Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30005629
Length (bp)2258
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30005629) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005629) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30005629) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30005629) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30005629

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30005629h1SMcG0010326 Contig4255GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005629h1SMcG0010328 Contig4255GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30005629h1SMcG0018221 Contig4255GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30005629h1SMcG0010328 dd_Smed_v4_4259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30005629h1SMcG0010328 dd_Smed_v4_4259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30005629h1SMcG0010328 dd_Smed_v4_4259_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005629h1SMcG0010328 Contig37593newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30005629h1SMcG0010328 Contig37593uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
tail regionSMED30005629h1SMcG0010328 dd_Smed_v6_4259_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CDKL3 (cyclin dependent kinase like 3 [Source:HGNC Symbol;Acc:HGNC:15483])

HSP 1 Score: 91.6633 bits (226), Expect = 7.644e-19
Identity = 76/228 (33.33%), Postives = 114/228 (50.00%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLKA 1970
            K+G+GSYG V   K  N+    AIKIF +   +SV +I +  EIK+L+ F  +  L++        KKI   F   + ++ ++++             +    + K  ++IL  +  LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK 
Sbjct:    9 KVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAM-REIKFLKQF-HHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKV 217          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CDKL3 (cyclin dependent kinase like 3 [Source:HGNC Symbol;Acc:HGNC:15483])

HSP 1 Score: 91.6633 bits (226), Expect = 1.596e-18
Identity = 76/227 (33.48%), Postives = 114/227 (50.22%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  N+    AIKIF +   +SV +I +  EIK+L+ F  +  L++        KKI   F   + ++ ++++             +    + K  ++IL  +  LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAM-REIKFLKQF-HHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CDKL3 (cyclin dependent kinase like 3 [Source:HGNC Symbol;Acc:HGNC:15483])

HSP 1 Score: 91.2781 bits (225), Expect = 1.974e-18
Identity = 76/227 (33.48%), Postives = 114/227 (50.22%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  N+    AIKIF +   +SV +I +  EIK+L+ F  +  L++        KKI   F   + ++ ++++             +    + K  ++IL  +  LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAM-REIKFLKQF-HHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 85.5001 bits (210), Expect = 1.160e-17
Identity = 61/209 (29.19%), Postives = 108/209 (51.67%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREI-NINEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV----PLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            ++K    + IG+GS+G+VY  +   S    A+K      +S +E+ N+  EI+ +      RGL   N  I      FE   +  +         F++      + E+++  +A +++  L  LH  +ILH D+KP+NILL K G   LCD+G ++ + + T +    + + GT  Y++PEL+  +P  D T +D+WS+G ++ E+  G
Sbjct:    1 MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIM------RGLRHPN--IVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVL---TSIKGTPLYMSPELVEERPY-DHT-ADLWSVGCILYELAVG 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: MAP3K4 (mitogen-activated protein kinase kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6856])

HSP 1 Score: 85.8853 bits (211), Expect = 1.804e-16
Identity = 79/243 (32.51%), Postives = 120/243 (49.38%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPG----TLG---YIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L + +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +PG    TLG   Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1270 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGK 1492          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 81.2629 bits (199), Expect = 3.018e-16
Identity = 62/215 (28.84%), Postives = 113/215 (52.56%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSY---NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            + K  +  K+G+GSYG VY  K  ++    AIK F ++         ++REI + +++K+  L     GL+     N+K+   F L ++++ ++++     NP+     +++  I K+ Y++L  LK  H  K +H D+KPENI L ++ +  L D+G +++I +        +D   T  Y +PEL+ G  Q      DIW++G V  E++ G+
Sbjct:    1 MDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLV----GLIEVFKRNRKLHLVFELCDRTVLHELE----KNPHG----VNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMY----TDYVATRWYRSPELLVGDVQYG-PPVDIWAVGCVYAELLTGE 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 81.2629 bits (199), Expect = 4.002e-16
Identity = 62/215 (28.84%), Postives = 113/215 (52.56%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSY---NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            + K  +  K+G+GSYG VY  K  ++    AIK F ++         ++REI + +++K+  L     GL+     N+K+   F L ++++ ++++     NP+     +++  I K+ Y++L  LK  H  K +H D+KPENI L ++ +  L D+G +++I +        +D   T  Y +PEL+ G  Q      DIW++G V  E++ G+
Sbjct:   31 MDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLV----GLIEVFKRNRKLHLVFELCDRTVLHELE----KNPHG----VNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMY----TDYVATRWYRSPELLVGDVQYG-PPVDIWAVGCVYAELLTGE 228          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 78.1814 bits (191), Expect = 2.624e-15
Identity = 56/205 (27.32%), Postives = 102/205 (49.76%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIF--------NDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEII--KLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            +GKG +G V++ +E  +    A+K+           S +  REI I   +++  +   Y G    +K++   F + + +   ++   ++S P  +V     NE+I  +   ++   L   H   ++H DIKPEN+LLD      L D+G S V+   +     +  L GT+ Y+APE+++ +P       DIW++GI++ EM+ G
Sbjct:   50 LGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLY-GYFHDDKRV---FVILDYASRGELFNVLQSQPGHKV-----NEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWS-VVADHS----KRHTLCGTMDYLAPEMVSNQPHDFNV--DIWAIGILLFEMLVG 238          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 78.1814 bits (191), Expect = 2.624e-15
Identity = 56/205 (27.32%), Postives = 102/205 (49.76%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIF--------NDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEII--KLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            +GKG +G V++ +E  +    A+K+           S +  REI I   +++  +   Y G    +K++   F + + +   ++   ++S P  +V     NE+I  +   ++   L   H   ++H DIKPEN+LLD      L D+G S V+   +     +  L GT+ Y+APE+++ +P       DIW++GI++ EM+ G
Sbjct:   50 LGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLY-GYFHDDKRV---FVILDYASRGELFNVLQSQPGHKV-----NEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWS-VVADHS----KRHTLCGTMDYLAPEMVSNQPHDFNV--DIWAIGILLFEMLVG 238          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cdkl-1 (Cyclin-dependent kinase-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U2H1])

HSP 1 Score: 79.337 bits (194), Expect = 2.820e-15
Identity = 62/215 (28.84%), Postives = 113/215 (52.56%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSY---NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            + K  +  K+G+GSYG VY  K  ++    AIK F ++         ++REI + +++K+  L     GL+     N+K+   F L ++++ ++++     NP+     +++  I K+ Y++L  LK  H  K +H D+KPENI L ++ +  L D+G +++I +        +D   T  Y +PEL+ G  Q      DIW++G V  E++ G+
Sbjct:  132 MDKYDRLSKLGEGSYGVVYKCKNRDTGQIVAIKKFVETEDDPHIKKIALREIRMLKQLKHQNLV----GLIEVFKRNRKLHLVFELCDRTVLHELE----KNPHG----VNDELIKKIIYQLLEALKFCHSHKCIHRDVKPENIFLTRNDQVKLGDFGFARIINTTEMY----TDYVATRWYRSPELLVGDVQYG-PPVDIWAVGCVYAELLTGE 329          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0302950)

HSP 1 Score: 85.1149 bits (209), Expect = 4.187e-17
Identity = 62/228 (27.19%), Postives = 115/228 (50.44%), Query Frame = 3
Query: 1281 MTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKY------LELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +++  +  +++ + +K  ++G+GSYG VY  ++  +    A+K F +S         ++REI + + +K+      LE+F + R L          F   E ++ ++++   +  P        E+   ++ Y+ L+ +   HK   LH DIKPENILL   G+  LCD+G ++++    S   N +D   T  Y APEL+ G  Q   T  D+W++G +  E++ G+
Sbjct:   34 LSLRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKRRLH-------LVFEFCELTVLHELERHPQGCP--------EHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARML----SPGENYTDYVATRWYRAPELLVGDTQYG-TPVDVWAIGCLFAELVRGE 241          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343387)

HSP 1 Score: 84.7297 bits (208), Expect = 6.000e-17
Identity = 64/240 (26.67%), Postives = 119/240 (49.58%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKY------LELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C +P ++        +  +++ + +K  ++G+GSYG VY  ++  +    A+K F +S         ++REI + + +K+      LE+F + R       ++   F   E ++ ++++   +  P        E+   ++ Y+ L+ +   HK   LH DIKPENILL   G+  LCD+G ++++    S   N +D   T  Y APEL+ G  Q   T  D+W++G +  E++ G+
Sbjct:   26 QVCNEP-DLVETRQYRPQGSSKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKR-------RLHLVFEFCELTVLHELERHPQGCP--------EHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARML----SPGENYTDYVATRWYRAPELLVGDTQYG-TPVDVWAIGCLFAELVRGE 244          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343388)

HSP 1 Score: 83.9593 bits (206), Expect = 7.829e-17
Identity = 61/220 (27.73%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 1305 TRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKY------LELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +++ + +K  ++G+GSYG VY  ++  +    A+K F +S         ++REI + + +K+      LE+F + R       ++   F   E ++ ++++   +  P        E+   ++ Y+ L+ +   HK   LH DIKPENILL   G+  LCD+G ++++    S   N +D   T  Y APEL+ G  Q   T  D+W++G +  E++ G+
Sbjct:   19 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKR-------RLHLVFEFCELTVLHELERHPQGCP--------EHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARML----SPGENYTDYVATRWYRAPELLVGDTQYG-TPVDVWAIGCLFAELVRGE 218          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: CG7236 (gene:FBgn0031730 transcript:FBtr0343389)

