVERIKADVEFLISLNIMDYSLLVGIHDCD 276          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase type 1 gamma [Source:NCBI gene;Acc:101162441])

HSP 1 Score: 357.451 bits (916), Expect = 9.138e-110
Identity = 169/278 (60.79%), Postives = 213/278 (76.62%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  R R+
Sbjct:   61 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKARPTFKDLDFMQDTPDGLMLDQDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNMDQADRERQ 338          

HSP 2 Score: 90.1225 bits (222), Expect = 5.321e-18
Identity = 46/97 (47.42%), Postives = 62/97 (63.92%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            A +ST +ESIQ          +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F ++ VF+
Sbjct:  357 ALYSTAMESIQGGAACGGSIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPGFYADRFFKFMSSTVFR 450          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase type 1 gamma [Source:NCBI gene;Acc:101162441])

HSP 1 Score: 354.369 bits (908), Expect = 1.377e-109
Identity = 169/278 (60.79%), Postives = 213/278 (76.62%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  R R+
Sbjct:   13 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKARPTFKDLDFMQDTPDGLMLDQDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNMDQADRERQ 290          

HSP 2 Score: 89.7373 bits (221), Expect = 5.758e-18
Identity = 46/97 (47.42%), Postives = 62/97 (63.92%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            A +ST +ESIQ          +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F ++ VF+
Sbjct:  309 ALYSTAMESIQGGAACGGSIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPGFYADRFFKFMSSTVFR 402          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Match: pip5k1ca (phosphatidylinositol-4-phosphate 5-kinase type 1 gamma [Source:NCBI gene;Acc:101162441])

HSP 1 Score: 357.066 bits (915), Expect = 2.254e-109
Identity = 169/278 (60.79%), Postives = 213/278 (76.62%), Query Frame = 3
Query:  141 KIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPS-IRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRK 971
            KIGHR ++  G  TYKK T+S ++ A+QLGI  TV    +K +RD+L++DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DYL S+C++ L ELSN GASGS+FY+T DDEFIIKTV HKEA FLQKLLP YY+NL Q+PRTLLPKF+GLYC Q+ GKNIR V+MNN++P  +R+H KYDLKGSTYKR A++ E+ K  PT KDLDF ++  + L L+ DTY AL+ T+QRDC VLESF IMDYSLLLG+HN+DQ  R R+
Sbjct:   61 KIGHRGVDASGETTYKKTTSSALKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGSNLTPAHHFPDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYLTKDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFFGLYCVQSGGKNIRVVVMNNVLPRVVRMHLKYDLKGSTYKRRASKKEREKARPTFKDLDFMQDTPDGLMLDQDTYNALVKTLQRDCLVLESFKIMDYSLLLGVHNMDQADRERQ 338          

HSP 2 Score: 90.1225 bits (222), Expect = 5.221e-18
Identity = 46/97 (47.42%), Postives = 62/97 (63.92%), Query Frame = 3
Query: 1821 AAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFK 2111
            A +ST +ESIQ          +D+     GGIPA N  G+RL+L++GIIDILQSYR++KK+EH  KA+  D   +SV  P FYA RF  F ++ VF+
Sbjct:  357 ALYSTAMESIQGGAACGGSIDTDDT---MGGIPAVNGKGERLLLYIGIIDILQSYRLIKKLEHTWKALVHDGDTVSVHRPGFYADRFFKFMSSTVFR 450          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Match: ENSORLT00000046121.1 (phosphatidylinositol 4-phosphate 5-kinase type-1 alpha [Source:NCBI gene;Acc:105355004])

HSP 1 Score: 346.28 bits (887), Expect = 1.478e-108
Identity = 167/283 (59.01%), Postives = 207/283 (73.14%), Query Frame = 3
Query:  135 KSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENE 980
            K  IGHR I+ +G  TYKK ++S ++ A+QLGI  TV     K +RD+LL+DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DY+ S+C+  L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP Y++NL Q+ RTLLPKFYGLYC Q  GKNIR V+MNNL+P ++R+H KYDLKGSTYKR A+  E+ K  PT KDLDF ++  E L LE D Y AL  TI RDC +L+SF IMDYS LL IHN+DQ  R +   E
Sbjct:   31 KKTIGHRGIDPQGETTYKKTSSSTLKGAIQLGIAHTVGSLTQKPERDVLLQDFEVVESIFFPSEGSNLTPAHHYGDFKFKTYAPVAFRYFRELFGIRPDDYMYSLCNDGLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYFMNLNQNRRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPNTVRMHSKYDLKGSTYKRRASAKEREKAIPTFKDLDFMQDMQEGLLLEGDKYIALCKTIHRDCLLLQSFKIMDYSFLLAIHNMDQACRDQASEE 313          

HSP 2 Score: 68.1662 bits (165), Expect = 1.978e-11
Identity = 34/69 (49.28%), Postives = 47/69 (68.12%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLD 2033
            +ST +ESIQA          +   + TGGIPA N  G+RL++++GIIDILQSYR +KK+EH+ KA+  D
Sbjct:  331 YSTAIESIQA----------EGGAMATGGIPAWNSRGERLLVYIGIIDILQSYRFVKKLEHSWKALVHD 389          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Match: ENSORLT00000028012.1 (phosphatidylinositol 4-phosphate 5-kinase type-1 alpha [Source:NCBI gene;Acc:105355004])

HSP 1 Score: 348.591 bits (893), Expect = 5.642e-108
Identity = 167/283 (59.01%), Postives = 207/283 (73.14%), Query Frame = 3
Query:  135 KSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVP-SIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENE 980
            K  IGHR I+ +G  TYKK ++S ++ A+QLGI  TV     K +RD+LL+DF VVE++ FP  G   TP+H   DF FKT+AP+AFRYFR+ F +   DY+ S+C+  L ELSN+GASGS+FY++ DDEFIIKTVQHKEA FLQKLLP Y++NL Q+ RTLLPKFYGLYC Q  GKNIR V+MNNL+P ++R+H KYDLKGSTYKR A+  E+ K  PT KDLDF ++  E L LE D Y AL  TI RDC +L+SF IMDYS LL IHN+DQ  R +   E
Sbjct:   40 KKTIGHRGIDPQGETTYKKTSSSTLKGAIQLGIAHTVGSLTQKPERDVLLQDFEVVESIFFPSEGSNLTPAHHYGDFKFKTYAPVAFRYFRELFGIRPDDYMYSLCNDGLIELSNSGASGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYFMNLNQNRRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPNTVRMHSKYDLKGSTYKRRASAKEREKAIPTFKDLDFMQDMQEGLLLEGDKYIALCKTIHRDCLLLQSFKIMDYSFLLAIHNMDQACRDQASEE 322          

HSP 2 Score: 102.449 bits (254), Expect = 5.179e-22
Identity = 59/133 (44.36%), Postives = 78/133 (58.65%), Query Frame = 3
Query: 1827 FSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSV 2225
            +ST +ESIQA    +    S +E   TGGIPA N  G+RL++++GIIDILQSYR +KK+EH+ KA+  D   +SV  P FYA+RF+ F    VFKK+P    P    S  RR    V  A+   P     SS+
Sbjct:  340 YSTAIESIQAEGGAMASTGSADE---TGGIPAWNSRGERLLVYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPRFYAERFEKFMCLRVFKKMPLKSSP----SKKRRANGPVKKAVGFGPSLSAQSSI 465          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Match: SMESG000017265.1 (SMESG000017265.1)

HSP 1 Score: 1529.61 bits (3959), Expect = 0.000e+0
Identity = 769/769 (100.00%), Postives = 769/769 (100.00%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPXXXXXXXXXXXXXXXXXXXXXXXXDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 2396
            AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL
Sbjct:    5 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 773          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Match: SMESG000017265.1 (SMESG000017265.1)

HSP 1 Score: 1472.22 bits (3810), Expect = 0.000e+0
Identity = 748/769 (97.27%), Postives = 748/769 (97.27%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPXXXXXXXXXXXXXXXXXXXXXXXXDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 2396
            AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS                     MRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL
Sbjct:    5 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPS--------------------PMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 753          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Match: SMESG000017265.1 (SMESG000017265.1)