HSP 1 Score: 83.9593 bits (206), Expect = 8.750e-17
Identity = 61/220 (27.73%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 1305 TRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKY------LELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +++ + +K  ++G+GSYG VY  ++  +    A+K F +S         ++REI + + +K+      LE+F + R       ++   F   E ++ ++++   +  P        E+   ++ Y+ L+ +   HK   LH DIKPENILL   G+  LCD+G ++++    S   N +D   T  Y APEL+ G  Q   T  D+W++G +  E++ G+
Sbjct:   28 SKMDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVSLLEVFRRKR-------RLHLVFEFCELTVLHELERHPQGCP--------EHLTKQICYQTLLGVAYCHKQGCLHRDIKPENILLTAQGQVKLCDFGFARML----SPGENYTDYVATRWYRAPELLVGDTQYG-TPVDVWAIGCLFAELVRGE 227          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Pak (gene:FBgn0267698 transcript:FBtr0334539)

HSP 1 Score: 81.6481 bits (200), Expect = 1.353e-15
Identity = 66/212 (31.13%), Postives = 109/212 (51.42%), Query Frame = 3
Query: 1314 KKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLF-------EKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSL-QINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +K  K +KIG+G+ G VY   E+++  + AIK  N S +  +E+ INE +   E   K+  +++Y      +  L+         S+ + +  T           + E +I  +  E+L  L+ LH  +++H DIK +NILL   G   L D+G     C+Q S  Q  ++ + GT  ++APE++  K    K   D+WSLGI+ IEM+EG+
Sbjct:  428 RKYTKMEKIGQGASGTVYTAIESSTGMEVAIKQMNLSQQPKKELIINEILVMREN--KHPNVVNYLDSYLVSEELWVVMEYLPGGSLTDVVTETC----------MDEGQIAAVCREVLQALEFLHANQVIHRDIKSDNILLGLDGSVKLTDFG----FCAQISPEQSKRTTMVGTPYWMAPEVVTRKQYGPKV--DLWSLGIMAIEMVEGE 621          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: nek1 (NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-040730-1])

HSP 1 Score: 81.6481 bits (200), Expect = 1.402e-16
Identity = 68/214 (31.78%), Postives = 103/214 (48.13%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVRE-----------ININEE--IKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEM 1913
            + K ++  KIG+GS+GK  L K      ++ IK    S  S +E            N++    ++Y E F +  G +      C    LF+K ++N+           R  L  E +I+    +I + LK +H  KILH DIK +NI L K G   L D+G ++V+ S   L        GT  Y++PE+   KP ++  KSDIW+LG V+ EM
Sbjct:    1 MDKYERLKKIGEGSFGKAILVKSRTDGRQYVIKEIGISRMSNKERQESRKEVAVLANMSHPNIVQYKESFEE-SGCLYIVMDYCEGGDLFKK-INNQ-----------RGSLFPEEQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDGTVQLGDFGIARVLNSTVELA---RTCIGTPYYLSPEICENKPYNN--KSDIWALGCVLYEM 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 84.3445 bits (207), Expect = 2.974e-16
Identity = 91/308 (29.55%), Postives = 146/308 (47.40%), Query Frame = 3
Query: 1227 FVNYDEQDCKDPIEISANMTIHLEEMTRL-KKEQKRDKI--GKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV---------PLI-SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKINL-----KALQFXXXXXXXXXXXXXNTNPDERLSAKELLQ 2063
             VN      + P+E S++M     ++  + ++ +  DK+  GKG+YG VY  ++ ++  + AIK   +   +  +  ++EEI   +   K+R ++ Y         L   S D  IKI +   P   +         PL  +E  I+    +IL  LK LH  +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK     L S      K+ +        +  S + K  +  C   NPD+R +A ELL+
Sbjct:  447 LVNSLLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRL-KHRNIVQY---------LGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTET--------FTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLK 735          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 84.3445 bits (207), Expect = 3.117e-16
Identity = 91/308 (29.55%), Postives = 146/308 (47.40%), Query Frame = 3
Query: 1227 FVNYDEQDCKDPIEISANMTIHLEEMTRL-KKEQKRDKI--GKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV---------PLI-SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKINL-----KALQFXXXXXXXXXXXXXNTNPDERLSAKELLQ 2063
             VN      + P+E S++M     ++  + ++ +  DK+  GKG+YG VY  ++ ++  + AIK   +   +  +  ++EEI   +   K+R ++ Y         L   S D  IKI +   P   +         PL  +E  I+    +IL  LK LH  +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK     L S      K+ +        +  S + K  +  C   NPD+R +A ELL+
Sbjct:  598 LVNSLLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRL-KHRNIVQY---------LGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTET--------FTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLK 886          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: map3k4 (mitogen-activated protein kinase kinase kinase 4 [Source:ZFIN;Acc:ZDB-GENE-990603-4])

HSP 1 Score: 84.3445 bits (207), Expect = 3.847e-16
Identity = 78/243 (32.10%), Postives = 119/243 (48.97%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPG----TLG---YIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L + +I   + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +PG    TLG   Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1252 QVCNTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCINVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYSKQITTAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVLIEMVTGK 1474          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-1i11.3 (si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8638])

HSP 1 Score: 83.9593 bits (206), Expect = 4.819e-16
Identity = 91/308 (29.55%), Postives = 146/308 (47.40%), Query Frame = 3
Query: 1227 FVNYDEQDCKDPIEISANMTIHLEEMTRL-KKEQKRDKI--GKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV---------PLI-SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKINL-----KALQFXXXXXXXXXXXXXNTNPDERLSAKELLQ 2063
             VN      + P+E S++M     ++  + ++ +  DK+  GKG+YG VY  ++ ++  + AIK   +   +  +  ++EEI   +   K+R ++ Y         L   S D  IKI +   P   +         PL  +E  I+    +IL  LK LH  +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK     L S      K+ +        +  S + K  +  C   NPD+R +A ELL+
Sbjct:  598 LVNSLLHQTESPVEDSSSMRGEEGDLEYIYERNENGDKVVLGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRL-KHRNIVQY---------LGSVSEDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEATIVFYTKQILDGLKYLHDNQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGINPCTET--------FTGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKPPFHELGSPQAAMFKVGMFKIHPAVPECMSEQAKDFIMCCFEPNPDKRTTASELLK 886          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ephb1 (EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626])

HSP 1 Score: 85.5001 bits (210), Expect = 2.435e-16
Identity = 77/243 (31.69%), Postives = 117/243 (48.15%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLP-------GTLGYIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L   +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +P       GT  Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1169 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISIDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYTKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITQAKGEGHGRAADIWSLGCVLIEMVTGK 1391          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ephb1 (EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626])

HSP 1 Score: 85.1149 bits (209), Expect = 2.651e-16
Identity = 77/243 (31.69%), Postives = 117/243 (48.15%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLP-------GTLGYIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L   +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +P       GT  Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1146 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISIDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYTKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITQAKGEGHGRAADIWSLGCVLIEMVTGK 1368          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ephb1 (EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626])

HSP 1 Score: 85.1149 bits (209), Expect = 2.921e-16
Identity = 77/243 (31.69%), Postives = 117/243 (48.15%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLP-------GTLGYIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L   +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +P       GT  Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1222 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISIDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYTKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITQAKGEGHGRAADIWSLGCVLIEMVTGK 1444          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ephb1 (EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626])

HSP 1 Score: 85.1149 bits (209), Expect = 2.997e-16
Identity = 77/243 (31.69%), Postives = 117/243 (48.15%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLP-------GTLGYIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L   +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +P       GT  Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1105 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISIDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYTKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITQAKGEGHGRAADIWSLGCVLIEMVTGK 1327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ephb1 (EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626])

HSP 1 Score: 85.1149 bits (209), Expect = 3.067e-16
Identity = 77/243 (31.69%), Postives = 117/243 (48.15%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLP-------GTLGYIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++   +   E   +  ++   R        L  +  +I+L   +I I + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +P       GT  Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1253 QVCDTPKSYDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCISIDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEM---YIFMEYCDEGTLEEVSR--------LGLQEHVIRLYTKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLKNNAQTMPGEVNSTLGTAAYMAPEVITQAKGEGHGRAADIWSLGCVLIEMVTGK 1475          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Cdkl3 (cyclin-dependent kinase-like 3 [Source:MGI Symbol;Acc:MGI:2388268])

HSP 1 Score: 92.8189 bits (229), Expect = 7.947e-20
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Cdkl3 (cyclin-dependent kinase-like 3 [Source:MGI Symbol;Acc:MGI:2388268])

HSP 1 Score: 92.8189 bits (229), Expect = 7.947e-20
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Cdkl3 (cyclin-dependent kinase-like 3 [Source:MGI Symbol;Acc:MGI:2388268])

HSP 1 Score: 92.0485 bits (227), Expect = 4.103e-19
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Cdkl3 (cyclin-dependent kinase-like 3 [Source:MGI Symbol;Acc:MGI:2388268])