HSP 1 Score: 1417.14 bits (3667), Expect = 0.000e+0
Identity = 714/714 (100.00%), Postives = 714/714 (100.00%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPXXXXXXXXXXXXXXXXXXXXXXXXDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRK 2231
            AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRK
Sbjct:    5 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGENEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYISVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSVIGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRK 718          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Match: SMESG000017265.1 (SMESG000017265.1)

HSP 1 Score: 802.742 bits (2072), Expect = 0.000e+0
Identity = 391/411 (95.13%), Postives = 396/411 (96.35%), Query Frame = 3
Query:   90 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADI---DNKEVKFVDGENEPLVFNKSAIG 1313
            AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIAD     N +   +DG +   V  +S+IG
Sbjct:    5 AKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKENEQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDENNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADTIRGQNNQSNAIDGGSPAAVSPESSIG 415          

HSP 2 Score: 501.901 bits (1291), Expect = 1.070e-165
Identity = 243/244 (99.59%), Postives = 244/244 (100.00%), Query Frame = 3
Query: 1665 NTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 2396
            +TIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL
Sbjct:  388 DTIRGQNNQSNAIDGGSPAAVSPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVELNPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFVHMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLGMPEYSPTDAANANKFALENSPTL 631          
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Match: SMESG000010509.1 (SMESG000010509.1)

HSP 1 Score: 444.121 bits (1141), Expect = 5.044e-145
Identity = 206/274 (75.18%), Postives = 242/274 (88.32%), Query Frame = 3
Query:  132 EKSKIGHRRINDEGTVTYKKKTTSEIQKALQLGIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKTFAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEFIIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRFVIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDESLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQ 953
            +K KIGHRR+N EGTVT+KKKTTSEIQKA+QLG+ I+V   +NK KRDMLLKDFGVVE +  P+TG + TP+H LSDF F+T+APIAFR+FRD F+VD+ +++DSIC ++LRELSN GASGSIFYIT DDEFIIKTV  KEA FLQKLLPEYYINL+QHPRTLLPKFYGLYCY+TMGKNIRFVIMNNL+PSI+IHEKYDLKGSTYKR A++ E++K SPTLKDLDF++NH   L LE +TY+ALM+TI RDC VLESFSIMD+SLLLGIHN+DQ
Sbjct:   20 KKQKIGHRRVNAEGTVTFKKKTTSEIQKAIQLGVNISVGSINNKPKRDMLLKDFGVVELISIPKTGTRTTPAHQLSDFQFRTYAPIAFRFFRDMFKVDMCEFMDSICTKDLRELSNPGASGSIFYITLDDEFIIKTVDKKEAIFLQKLLPEYYINLMQHPRTLLPKFYGLYCYETMGKNIRFVIMNNLLPSIKIHEKYDLKGSTYKRYASKKERSKSSPTLKDLDFKENHPNGLILEPETYDALMSTISRDCMVLESFSIMDFSLLLGIHNVDQ 293          

HSP 2 Score: 123.25 bits (308), Expect = 4.948e-29
Identity = 61/111 (54.95%), Postives = 77/111 (69.37%), Query Frame = 3
Query: 1785 RQKSRSKSTRRIAAFSTVLESIQAPVEQVELN-PSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIFLDPSAISVTNPTFYAQRFQDFFANIVFKK 2114
            R  S  +S +RIAA+ T LESIQ           +D   +P+GGIPARN  G+RL L++GIIDILQSY+I KK+EH  K++  D  AISVTNPTFY QRFQDFF+  VF++
Sbjct:  365 RSSSHGRSVKRIAAYCTPLESIQRDSHTALTEYGNDTNDLPSGGIPARNSKGERLCLYLGIIDILQSYQINKKLEHGFKSLVQDGKAISVTNPTFYKQRFQDFFSKFVFRR 475          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIP5K1A4.101e-10960.00phosphatidylinositol-4-phosphate 5-kinase type 1 a... [more]
PIP5K1A9.897e-10960.00phosphatidylinositol-4-phosphate 5-kinase type 1 a... [more]
PIP5K1A1.000e-10860.00phosphatidylinositol-4-phosphate 5-kinase type 1 a... [more]
PIP5K1A1.399e-10860.00phosphatidylinositol-4-phosphate 5-kinase type 1 a... [more]
PIP5K1A1.920e-10860.00phosphatidylinositol-4-phosphate 5-kinase type 1 a... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ppk-11.328e-11458.25PIP Kinase [Source:UniProtKB/TrEMBL;Acc:O01759][more]
ppk-21.804e-2432.05PIP Kinase [Source:UniProtKB/TrEMBL;Acc:Q9BL73][more]
ppk-31.472e-1132.00PIP Kinase [Source:UniProtKB/TrEMBL;Acc:G5ED98][more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIP5K59B8.967e-11360.75gene:FBgn0034789 transcript:FBtr0071900[more]
PIP5K59B1.716e-11260.75gene:FBgn0034789 transcript:FBtr0304923[more]
PIP5K59B2.278e-11260.75gene:FBgn0034789 transcript:FBtr0290095[more]
PIP5K59B3.088e-11260.75gene:FBgn0034789 transcript:FBtr0304921[more]
PIP5K59B4.416e-11260.75gene:FBgn0034789 transcript:FBtr0339762[more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pip5k1cb1.092e-10960.79phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ca3.188e-10959.44phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ca3.192e-10959.44phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ca4.877e-10959.44phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ca5.115e-10959.44phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIP5K1B4.208e-10558.54phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1c1.455e-10459.93phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1c1.598e-10459.93phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1c2.154e-10459.93phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1c3.943e-10459.93phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pip5k1a6.922e-11059.01phosphatidylinositol-4-phosphate 5-kinase, type 1 ... [more]
Pip5k1a1.335e-10959.01phosphatidylinositol-4-phosphate 5-kinase, type 1 ... [more]
Pip5k1a2.176e-10959.01phosphatidylinositol-4-phosphate 5-kinase, type 1 ... [more]
Pip5k1a2.241e-10959.01phosphatidylinositol-4-phosphate 5-kinase, type 1 ... [more]
Pip5k1b1.006e-10662.03phosphatidylinositol-4-phosphate 5-kinase, type 1 ... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70182|PI51A_MOUSE1.522e-10859.01Phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
sp|D3ZSI8|PI51A_RAT2.215e-10860.36Phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