HSP 1 Score: 91.6633 bits (226), Expect = 1.005e-18
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Cdkl3 (cyclin-dependent kinase-like 3 [Source:MGI Symbol;Acc:MGI:2388268])

HSP 1 Score: 91.6633 bits (226), Expect = 1.005e-18
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9JM01|CDKL3_RAT (Cyclin-dependent kinase-like 3 OS=Rattus norvegicus OX=10116 GN=Cdkl3 PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 6.395e-18
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTTYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IVW4|CDKL3_HUMAN (Cyclin-dependent kinase-like 3 OS=Homo sapiens OX=9606 GN=CDKL3 PE=1 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.663e-18
Identity = 76/227 (33.48%), Postives = 114/227 (50.22%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  N+    AIKIF +   +SV +I +  EIK+L+ F  +  L++        KKI   F   + ++ ++++             +    + K  ++IL  +  LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAM-REIKFLKQF-HHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BLF2|CDKL3_MOUSE (Cyclin-dependent kinase-like 3 OS=Mus musculus OX=10090 GN=Cdkl3 PE=2 SV=2)

HSP 1 Score: 91.2781 bits (225), Expect = 8.891e-18
Identity = 76/227 (33.48%), Postives = 115/227 (50.66%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMS------YNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  ++    AIKIF +   KSV +I    EIK+L+ F ++  L++        KKI   F   + ++ ++++             +    + K  ++IL  ++ LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKI-ATREIKFLKQF-RHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIEYLHNNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGHPFLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R8T9|CDKL3_MACFA (Cyclin-dependent kinase-like 3 OS=Macaca fascicularis OX=9541 GN=CDKL3 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.026e-17
Identity = 76/227 (33.48%), Postives = 114/227 (50.22%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSA-KSVREININEEIKYLELFPKYRGLMSY------NKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELI-----NGKPQSDKTKSDIWSLGIVIIEMMEGKL----SSDIKFSHKINLK 1967
            K+G+GSYG V   K  N+    AIKIF +   +SV +I +  EIK+L+ F  +  L++        KKI   F   + ++ ++++             +    + K  ++IL  +  LH   I+H DIKPENIL+ +SG   LCD+G ++ + +   +    +D   T  Y APEL+      GKP       DIW+LG +IIEM  G      SSD+   HKI LK
Sbjct:    9 KVGEGSYGTVMKCKHKNTGQIVAIKIFYERPEQSVNKIAM-REIKFLKQF-HHENLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHG--------LESKRLRKYLFQILRAIDYLHSNNIIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDIY---TDYVATRWYRAPELVLKDTSYGKP------VDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLK 216          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O59790|ARK1_SCHPO (Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ark1 PE=1 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 4.327e-17
Identity = 76/258 (29.46%), Postives = 125/258 (48.45%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSA-------KSVR-EININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKL--------SSDIKFSHKINLKALQFXXXXXXXXXXXXXNTNPDERLSAKELLQ 2063
            +GKG +G+VYL KE  +    A+K  + S        K VR EI I   +++  +   Y G     K+I   + + E +   ++   +R    F     SE    K  +++   L  LHK  ++H DIKPENILL   G   L D+G S    S       ++ L GTL Y+ PE++ GK  ++K   D+WSLG++  E + G          S+  K   K++LK   F     + ++ + L  NP++R+S +++++
Sbjct:   95 LGKGKFGRVYLAKEKKTGFIVALKTLHKSELVQSKIEKQVRREIEIQSNLRHKNILRLY-GHFHDEKRI---YLILEFAGRGELYQHLRRAKRF-----SEEVASKYIFQMANALSYLHKKHVIHRDIKPENILLGIDGEIKLSDFGWSVHAPSN-----RRTTLCGTLDYLPPEMVEGKEHTEKV--DLWSLGVLTYEFLVGAPPFEDMSGHSATYKRIAKVDLKIPSFVPPDARDLISRLLQHNPEKRMSLEQVMR 336          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1D2NI39 (Serine/threonine-protein kinase 36 (Fragment) OS=Orchesella cincta OX=48709 GN=Ocin01_01712 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.212e-19
Identity = 68/208 (32.69%), Postives = 113/208 (54.33%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREI-NINEEIKYLELFPK---YRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            + + Q   +IG GS+G VY+ +  N++   A+K  N   K  REI ++ +E +  + F      R L ++N    A   + E + ++  +   R+ P   +PL   NE+ ++A  I+  L  LH  +ILH DIKP+NILL   G A LCD+G +K +     +    + + GT  Y+APE++N KP      +D+WSLG ++ E+++G
Sbjct:    1 MDRYQDLKEIGAGSFGTVYVCRIKNTETFVALKKINTRGKHAREIESLRQECEIQKNFKHPNIIRMLDAFNTDD-AVVVVTEYAREDLARCKDRA-PGKCLPL---NEVQRIACHIVSALYFLHSHRILHRDIKPQNILLGWDGMAKLCDFGFAKAMAPSDYML---TSVKGTPLYMAPEIVNEKPYDH--NADLWSLGCILYELLKG 198          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: W4K4N4 (Protein kinase domain-containing protein OS=Heterobasidion irregulare TC 32-1 OX=747525 GN=HETIRDRAFT_320912 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 5.426e-19
Identity = 65/225 (28.89%), Postives = 115/225 (51.11%), Query Frame = 3
Query: 1323 QKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELF------PKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLKALQF 1979
            Q+ + +GKG+YG V+  +   + +  A+KI +         +I  E+  L          KY G      ++   + + E +    +   ++++P      + E  ++ +  E+L+ L  LHK  I+H DIK  N+L+  SG+  LCD+G S ++ + +S    +S L GT  ++APE++   P  D TK+DIWSLGI+I EM++G        S+ +  +A+Q 
Sbjct:   11 QRLETVGKGAYGSVHKGRHIPTGNIVALKIIDLDTADDDVDDIQREVALLTQLRDAPNITKYYGCHLDGPRV---WIVMEFAQGGSVFNLMKASPEN---CLEEKYVVIIVREVLLALSYLHKSSIIHRDIKSANVLVTSSGKVMLCDFGVSALLATTSS---KRSTLIGTPYWMAPEVVQPVPAYD-TKADIWSLGIMIYEMVKG----SPPHSNMVAARAIQL 221          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A2D4CJE2 (ULK/FUSED protein kinase OS=Pythium insidiosum OX=114742 GN=PINS_014472 PE=3 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 6.081e-19
Identity = 66/203 (32.51%), Postives = 108/203 (53.20%), Query Frame = 3
Query: 1332 DKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREI-NINEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV----PLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            ++IG+GS+GKVY  +   +    A+K  +   +S RE+ N+ EEI  L      R L   N  I A    FE   +  +         F+V      + E+EI  +A ++L  L VLH  +I+H D+KP+NIL+    +  L D+G ++ I + TS+    + + GT  Y+APEL+  +P +    +D+WSLG+++ E+  GK
Sbjct:    8 ERIGEGSFGKVYRGRRKYTGQVVALKFVSKRGRSARELHNLREEINIL------RRLHHIN--IIAMLDSFETDGEFCMVTEYAQGELFQVLEDDRQLPESEIRAIAIQLLQALHVLHSNRIIHRDMKPQNILIGSKQQIKLADFGFARAISNDTSV---LTSIKGTPLYMAPELVQERPYNH--TADLWSLGVILYELAVGK 197          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: F8PWA7 (Protein kinase domain-containing protein OS=Serpula lacrymans var. lacrymans (strain S7.3) OX=936435 GN=SERLA73DRAFT_53219 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.619e-19
Identity = 64/224 (28.57%), Postives = 118/224 (52.68%), Query Frame = 3
Query: 1323 QKRDKIGKGSYGKVYLFKEANSDDKFAIKIFN-----DSAKSV-REININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKIN 1961
            ++ + +GKG+YG V+      + +  A+KI N     D  +++ RE+ +  +++      KY G      ++   + + E +    ++  ++++   +  +I E  I+ +  E+L+ L  LHK  I+H DIK  N+L+  SG+  +CD+G S +  + TS    ++ L GT  ++APE+    P  D +K+DIWSLGI++ EM++G      +   IK  H I 
Sbjct:   11 RRLETVGKGAYGSVHKGVHIPTGNVVALKIINLDTADDDVEAIQREVALLTQLRDAPNVTKYYGCYLDGPRV---WIVMEFAQGGSVRTLMQAS---KEGVIEERYIVIIVREVLVGLSYLHKSAIIHRDIKAANVLITASGKVMICDFGVSALSATTTS---KRNTLMGTPNWMAPEVAQAVPAYD-SKADIWSLGIMVYEMVKGAPPHADMRDAIKVMHMIT 224          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0CLD6 (Uncharacterized protein OS=Paramecium tetraurelia OX=5888 GN=GSPATT00008151001 PE=3 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.076e-19
Identity = 79/262 (30.15%), Postives = 131/262 (50.00%), Query Frame = 3
Query: 1329 RDKIGKGSYGKVYLFKEANSDDKFAIKIFN--------DSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKL-----SSDIKFSHKINLKALQFXXXXXXXXXXXXXN---TNPDERLSAKELLQL 2066
            + ++GKGSYG+V L K+  +   +A+KI N         +    REI I   + +    P    L  Y +     + + E + +  + + IR     R   + E E     ++  + ++ LHK  +LH D+KPEN+LLDK G   +CD+G S    ++ + Q  ++   GTL Y+APE++  KP     K DIW LGI++ E++ G       ++  K  + INL+ ++F      ++     N   TNP++RLS   LLQ+
Sbjct:   84 KSELGKGSYGQVKLVKDRQNGQLYAMKILNKKRIFEYWSTENLKREIKIQRRLSH----PHIVKLYHYFEDKENVYLILELAENGSLFVYIR-----RRKRLPEKEAFVYFFQTCLGIEYLHKKNVLHRDLKPENLLLDKQGNIKVCDFGWS----AEANQQSKRTTFCGTLDYMAPEMLLNKPYD--FKLDIWCLGILLYELIHGYAPFKGKTNQEKGQNIINLQTIEFNETCSFEVKDLISNILKTNPEDRLS---LLQI 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000033332.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 86.2705 bits (212), Expect = 7.492e-18
Identity = 60/211 (28.44%), Postives = 108/211 (51.18%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            ++K +K  KIG+GSYG V+  +  ++    AIK F +S         ++REI + +++K++ L      +    +++   F   E+++ N++    +  P        E ++  + ++ L  +   HK   +H D+KPENILL K+G   LCD+G ++++   T    + +D   T  Y APEL+ G  Q      D+W+LG V  E++ G
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLV-NLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVP--------EAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARIL---TGPGDDYTDYVATRWYRAPELLVGDTQYGPA-VDVWALGCVFAELLNG 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000057054.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 84.7297 bits (208), Expect = 3.326e-17
Identity = 60/211 (28.44%), Postives = 108/211 (51.18%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            ++K +K  KIG+GSYG V+  +  ++    AIK F +S         ++REI + +++K++ L      +    +++   F   E+++ N++    +  P        E ++  + ++ L  +   HK   +H D+KPENILL K+G   LCD+G ++++   T    + +D   T  Y APEL+ G  Q      D+W+LG V  E++ G
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLV-NLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVP--------EAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARIL---TGPGDDYTDYVATRWYRAPELLVGDTQYGPA-VDVWALGCVFAELLNG 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052448.1 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:103024925])