sp|Q99755|PI51A_HUMAN9.221e-10860.00Phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
sp|Q5CZZ9|PI51B_RAT8.499e-10662.03Phosphatidylinositol 4-phosphate 5-kinase type-1 b... [more]
sp|P70181|PI51B_MOUSE1.126e-10562.03Phosphatidylinositol 4-phosphate 5-kinase type-1 b... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ESS62.839e-13567.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3ET037.335e-13567.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EUV88.878e-13567.24Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A183T4D68.910e-13567.80PIPK domain-containing protein OS=Schistocephalus ... [more]
A0A0X3PYS89.559e-13567.80Phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pip5k1ca5.323e-11059.11phosphatidylinositol 4-phosphate 5-kinase type-1 g... [more]
pip5k1cb8.238e-11059.11phosphatidylinositol 4-phosphate 5-kinase type-1 g... [more]
pip5k1ca1.140e-10959.11phosphatidylinositol 4-phosphate 5-kinase type-1 g... [more]
pip5k1ca1.873e-10959.11phosphatidylinositol 4-phosphate 5-kinase type-1 g... [more]
pip5k1cb3.644e-10961.45phosphatidylinositol 4-phosphate 5-kinase type-1 g... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pip5k1ab2.762e-10359.77phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ab7.370e-10359.77phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
pip5k1ab1.232e-10060.96phosphatidylinositol-4-phosphate 5-kinase, type I,... [more]
ENSPMAT00000003871.18.301e-1231.87pep scaffold:Pmarinus_7.0:GL484476:49:10994:1 gene... [more]
pip5kl12.746e-1031.85phosphatidylinositol-4-phosphate 5-kinase-like 1 [... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
MSS45.789e-3134.63Phosphatidylinositol-4-phosphate 5-kinase; involve... [more]
FAB12.599e-1131.211-phosphatidylinositol-3-phosphate 5-kinase; vacuo... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO410041.259e-11558.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289192.551e-8750.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357427.407e-2934.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pip5k1ca9.138e-11060.79phosphatidylinositol-4-phosphate 5-kinase type 1 g... [more]
pip5k1ca1.377e-10960.79phosphatidylinositol-4-phosphate 5-kinase type 1 g... [more]
pip5k1ca2.254e-10960.79phosphatidylinositol-4-phosphate 5-kinase type 1 g... [more]
ENSORLT00000046121.11.478e-10859.01phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
ENSORLT00000028012.15.642e-10859.01phosphatidylinositol 4-phosphate 5-kinase type-1 a... [more]
back to top
BLAST of Phosphatidylinositol 4 phosphate 5 kinase type 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017265.10.000e+0100.00SMESG000017265.1[more]
SMESG000017265.10.000e+097.27SMESG000017265.1[more]
SMESG000017265.10.000e+0100.00SMESG000017265.1[more]
SMESG000017265.11.070e-16595.13SMESG000017265.1[more]
SMESG000010509.15.044e-14575.18SMESG000010509.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005638 ID=SMED30005638|Name=Phosphatidylinositol 4 phosphate 5 kinase type 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3118bp
AGATAAATGTTTTTTTGAAATCTAATTTTATTTAGAATAATTAATTTTGT
TAAATATTTATTTTTAATATTTCTATAATGTCAATTAATGCAAAAGAAGG
AATGTATTATGAAGAAAGGAAAGTTTTGAAAGAAAAAAGCAAAATTGGGC
ACCGACGCATTAATGATGAAGGAACTGTTACTTATAAAAAGAAAACAACA
TCTGAAATTCAAAAGGCTTTGCAGCTGGGTATCAAAATCACAGTCACTCT
TGCTCATAATAAAAGTAAACGAGACATGTTATTGAAAGATTTTGGGGTTG
TCGAAACATTACCATTTCCGAGAACTGGAGGCAAGGATACTCCTTCACAC
GACCTTAGTGATTTCACTTTCAAAACATTCGCTCCAATTGCCTTTCGATA
TTTCAGGGATTTCTTTCAGGTGGACATTACAGATTACTTGGATTCGATCT
GTCATCAAGAACTACGCGAGTTATCCAATGCTGGGGCATCCGGCTCCATA
TTCTACATAACTTGTGATGATGAATTCATTATCAAAACAGTGCAGCATAA
GGAGGCGTCATTCCTACAGAAGCTGCTGCCTGAATATTACATCAATCTCA
TTCAACATCCGAGAACATTGCTCCCAAAGTTTTATGGACTCTATTGCTAT
CAAACAATGGGCAAGAACATTAGATTTGTCATCATGAATAATTTGGTGCC
GTCGATTAGGATCCATGAGAAATACGACTTGAAAGGATCTACTTATAAAC
GGTCCGCCAATGAAACGGAAAAGACTAAACCAAGCCCAACATTAAAAGAT
TTGGATTTCAGGAAGAATCACGACGAGAGCTTGTATCTTGAGGTGGATAC
GTATGAAGCTCTGATGAATACCATCCAACGAGATTGTCGAGTATTGGAAT
CATTCAGTATTATGGATTATTCCTTGCTATTGGGCATTCACAACCTGGAC
CAAAACCTGCGGATGAGAAAAGAGAATGAACAGGAACAGAAAAATCACGC
ATTGTCAAGTCCTAACCATGCTGTAAAAGACATGTCAGTATTCGAGGATG
AGAATAGCAAGACGAAGAATGACTCGCCAGATATTTCTCAACTCATTATT
CAGAAGGACAGTTTCCTCTCAGATGAAAACAACAGAAACTCTATTAAAGA
TATCGAATCAGAGTTGCTACTTAATATCAAATCATCAGAAAATTCTGAAT
CAACTTCTGGAGATTATTATTGCACTCCTGGAATCGCCGATATTGATAAT
AAGGAAGTGAAATTTGTTGATGGTGAAAACGAGCCACTTGTGTTTAATAA
ATCTGCTATTGGCGGGTTATCCAAGCTCGTCAAAAAATACAAGAAAATAA
GTCCGGAAGCATCTAGTAGAAAAGATGAATTCATTAAAAAGTTGTATCCA
ATCGGAAAGCAGTTGCACTCATATATTAGTGTAAATCCTAAATGCATTAT
AAAATCCGTTGAGAATTGTGTGGAACGCGTTTTTCAAAGTGTCTGGTTAG
ATTGCGATAAAGATTTGTATAGTGTTGTTCCTCCTGTCGCTATTCTGTCA
TCGGGTTCTTCTGATGCATCTTCAGTGATTGGCAGTGAAGAGGAAATATC
ATCCATAGATACCGATGTCATTTACAACTCCCTCATCAAGAACAGCGATC
CTGATAACGACGAGAATACGATCCGGGGTCAGAATAACCAGAGCAACGCC
ATAGATGGGGGGAGCCCTGCCGCCGTAAGTCCTGAATCAAGTATTGGTAA
TCAAATTATTGGAAAACCTCGTGAATCATTCAACCGCCAAAAATCGAGAT
CTAAATCCACCAGGCGGATTGCAGCATTTTCTACAGTGCTCGAATCAATT
CAGGCGCCAGTGGAGCAAGTCGAGTTGAACCCGAGTGACGAGGAATACAT
TCCTACCGGGGGAATTCCAGCCCGCAACAAAGGTGGTGATCGGCTGATCC
TATTTATGGGAATAATAGATATCCTCCAATCATATCGGATAATGAAGAAA
ATGGAACACAATGTCAAGGCCATTTTCTTGGACCCAAGCGCAATTTCCGT
AACAAATCCAACATTCTACGCACAAAGATTCCAGGATTTCTTTGCAAATA
TAGTTTTCAAGAAAATTCCATCACTCGATCAACCTCAAATCCTAGGTTCA
CATGTTAGAAGATTCCGCAATTTCGTTCACATGGCAATGAGGCAGAATCC
TGATAGGAAACGGACGTCATCAGTGAGAAAAGAGAACCTGATTCCAAGCG
ACAAAGAGCGGCAAAATCAATCTCGGGAGGTCATTGACGAATCCGAGCTG
GTGAAAGACGAATTTGAGAATCTCGGAATGCCTGAGTACTCTCCAACTGA
CGCAGCAAACGCAAACAAATTTGCTTTAGAAAATTCACCAACTCTATAAA
AAGAGTAAAGTATTTGAAGGTTTCCATAATCAAAGTAGATGGATTGGATC
CCGCTAGATCAGGAACCCGCGGGTCATAATTTATCTATGATTTGATAATA
TTTAATGGGGAATTTCAGCTGCCACTTGAAGAATTGTTGATGTCATTCTA
TCCTGATGAGTTGAGATTTGAATCGTTAATTATAATTTGTATTGAAAAAA
ATGCATTTAATTACTTGAAGTTTTTTAATATAATGGTGTTGTGTTGGTCA
TATTTACTGTGTACTAAATGGTTATTTGCTAGCTCGTGATCGTGGTGTGT
GGCTGTAATCTAGGTAGTTGGGGGCCTCTGCAAATAATTAGAGAGTCAAA
ACATTAATTAATTTGGTCTTAGTACTGATGACGCTTTGACATGATGGTTT
ATTCACAATCATAAAGTTGTGTAATGTGCTGATTGGTGACTAACTCGACA
AACTAAACTTGGTTTGTGCTATATCGTCCTGATGCTTTTGGCCCTATTTG
GGTAGGCACCAACAACATTTGTAGACGCGACCAAATACTTTAACTCTTTC
AAGCACAGGTATTTTGTCCCCGCTCAATAGATCTGGCGACAATAAAGCTT
GCACTTCATCTTGTCTTCAATTTTTATTGTGTTGTTAATGTTTTCAGTTT
GAAGACGCCATAATTTAACATTACATTTATCCTTCTAAAAATAGGTCTTA
AGCAGATATCGTAAAATT
back to top