HSP 1 Score: 84.7297 bits (208), Expect = 3.326e-17
Identity = 60/211 (28.44%), Postives = 108/211 (51.18%), Query Frame = 3
Query: 1311 LKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            ++K +K  KIG+GSYG V+  +  ++    AIK F +S         ++REI + +++K++ L      +    +++   F   E+++ N++    +  P        E ++  + ++ L  +   HK   +H D+KPENILL K+G   LCD+G ++++   T    + +D   T  Y APEL+ G  Q      D+W+LG V  E++ G
Sbjct:    1 MEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEDDPVIKKIALREIRMLKQLKHVNLV-NLLEVFRRKRRLHLVFEFCEQTVLNELDKHPKGVP--------EAQLKSIIWQTLQAVNFCHKNNCIHRDVKPENILLTKTGIIKLCDFGFARIL---TGPGDDYTDYVATRWYRAPELLVGDTQYGPA-VDVWALGCVFAELLNG 198          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: pak1 (p21 protein (Cdc42/Rac)-activated kinase 1 [Source:ZFIN;Acc:ZDB-GENE-030826-29])

HSP 1 Score: 83.1889 bits (204), Expect = 2.574e-16
Identity = 68/210 (32.38%), Postives = 99/210 (47.14%), Query Frame = 3
Query: 1314 KKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRG-----LMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQ-TSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            KK  + +KIG+G+ G VY   +  +  + AIK  N   +  +E+ INE +   E  P   G     +M Y         + E  MD                   E +I  +  E L  L+ LH  +++H DIK +NILL   G   L D+G     C+Q T  Q  +S + GT  ++APE++  K    K   DIWSLGI+ IEM+EG+
Sbjct:  229 KKYTRFEKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKPYLVGDELWVVMEYLAGGSLTDVVTETCMD-------------------EAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFG----FCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKV--DIWSLGIMAIEMIEGE 413          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: map3k15 (mitogen-activated protein kinase kinase kinase 15 [Source:ZFIN;Acc:ZDB-GENE-091204-246])

HSP 1 Score: 83.5741 bits (205), Expect = 5.590e-16
Identity = 67/210 (31.90%), Postives = 104/210 (49.52%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLI--------SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +G+G+YG VY  ++ ++  + AIK   +      +  ++EEI  L  + K R ++ Y         L   S D  IKI +   P   +  +         E  II    +IL  L+ LH+ +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK
Sbjct:  647 LGRGTYGVVYAGRDLSNQVRIAIKEIPERDSRYSQ-PLHEEIA-LHKYLKQRNIVQY---------LGSVSEDGYIKIFMEQVPGGSLSALLRSKWGPLKEATIIFYTRQILEGLRYLHENQIVHRDIKGDNVLVNTYSGVLKISDFGTSKRLAGVNPCTET--------FTGTLQYMAPEIIDKGPRGYGAPADIWSLGCTIIEMATGK 837          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k2 (mitogen-activated protein kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-120215-96])

HSP 1 Score: 83.5741 bits (205), Expect = 6.787e-17
Identity = 68/214 (31.78%), Postives = 112/214 (52.34%), Query Frame = 3
Query: 1323 QKRDKIGKGSYGKVYLFKEANSDDKFAIKIFN---DSAKSVREININE-EIKYL-----ELFPKYRGLMSYNKKICAAFSLFEKSMDN-KIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSK---VICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q+   +G+G++G+VYL  +A++  + A+K       S ++ +E+N  E EI+ L     E   +Y G +   ++     S+F + M    IK  +R+        ++EN   K   +IL  +  LH   I+H DIK  NIL D +G   L D+G SK    ICSQ +   + +   GT  +++PE+ING  +    K+DIWS+G  ++EM+  K
Sbjct:  360 QRGKLLGQGAFGRVYLCYDADTGRELAVKQVQFDPGSVETSKEVNALECEIQLLKNLQHERIVQYFGCLRDPQQ--KTLSIFMEYMPGGSIKDQLRA-----YGALTENVTRKYTRQILEGVSFLHGNMIVHRDIKGANILRDSTGNVKLGDFGASKRLQTICSQGTAMRSVT---GTPYWMSPEVING--EGYGRKADIWSVGCTVVEMLTEK 561          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 83.1889 bits (204), Expect = 1.416e-16
Identity = 61/202 (30.20%), Postives = 104/202 (51.49%), Query Frame = 3
Query: 1332 DKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREI-NINEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV----PLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            + IG+GS+GKVY  ++  +    A+K      +S +E+ N+  EI  +      RGL   N  I      FE   +  +         F++      + E ++ ++A +++  L  LH  +ILH D+KP+NILL K G   LCD+G ++ +   T   +  + + GT  Y++PEL+  KP  D T +D+WS+G ++ E+  G
Sbjct:    8 EMIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKELRNLRREIDIM------RGLQHPN--IVQMLDSFETDKEVVVVTDYAEGELFQILEDDGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINT---LVLTSIKGTPLYMSPELVEEKPY-DHT-ADLWSMGCILYELFVG 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007414.1 (pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1 gene:ENSPMAG00000006689.1 transcript:ENSPMAT00000007414.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 5.598e-16
Identity = 68/207 (32.85%), Postives = 98/207 (47.34%), Query Frame = 3
Query: 1332 DKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVRE-----------ININEE--IKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEM 1913
             +IG+GS+GK  L K       + IK  N S  S +E            N+     + Y E F + RG +      C    LF+           R N    V L SE++I+    ++ + LK +H  KILH DIK +NI L K+G   L D+G ++V+ S T L        GT  Y++PE+   KP +   KSD+W+LG V+ EM
Sbjct:    8 SQIGEGSFGKAMLVKSKADGHLYVIKEINISRMSPKERDEARKEVCVLANMRHPNIVSYKESF-EERGNLYIVMDYCEGGDLFK-----------RINAQKGV-LFSEDQILDWLVQLCLALKHVHDRKILHRDIKSQNIFLTKAGIVQLGDFGIARVLNSTTEL---ARTCIGTPYYLSPEICENKPYNH--KSDMWALGCVLYEM 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: pak4 (p21 protein (Cdc42/Rac)-activated kinase 4 [Source:ZFIN;Acc:ZDB-GENE-040704-69])