protein sequence of SMED30005638-orf-1

>SMED30005638-orf-1 ID=SMED30005638-orf-1|Name=SMED30005638-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=774bp
MSINAKEGMYYEERKVLKEKSKIGHRRINDEGTVTYKKKTTSEIQKALQL
GIKITVTLAHNKSKRDMLLKDFGVVETLPFPRTGGKDTPSHDLSDFTFKT
FAPIAFRYFRDFFQVDITDYLDSICHQELRELSNAGASGSIFYITCDDEF
IIKTVQHKEASFLQKLLPEYYINLIQHPRTLLPKFYGLYCYQTMGKNIRF
VIMNNLVPSIRIHEKYDLKGSTYKRSANETEKTKPSPTLKDLDFRKNHDE
SLYLEVDTYEALMNTIQRDCRVLESFSIMDYSLLLGIHNLDQNLRMRKEN
EQEQKNHALSSPNHAVKDMSVFEDENSKTKNDSPDISQLIIQKDSFLSDE
NNRNSIKDIESELLLNIKSSENSESTSGDYYCTPGIADIDNKEVKFVDGE
NEPLVFNKSAIGGLSKLVKKYKKISPEASSRKDEFIKKLYPIGKQLHSYI
SVNPKCIIKSVENCVERVFQSVWLDCDKDLYSVVPPVAILSSGSSDASSV
IGSEEEISSIDTDVIYNSLIKNSDPDNDENTIRGQNNQSNAIDGGSPAAV
SPESSIGNQIIGKPRESFNRQKSRSKSTRRIAAFSTVLESIQAPVEQVEL
NPSDEEYIPTGGIPARNKGGDRLILFMGIIDILQSYRIMKKMEHNVKAIF
LDPSAISVTNPTFYAQRFQDFFANIVFKKIPSLDQPQILGSHVRRFRNFV
HMAMRQNPDRKRTSSVRKENLIPSDKERQNQSREVIDESELVKDEFENLG
MPEYSPTDAANANKFALENSPTL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016740transferase activity
GO:0016307phosphatidylinositol phosphate kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR023610PInositol-4-P-5-kinase
IPR002498PInositol-4-P-5-kinase_core
IPR027484PInositol-4-P-5-kinase_N
IPR027483PInositol-4-P-5-kinase_C
Vocabulary: biological process
TermDefinition
GO:0046488phosphatidylinositol metabolic process
GO:0016310phosphorylation
GO:0046854phosphatidylinositol phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002498Phosphatidylinositol-4-phosphate 5-kinase, coreSMARTSM00330PIPK_2coord: 68..411
e-value: 1.2E-80
score: 283.9
IPR002498Phosphatidylinositol-4-phosphate 5-kinase, corePFAMPF01504PIP5Kcoord: 126..350
e-value: 2.6E-66
score: 223.7
coord: 578..674
e-value: 4.7E-16
score: 58.8
IPR002498Phosphatidylinositol-4-phosphate 5-kinase, corePROSITEPS51455PIPKcoord: 36..676
score: 58.618
IPR027483Phosphatidylinositol-4-phosphate 5-kinase, C-terminalGENE3DG3DSA:3.30.810.10coord: 571..680
e-value: 2.7E-20
score: 74.6
IPR027483Phosphatidylinositol-4-phosphate 5-kinase, C-terminalGENE3DG3DSA:3.30.810.10coord: 206..341
e-value: 2.1E-32
score: 114.1
IPR027484Phosphatidylinositol-4-phosphate 5-kinase, N-terminalGENE3DG3DSA:3.30.800.10coord: 38..205
e-value: 2.7E-60
score: 205.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..747
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..773
NoneNo IPR availablePANTHERPTHR23086:SF101LP03320P-RELATEDcoord: 572..691
coord: 15..331
NoneNo IPR availableCDDcd17301PIPKc_PIP5KIcoord: 42..290
e-value: 1.5925E-153
score: 447.849
NoneNo IPR availableCDDcd17301PIPKc_PIP5KIcoord: 611..680
e-value: 2.16507E-32
score: 126.207
NoneNo IPR availableSUPERFAMILYSSF56104SAICAR synthase-likecoord: 38..389
NoneNo IPR availableSUPERFAMILYSSF56104SAICAR synthase-likecoord: 562..676
IPR023610Phosphatidylinositol-4-phosphate 5-kinasePANTHERPTHR23086PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASEcoord: 572..691
IPR023610Phosphatidylinositol-4-phosphate 5-kinasePANTHERPTHR23086PHOSPHATIDYLINOSITOL-4-PHOSPHATE 5-KINASEcoord: 15..331