HSP 1 Score: 77.0258 bits (188), Expect = 8.316e-15
Identity = 62/204 (30.39%), Postives = 97/204 (47.55%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMS-YNKKICA-----AFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKS-DLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            KIG+GS G V L  +  S  + A+K  +   +  RE+  NE +   E    +  ++  YN  + A          E      I    R N         E +I  +   +L  L  LH   ++H DIK ++ILL   GR  L D+G     C+Q S ++ +   L GT  ++APE+I+  P   +   D+WSLGI++IEM++G+
Sbjct:  424 KIGEGSTGVVCLAVDRRSGRQVAVKKMHLRKQQRRELLFNEVVIMREYH--HENVVDMYNSYLVADELWVVMEFLEGGALTDIVTHTRMN---------EEQIATVCVSVLRALAYLHGQGVIHRDIKSDSILLTADGRIKLSDFG----FCAQVSKEVTRRKSLVGTPYWMAPEVISRLPYGPEV--DVWSLGIMVIEMVDGE 610          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004683.1 (pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene:ENSPMAG00000004265.1 transcript:ENSPMAT00000004683.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 2.237e-14
Identity = 51/154 (33.12%), Postives = 79/154 (51.30%), Query Frame = 3
Query: 1605 LISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKL---SSDIKFSHKINLKA----LQFXXXXXXXXXXXXXNTNPDERLS 2045
            + +E ++     E+ + L  LH   I++ D+KPENILLD+SG   L D+G SK        +       GT+ Y+APE++N K  +    +D WS G+++ EM+ G L     D K +  + LKA     QF S + + +L+     NP  RL 
Sbjct:   29 MFTEEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDESGHIGLTDFGLSKESIDH---EKKAYSFCGTVEYMAPEVVNRKGHTH--SADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSGEAQSLLRMLFKRNPGNRLG 177          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 88.5817 bits (218), Expect = 7.776e-19
Identity = 68/206 (33.01%), Postives = 103/206 (50.00%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFND-------SAKSVREININEEIKYLELFPKYRGLMS--YNKKICAAFS-LFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +G+G+ G V   K  N    FA+K+ N          +  RE+  N   +  E   +Y G+ +   N  I  A   +  +S+D   K  +      R   ISE  + K+A  +L  L  LH+ K++H DIKP+NILL+++G+  LCD+G S    +  +         GT  Y+APE I G+P S    SD+WSLG+ I+E+  GK
Sbjct:  227 LGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFNRSFQS-EYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLE-----RGGRISEKVLGKIAEAVLRGLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFT-----GTSFYMAPERIQGQPYS--VTSDVWSLGLTILEVANGK 419          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 83.9593 bits (206), Expect = 2.244e-17
Identity = 62/204 (30.39%), Postives = 102/204 (50.00%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFND-------SAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKL 1928
            +G+G+ G V   +  N    FA+K  N          +  RE+  N+  K  +   +Y G+ + +++  + +   E      ++ T + N   R   ISE  I K+A  +L  L  LH+ K++H DIKP+NILL++ G   LCD+G S    +  ++        GT  Y+APE I G+P S     D+WSLG+ ++E+  G+ 
Sbjct:  220 LGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFNKSFKS-DYIVQYYGMFT-DEQSSSIYIAMEYMGGKSLEATYK-NLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFT-----GTSFYMAPERIQGQPYS--VTCDVWSLGLTLLEVAGGRF 413          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 82.8037 bits (203), Expect = 2.300e-17
Identity = 64/212 (30.19%), Postives = 99/212 (46.70%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIF--------------NDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAA--FSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            +G GS+G+V+L +  ++   +AIK+               ND  + ++ +     I+    F   R +      I     FSL  KS               R P    N + K  A E+++ L+ LH   I++ D+KPENILLD++G   + D+G +K + + T        L GT  YIAPE+I  KP +     D WSLG++I EM+ G
Sbjct:   76 LGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQ--------------RFP----NPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQTVT------WTLCGTPDYIAPEVITTKPYNKSV--DWWSLGVLIYEMLAG 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 82.0333 bits (201), Expect = 3.714e-17
Identity = 63/209 (30.14%), Postives = 103/209 (49.28%), Query Frame = 3
Query: 1332 DKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKI-------CAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQT----SLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            D IG+G+YG V       S  K AIK     +K +       EIK L  F ++  ++S   K+         A  L E+ M+  ++  I +N N     +S++ +    Y+IL  LK +H  +++H DIKP N+LL+ +    +CD+G ++ + S +    +L    ++   T  Y APE++    Q   T  DIWS G ++ EM+ GK
Sbjct:   17 DLIGEGAYGTVCSAIHKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVI-NNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTF-QEYTTAMDIWSCGCILAEMVSGK 223          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 76.6406 bits (187), Expect = 1.051e-15
Identity = 61/216 (28.24%), Postives = 110/216 (50.93%), Query Frame = 3
Query: 1302 MTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF------NDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIK-LAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINK-SDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            M+   + ++ +K+G G+Y  VY      +    A+K           + ++REI++ +E+K+  +   Y  + + NK      +L  + MDN +K  + S      P   E  ++K   +++L  L   H+ KILH D+KP+N+L++K G+  L D+G ++       + +N  S    TL Y AP+++ G  ++  T  DIWS G ++ EM+ GK
Sbjct:    1 MSSSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENK-----LTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAF----GIPVNTFSSEVVTLWYRAPDVLMGS-RTYSTSIDIWSCGCILAEMITGK 206          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO35402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ0])

HSP 1 Score: 87.0409 bits (214), Expect = 1.898e-18
Identity = 57/203 (28.08%), Postives = 108/203 (53.20%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            +G+GSYG V   +  +S+   AIK F +S         ++RE+ +  ++++  L      L+   ++    F +FE  +D+ +   +   PN     + EN + K+ +++L  ++ +H+  I+H D+KPENIL+ +SG   LCD+G ++ + S        +D   T  Y APEL+ G  +  +   D+W++G ++ EM+ G+
Sbjct:   10 VGEGSYGMVMKCRHKDSNQIVAIKKFIESEDDKMVKKIAMREVRMLRQLRHENLV----NLIEVFRRKKRLFLVFE-FVDHTVLDDLERYPNG----LDENTVRKVMWQVLRAIEFIHRHNIIHRDVKPENILVSRSGIVKLCDFGFARTLASGQGEAY--TDYVATRWYRAPELLVGDTKYGRA-VDVWAVGCLLAEMLTGE 200          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG02])

HSP 1 Score: 82.4185 bits (202), Expect = 3.205e-17
Identity = 62/205 (30.24%), Postives = 97/205 (47.32%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEE-------------IKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEM 1913
            IGKGSYG+V+L K      ++ +K  +    SVRE    E              + Y E F    G +      C    L+ +    K            +PL  EN+I++   +I + L+ +H+  ILH D+K +NI L KS    + D G ++V+ S + +    + L GT  Y++PEL + KP +   KSD+W+LG  + EM
Sbjct:   12 IGKGSYGEVFLSKHKKDKKQYVLKKVDLQKASVRERKAAELEAKLLSQLRHPNIVSYRESFQDDTGFLYIAMNFCEGGDLYSRLKAQK-----------GIPL-DENQIVEWFVQIAMALQYMHEKHILHRDLKTQNIFLTKSKIIKVGDLGIARVLESSSDMA---TTLIGTPYYMSPELFSNKPYNH--KSDVWALGCCLYEM 199          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG20])

HSP 1 Score: 82.0333 bits (201), Expect = 3.261e-17
Identity = 65/200 (32.50%), Postives = 102/200 (51.00%), Query Frame = 3
Query: 1335 KIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREIN-INEEIKYLELFPKYRGLMSYNKKICAAFSLFE-----KSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMM 1916
            KIG+GS+GK  L K+ N    + IK  N      RE     +E+K L    K+  ++SY +    + +L+         D   KI  +    F     SE++++    +I + LK +H  KILH DIK +NI L + G   + D+G ++V+ S   L        GT  Y++PE++  +P ++  KSDIWSLG V+ EM+
Sbjct:    9 KIGEGSFGKALLVKKRNDGKHYVIKEINICRMKPREREESRKEVKVLSQL-KHPNIVSYQESFEESGNLYIVMDYCDGGDLYKKINGQRGIAF-----SEDQVMDWFVQICLGLKHVHDRKILHRDIKSQNIFLTRHGIIKMGDFGIARVLHSTVELA---RTCIGTPYYLSPEIVENRPYNN--KSDIWSLGCVLYEML 197          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO38062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX6])

HSP 1 Score: 81.2629 bits (199), Expect = 1.514e-16
Identity = 61/213 (28.64%), Postives = 101/213 (47.42%), Query Frame = 3
Query: 1323 QKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVRE------ININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHK-WKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSD----KTKSDIWSLGIVIIEMMEGKL 1928
            Q+  ++G G+YG VY      +    A+K    +  S  +      ++I+  +        + G +     +     L + S+ +  K  + S P+ R+P   E  + K+A  ++  L+ LH   K++H D+KP NIL+D+ G   LCD+G S  +    +  ++     G   Y+APE IN  P  D      +SDIWSLGI +IE+  GK 
Sbjct:   59 QEIRELGHGAYGYVYEMLHVPTSTVMAVKKIRANVNSTEQKRLLMDLDISMRVSDYPYTVHFYGALFREGDVWICMELMKTSLYDLYK-QVFSKPDRRIP---EEVLGKIAVSVVSALEYLHSNLKVIHRDVKPSNILVDERGNFKLCDFGISGQLVDSLAKTVDA----GCKPYMAPERIN--PDRDMKGYDIRSDIWSLGITMIELATGKF 261          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46185 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQY7])

HSP 1 Score: 82.0333 bits (201), Expect = 3.786e-16
Identity = 64/200 (32.00%), Postives = 109/200 (54.50%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKI----FNDSAKSVREININEEIKYLELFPKYRGLMSYNKKIC---AAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRAT-LCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEM 1913
            +G+G+YG VYL +     D F + I      +  K  R+  +NE +K L +F ++  ++ Y        A   + E +    I   ++        L+ E+EI++L  +IL+ L+ +HK +ILH D+K +NILL+K  +   + D+G SK++ S++      + + G+  YI+PEL  GKP +   KSD+WSLG V+ E+
Sbjct:   10 VGRGAYGTVYLCRRLV--DNFLVIIKQIPVEEMTKEERQSALNE-VKVLSMF-QHPNIIRYYDSFVQEKALMIVMEYAQGGTIYDYLQQRGG---KLMDEDEILRLFVQILLALRHVHKGQILHRDLKTQNILLNKKRKVVKIGDFGISKILSSKS----KANTVIGSPCYISPELCEGKPYNQ--KSDVWSLGCVLYEL 196          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001547.2 (cyclin-dependent kinase-like 1 [Source:NCBI gene;Acc:101157382])

HSP 1 Score: 92.0485 bits (227), Expect = 1.171e-19
Identity = 62/214 (28.97%), Postives = 112/214 (52.34%), Query Frame = 3
Query: 1302 MTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAK-------SVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEG 1922
            M  ++K +K  KIG+GSYG V+  +  ++    AIK F +S +       ++REI + +++K++ L      +    +++   F   E+++ N++    R  P        E ++  + ++ L  +   HK   +H D+KPENILL K+G   LCD+G ++++   T  + + +D   T  Y APEL+ G  Q      D+W+LG V  E+++G
Sbjct:    1 MDMMEKYEKLAKIGEGSYGVVFKCRNRDTGQIVAIKKFVESEEDPVIKKIALREIRMLKQLKHVNLV-NLLEVFRRKRRLHLVFEFCEQTVLNELDRHPRGVP--------EAQLKSIVWQTLQAVNFCHKHNCIHRDVKPENILLTKTGVIKLCDFGFARIL---TGPEDDYTDYVATRWYRAPELLVGDTQYG-PPVDVWALGCVFAELLDG 201          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 85.5001 bits (210), Expect = 1.351e-16
Identity = 86/272 (31.62%), Postives = 130/272 (47.79%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV---------PLI-SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKINL-----KALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAF 2075
            +GKG+YG VY  ++ ++  + AIK   +   +  +  ++EEI   +   K+R ++ Y         L   S D  IKI +   P   +         PL  +E  II    ++L  LK LH  +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK     L S      K+ +     K  +  S + K  +  C   NPD R +A ELL +D F
Sbjct:  583 LGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRL-KHRNIVQY---------LGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTET--------FAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELL-MDTF 834          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: si:ch211-1i11.3 (mitogen-activated protein kinase kinase kinase 5 [Source:NCBI gene;Acc:101167985])

HSP 1 Score: 85.5001 bits (210), Expect = 1.433e-16
Identity = 86/272 (31.62%), Postives = 130/272 (47.79%), Query Frame = 3
Query: 1338 IGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRV---------PLI-SENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDK-SGRATLCDYGCSKVI-----CSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK-----LSSDIKFSHKINL-----KALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAF 2075
            +GKG+YG VY  ++ ++  + AIK   +   +  +  ++EEI   +   K+R ++ Y         L   S D  IKI +   P   +         PL  +E  II    ++L  LK LH  +I+H DIK +N+L++  SG   + D+G SK +     C++T          GTL Y+APE+I+  P+     +DIWSLG  IIEM  GK     L S      K+ +     K  +  S + K  +  C   NPD R +A ELL +D F
Sbjct:  639 LGKGTYGVVYAGRDLSNQVRIAIKEIPEKDSTYSQ-PLHEEIALHKRL-KHRNIVQY---------LGSVSQDGFIKIFMEEVPGGSLSSLLRSKWGPLKDNEPTIIFYTKQVLEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTET--------FAGTLQYMAPEIIDQGPRGYGKPADIWSLGCTIIEMATGKTPFHELGSPQAAMFKVGMFKIHPKVPECMSDEAKGFIMSCFEPNPDNRATAAELL-MDTF 890          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015480.2 (serine/threonine-protein kinase PAK 2 [Source:NCBI gene;Acc:101169249])

HSP 1 Score: 83.1889 bits (204), Expect = 2.845e-16
Identity = 66/212 (31.13%), Postives = 106/212 (50.00%), Query Frame = 3
Query: 1314 KKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLF-------EKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQ-TSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            KK  + +KIG+G+ G VY   + ++  + AIK  N   +  +E+ INE +   EL  K   ++++         LF         S+ + +  T           + E +I  +  E+L  L+ LH  +++H DIK +N+LL   G   L D+G     C+Q T  Q  +S + GT  ++APE++  K    K   DIWSLGI+ IEM+EG+
Sbjct:  200 KKYTRYEKIGQGASGTVYTAIDVSTGQEVAIKQINLQKQPKKELIINEILVMKEL--KNPNIVNFVDSFLVGDELFVVMEYLAGGSLTDVVTET----------CMDEAQIAAVCREVLQALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFG----FCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKV--DIWSLGIMAIEMVEGE 393          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: map3k4 (mitogen-activated protein kinase kinase kinase 4 [Source:NCBI gene;Acc:101174856])

HSP 1 Score: 84.3445 bits (207), Expect = 2.961e-16
Identity = 80/249 (32.13%), Postives = 118/249 (47.39%), Query Frame = 3
Query: 1245 QDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIF----NDSA---KSVREININEEIKYLELFPKYRGLMSYNKKI------CAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKL-AYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPG----TLG---YIAPELIN-GKPQSDKTKSDIWSLGIVIIEMMEGK 1925
            Q C  P      M + L ++T   K Q+ +KIG+G YGKVY     ++ +  A+K      ND     ++  E+ I E IK+  L  +Y G+  + +++      C   +L E S                  L  +  +I+L + +I   + VLH+  I+H DIK  NI L  SG   L D+GCS        L+ N   +PG    TLG   Y+APE+I   K +     +DIWSLG V+IEM+ GK
Sbjct: 1133 QVCHTPKSFDNVMHVGLRKVTF--KWQRGNKIGEGQYGKVYTCINVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLV-RYFGVELHREEMYIFMEYCDEGTLEEVSK-----------------LGLQEHVIRLYSKQITTAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCS------VKLRNNTHTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVLIEMVTGK 1355          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078507.1 (SMESG000078507.1)

HSP 1 Score: 1167.91 bits (3020), Expect = 0.000e+0
Identity = 613/679 (90.28%), Postives = 636/679 (93.67%), Query Frame = 3
Query:   63 MYWVKRENNDPIPVKRKKCLYVKDIIKYCLNEDYTPNQSFPPCELIYDRIILNHEKPLQFYKISSDKVIYMGPVEEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIYDINGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRYLIEKYFWYMNDSEEGWIKSXXXXXXXXXXXXXXXDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYNRRSWWDVSSMNDIIIKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEIKKIAQIFCGIDEDLIYFVNYDEQDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKS-DLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLK-ALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAFKDIQSA 2093
            MYWVKRENNDPIPVKRKKCLYVKDIIKYCLNEDYTPNQSFPPCELIYDRIILNHEKPLQFYKISSDKVIYMGP+EEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIY+INGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRYLIEKYFWY NDSEEGWIKSFNRFLNNNENRFYLRDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYNRRSWWDVSSMNDIIIKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEI KIAQIFCGIDEDLIYFVNYDEQD KDPI+ISANMTIHLEEMTRLKKEQKRDKIG+GSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKS+DNKIKITIRSNPNFRVPLISENEIIKLAYEIL ELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSK+IC+QT++ ++K  +  GT  Y APE+      SD  K+DIWSLGIVIIEM+EGKL+   K    IN K  L+F S  L+ IL KCL  +   R SA+ELL+L+ FKDIQ+ 
Sbjct:    1 MYWVKRENNDPIPVKRKKCLYVKDIIKYCLNEDYTPNQSFPPCELIYDRIILNHEKPLQFYKISSDKVIYMGPLEEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIYNINGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRYLIEKYFWYGNDSEEGWIKSFNRFLNNNENRFYLRDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYNRRSWWDVSSMNDIIIKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEINKIAQIFCGIDEDLIYFVNYDEQDLKDPIKISANMTIHLEEMTRLKKEQKRDKIGEGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSLDNKIKITIRSNPNFRVPLISENEIIKLAYEILKELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKLICNQTNIIVHKKPNSFGTQDYEAPEISKNNSYSD--KADIWSLGIVIIEMIEGKLNQYAK-DKNINFKFRLRFISENLRNILMKCLTNDMAARSSAEELLELEVFKDIQNT 676          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078505.1 (SMESG000078505.1)

HSP 1 Score: 709.523 bits (1830), Expect = 0.000e+0
Identity = 407/685 (59.42%), Postives = 499/685 (72.85%), Query Frame = 3
Query:   63 MYWVKRENNDPIPVKRKKCLYVKDIIKYCLNEDYTPNQSFPPCELIYDRIILNHEKPLQFYKISSDKVIYMGPVEEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIYDINGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRYLIEKYFWYMNDSEEGWIKSXXXXXXXXXXXXXXXDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYN-----RRSWWDVSSMNDIIIKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEIKKIAQIFCGIDEDLIYFVNYDEQDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLKALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAFKDIQSATTQ 2102
            MY V+ ENN    +K +   YV DI+KY  ++    N+  P  ELIY+ +ILN EK LQFYKI   K IYMG VE Y+  S  GDKD DV VEVVVQC  SESIFLIMKQN  I +V EI+ARL +IS L    DIN             +K+DS +IFISWTP+YLH  YNR LIEKYFW   DS +GWIK+ ++ +   +       FK +LE +   +S ++   L+ +   S+ YFCK+YSE F KE E++WK  IK+ +DF VIY +IR+ IFI L +  N      + W    S + I+I+ L+LLL+ +  G+  ++KF+KHV +GE++ E +E++I+ YF  YG LK+KM KSTE +++PL E+S F++KKIAQI CGI++DL+YFVNYDE+D   PI I+ +MTIH EEM RLKKEQ   KIG GSYG+VY  KEAN D +F IK F    +SVREININEEIKY +L   YRGLM Y+++IC AFSLFE+S+D KIK   + +        +E +I+++AYEIL ELK LHKW+I+H DIKPENILLDK+GRATLCDYGCSKVICSQTSLQINKSDL GTLGYIAPELI GKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINL+ALQFKSVKLKKILKKCL T+PD+RLSAKELLQLDAFKDIQSATTQ
Sbjct:    1 MYSVRTENNILKELKIESFYYVNDIVKYFSDKYSNSNRRLPHFELIYENMILNREKHLQFYKICQFKEIYMGSVEGYM--SRFGDKDQDVIVEVVVQCFLSESIFLIMKQNYEISEVTEILARLTQISGLLEKDDINRIPE---------VKRDSGKIFISWTPEYLHEGYNRNLIEKYFWNGGDSVDGWIKTSDKIIKIIKKDLQA--FKKHLESHPK-DSLIHNTPLSKVVRRSKSYFCKWYSESFDKECEEEWKSKIKDDSDFTVIYSYIRIAIFIVLHKECNLNPPFHKCWPKTDSFDAILIQALKLLLKKN-SGKSIMKKFVKHVSMGEMTREIMEDKIDKYFLQYGVLKVKMIKSTENLRIPLEEISFFQLKKIAQITCGIEKDLLYFVNYDERDLNIPIRITEHMTIHFEEMKRLKKEQMIRKIGNGSYGEVYQCKEANFDGQFVIKRFIVPEESVREININEEIKYFKLLSNYRGLMRYDREICVAFSLFEESLDKKIKSYCQKSEE------NEKKILRVAYEILKELKELHKWEIIHRDIKPENILLDKNGRATLCDYGCSKVICSQTSLQINKSDLAGTLGYIAPELIKGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLEALQFKSVKLKKILKKCLKTDPDKRLSAKELLQLDAFKDIQSATTQ 664          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078505.1 (SMESG000078505.1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 388/636 (61.01%), Postives = 472/636 (74.21%), Query Frame = 3
Query:  210 IILNHEKPLQFYKISSDKVIYMGPVEEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIYDINGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRYLIEKYFWYMNDSEEGWIKSXXXXXXXXXXXXXXXDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYN-----RRSWWDVSSMNDIIIKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEIKKIAQIFCGIDEDLIYFVNYDEQDCKDPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLKALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAFKDIQSATTQ 2102
            +ILN EK LQFYKI   K IYMG VE Y+  S  GDKD DV VEVVVQC  SESIFLIMKQN  I +V EI+ARL +IS L    DIN             +K+DS +IFISWTP+YLH  YNR LIEKYFW   DS +GWIK+ ++ +   +       FK +LE +   +S ++   L+ +   S+ YFCK+YSE F KE E++WK  IK+ +DF VIY +IR+ IFI L +  N      + W    S + I+I+ L+LLL+ +  G+  ++KF+KHV +GE++ E +E++I+ YF  YG LK+KM KSTE +++PL E+S F++KKIAQI CGI++DL+YFVNYDE+D   PI I+ +MTIH EEM RLKKEQ   KIG GSYG+VY  KEAN D +F IK F    +SVREININEEIKY +L   YRGLM Y+++IC AFSLFE+S+D KIK   + +        +E +I+++AYEIL ELK LHKW+I+H DIKPENILLDK+GRATLCDYGCSKVICSQTSLQINKSDL GTLGYIAPELI GKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINL+ALQFKSVKLKKILKKCL T+PD+RLSAKELLQLDAFKDIQSATTQ
Sbjct:    1 MILNREKHLQFYKICQFKEIYMGSVEGYM--SRFGDKDQDVIVEVVVQCFLSESIFLIMKQNYEISEVTEILARLTQISGLLEKDDINRIPE---------VKRDSGKIFISWTPEYLHEGYNRNLIEKYFWNGGDSVDGWIKTSDKIIKIIKKDLQA--FKKHLESHPK-DSLIHNTPLSKVVRRSKSYFCKWYSESFDKECEEEWKSKIKDDSDFTVIYSYIRIAIFIVLHKECNLNPPFHKCWPKTDSFDAILIQALKLLLKKN-SGKSIMKKFVKHVSMGEMTREIMEDKIDKYFLQYGVLKVKMIKSTENLRIPLEEISFFQLKKIAQITCGIEKDLLYFVNYDERDLNIPIRITEHMTIHFEEMKRLKKEQMIRKIGNGSYGEVYQCKEANFDGQFVIKRFIVPEESVREININEEIKYFKLLSNYRGLMRYDREICVAFSLFEESLDKKIKSYCQKSEE------NEKKILRVAYEILKELKELHKWEIIHRDIKPENILLDKNGRATLCDYGCSKVICSQTSLQINKSDLAGTLGYIAPELIKGKPQSDKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLEALQFKSVKLKKILKKCLKTDPDKRLSAKELLQLDAFKDIQSATTQ 615          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078509.1 (SMESG000078509.1)

HSP 1 Score: 241.891 bits (616), Expect = 3.963e-75
Identity = 140/204 (68.63%), Postives = 162/204 (79.41%), Query Frame = 3
Query: 1500 MSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKVICSQTSLQIN-KSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLSS-----DIKFSHKINLKALQFXXXXXXXXXXXXXNTNPDERLSAKELLQLDAFKDIQSA 2093
            MSYNKKICAAF LFEKS+DNKIKITIRSNPNFRVPLISENEIIKLAYEIL ELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSK+IC+QT++ ++ K +  GT  Y APE+      SD  K+DIWSLGIVIIEM+EGKL+      +I F+ +     L+F S  L+ IL KCL T+P  R SA+ELL+L+ FKDIQ+ 
Sbjct:    1 MSYNKKICAAFLLFEKSLDNKIKITIRSNPNFRVPLISENEIIKLAYEILKELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSKLICNQTNIIVHKKPNSFGTQDYEAPEISENNSYSD--KADIWSLGIVIIEMIEGKLNQYAKDKNINFAFR-----LRFISENLRNILMKCLITDPAARSSAEELLELEVFKDIQNT 197          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000003013.1 (SMESG000003013.1)

HSP 1 Score: 143.28 bits (360), Expect = 2.984e-35
Identity = 170/662 (25.68%), Postives = 304/662 (45.92%), Query Frame = 3
Query:  183 PPCELIYDRIILNHEKPLQFYKISSDKVIYMGPVEEYILKSGIGDKDPDVFVEVVVQCHYSESIFLIMKQNDNILKVKEIVARLIRISSLPGIYDINGFQLEDFIALSQILKKDSQRIFISWTPDYLHRDYNRY------LIEKYFWYMNDSEEGWIKSXXXXXXXXXXXXXXXDFKTYLERNRNCNSSLNRKSLN--ALFETSEFYFCKYYSEFFYKEIEQKWKCHIKNVA--------DFPVIYYFIRLGIFIALQEYYNRRSWWDVSSMNDIIIKGLELLLQ--NDQG--GEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLKIKMTKSTEFIKVPLGEMSLFEIKKIAQIFCGIDEDLIYFVNYDEQDCK--DPIEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKIFNDSAKSV-REININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNKIKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENILLDKSGRATLCDYGCSK--VICSQTSLQIN-KSDLPGTLGYIAPELINGKPQSDKTKSDIWSLGIVIIEMMEGKLS-SDIK---FSHKINLKALQFXXXXXXXXXXX-----XXNTNPDERLSAKELLQ 2063
             P  LIY+ IILN  + +++YKI+ +K I+   +E Y+ +  I        VE+ +     + I LI+K  D I  +K ++  ++  + +  I+++NG  L    +++           I    D +  +++++       I   +W      +GWI+      + +     +  +K  L  +   +  L +  L+    F  S +  C+Y SE+ Y   +   K   +++         DF  I+  I+  I  +++      +  D  S+  I+  G++ L+   ND    G ++++ ++        S     N+I   F  Y ++KI + +    I VP    ++ ++K    +  G   D +Y V     D K  D   I       +E +      Q    +GKGS+G V+ + +  +     +K  + S + + R+I+I   I+  E F     L+  N  IC  F++   S+   +K  + +   F      E++I K++Y+IL +++ +HK  I+H DIK ENI+LD+   A L D+G SK  V  SQTSL+   K   PGT+ Y+APEL+  KP ++K   DIWS GIV++EM  G +  SD+    F   I  K +++K+               L  +P+ER SAK+L++
Sbjct:   28 APYFLIYNDIILNDNRVIEYYKINPNKKIFAAKLENYLQRDHI-------VVEIFIMRFNPDRIHLIVKPCDTIAHIKLLLENIV--ADISNIWNMNGQLLAGNQSVADTANNGIDLKLIILCGDQIDIEFDKFCKIHDQFILYNYWRKYIFYDGWIRGDLFNSDRDILMALVDKWKLILLSDFTIDCKLEKNFLHFPVGFLNSRWLACEYLSEYIYGICDDYLKLVKQDIRLDGNSGFRDF--IFDAIQCSILNSIKFRTADTAGID-KSIRTILTNGIDYLMNFINDPSFNGRYWMKLYVDEFMFAP-SNTVDMNDIT--FDTYSDVKIHIDQCKYDITVPSTVETVIQLKNAISMLTGFPSDQMYLVKRG-GDVKPDDNDRIDGIYNYFVEIINSFDCLQDETSLGKGSFGTVFKYVDKETKSSIILKEQHLSNEDLYRDISIQSLIERSERFINRNRLIDKNGHIC--FTMDYMSL-GSLKSLLETKKYF-----PEDQIAKISYQILKQIEYIHKRYIIHRDIKSENIVLDEHYNAKLIDFGLSKFTVGLSQTSLEERLKIYAPGTVLYMAPELLMDKPYTNKI--DIWSFGIVMVEMATGNVPYSDLPQPVFIRNIKTKPIKYKASFHLSEELTNFIDCALKKDPNERFSAKQLIE 663          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDKL37.644e-1933.33cyclin dependent kinase like 3 [Source:HGNC Symbol... [more]
CDKL31.596e-1833.48cyclin dependent kinase like 3 [Source:HGNC Symbol... [more]
CDKL31.974e-1833.48cyclin dependent kinase like 3 [Source:HGNC Symbol... [more]
STK361.160e-1729.19serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
MAP3K41.804e-1632.51mitogen-activated protein kinase kinase kinase 4 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdkl-13.018e-1628.84Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
cdkl-14.002e-1628.84Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
air-12.624e-1527.32Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-12.624e-1527.32Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
cdkl-12.820e-1528.84Cyclin-dependent kinase-like 1 [Source:UniProtKB/... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG72364.187e-1727.19gene:FBgn0031730 transcript:FBtr0302950[more]
CG72366.000e-1726.67gene:FBgn0031730 transcript:FBtr0343387[more]
CG72367.829e-1727.73gene:FBgn0031730 transcript:FBtr0343388[more]
CG72368.750e-1727.73gene:FBgn0031730 transcript:FBtr0343389[more]
Pak1.353e-1531.13gene:FBgn0267698 transcript:FBtr0334539[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nek11.402e-1631.78NIMA-related kinase 1 [Source:ZFIN;Acc:ZDB-GENE-04... [more]
si:ch211-1i11.32.974e-1629.55si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
si:ch211-1i11.33.117e-1629.55si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
map3k43.847e-1632.10mitogen-activated protein kinase kinase kinase 4 [... [more]
si:ch211-1i11.34.819e-1629.55si:ch211-1i11.3 [Source:ZFIN;Acc:ZDB-GENE-030131-8... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ephb12.435e-1631.69EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626... [more]
ephb12.651e-1631.69EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626... [more]
ephb12.921e-1631.69EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626... [more]
ephb12.997e-1631.69EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626... [more]
ephb13.067e-1631.69EPH receptor B1 [Source:Xenbase;Acc:XB-GENE-488626... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdkl37.947e-2033.48cyclin-dependent kinase-like 3 [Source:MGI Symbol;... [more]
Cdkl37.947e-2033.48cyclin-dependent kinase-like 3 [Source:MGI Symbol;... [more]
Cdkl34.103e-1933.48cyclin-dependent kinase-like 3 [Source:MGI Symbol;... [more]
Cdkl31.005e-1833.48cyclin-dependent kinase-like 3 [Source:MGI Symbol;... [more]
Cdkl31.005e-1833.48cyclin-dependent kinase-like 3 [Source:MGI Symbol;... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JM01|CDKL3_RAT6.395e-1833.48Cyclin-dependent kinase-like 3 OS=Rattus norvegicu... [more]
sp|Q8IVW4|CDKL3_HUMAN7.663e-1833.48Cyclin-dependent kinase-like 3 OS=Homo sapiens OX=... [more]
sp|Q8BLF2|CDKL3_MOUSE8.891e-1833.48Cyclin-dependent kinase-like 3 OS=Mus musculus OX=... [more]
sp|Q4R8T9|CDKL3_MACFA1.026e-1733.48Cyclin-dependent kinase-like 3 OS=Macaca fascicula... [more]
sp|O59790|ARK1_SCHPO4.327e-1729.46Serine/threonine-protein kinase ark1 OS=Schizosacc... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D2NI393.212e-1932.69Serine/threonine-protein kinase 36 (Fragment) OS=O... [more]
W4K4N45.426e-1928.89Protein kinase domain-containing protein OS=Hetero... [more]
A0A2D4CJE26.081e-1932.51ULK/FUSED protein kinase OS=Pythium insidiosum OX=... [more]
F8PWA76.619e-1928.57Protein kinase domain-containing protein OS=Serpul... [more]
A0CLD67.076e-1930.15Uncharacterized protein OS=Paramecium tetraurelia ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000033332.17.492e-1828.44cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000057054.13.326e-1728.44cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
ENSAMXT00000052448.13.326e-1728.44cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
pak12.574e-1632.38p21 protein (Cdc42/Rac)-activated kinase 1 [Source... [more]
map3k155.590e-1631.90mitogen-activated protein kinase kinase kinase 15 ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k26.787e-1731.78mitogen-activated protein kinase kinase kinase 2 [... [more]
STK361.416e-1630.20serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
ENSPMAT00000007414.15.598e-1632.85pep scaffold:Pmarinus_7.0:GL476981:230882:244405:1... [more]
pak48.316e-1530.39p21 protein (Cdc42/Rac)-activated kinase 4 [Source... [more]
ENSPMAT00000004683.12.237e-1433.12pep scaffold:Pmarinus_7.0:GL488517:199:5283:1 gene... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MKK17.776e-1933.01MAPKK involved in the protein kinase C signaling p... [more]
MKK22.244e-1730.39MAPKK involved in the protein kinase C signaling p... [more]
TPK22.300e-1730.19cAMP-dependent protein kinase catalytic subunit; p... [more]
KSS13.714e-1730.14Mitogen-activated protein kinase (MAPK); involved ... [more]
PHO851.051e-1528.24Cyclin-dependent kinase; has ten cyclin partners; ... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354021.898e-1828.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496903.205e-1730.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498223.261e-1732.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380621.514e-1628.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461853.786e-1632.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001547.21.171e-1928.97cyclin-dependent kinase-like 1 [Source:NCBI gene;A... [more]
si:ch211-1i11.31.351e-1631.62mitogen-activated protein kinase kinase kinase 5 [... [more]
si:ch211-1i11.31.433e-1631.62mitogen-activated protein kinase kinase kinase 5 [... [more]
ENSORLT00000015480.22.845e-1631.13serine/threonine-protein kinase PAK 2 [Source:NCBI... [more]
map3k42.961e-1632.13mitogen-activated protein kinase kinase kinase 4 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078507.10.000e+090.28SMESG000078507.1[more]
SMESG000078505.10.000e+059.42SMESG000078505.1[more]
SMESG000078505.10.000e+061.01SMESG000078505.1[more]
SMESG000078509.13.963e-7568.63SMESG000078509.1[more]
SMESG000003013.12.984e-3525.68SMESG000003013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30005629 ID=SMED30005629|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2258bp
CTGATATATTACATTGTCAATAGGTTGTGAGATCACAATAAAATATTTGA
TCTCAATTTATAATGTATTGGGTGAAGAGAGAAAATAATGACCCCATACC
AGTAAAAAGAAAGAAATGCCTTTATGTGAAAGATATCATTAAGTATTGCC
TTAATGAAGACTACACCCCCAATCAGAGTTTTCCCCCATGTGAGTTGATA
TATGACAGAATCATATTGAATCATGAGAAACCTTTGCAATTTTATAAAAT
AAGTTCTGATAAAGTTATTTATATGGGTCCTGTGGAAGAATATATCTTAA
AGTCTGGTATTGGAGATAAAGATCCGGACGTCTTTGTCGAGGTTGTGGTA
CAATGTCATTACTCAGAATCTATTTTCTTAATAATGAAACAAAATGATAA
CATATTAAAGGTAAAAGAAATTGTAGCTAGATTGATTAGGATTTCTAGCT
TACCTGGAATATATGACATCAATGGATTCCAATTGGAAGATTTCATTGCG
CTGTCTCAAATATTAAAGAAAGATTCGCAAAGAATATTCATAAGCTGGAC
TCCTGACTACCTCCATAGAGATTATAATCGGTATTTAATAGAAAAGTATT
TTTGGTACATGAACGATTCAGAGGAAGGATGGATCAAGTCTTTCAACAGG
TTCTTAAATAATAATGAAAACAGATTTTACCTTAGAGATTTCAAAACTTA
CCTGGAAAGAAACAGGAATTGTAATTCTAGCCTGAACAGAAAATCATTGA
ATGCACTTTTTGAAACGTCCGAATTCTACTTTTGCAAATATTATTCCGAG
TTTTTCTATAAAGAAATTGAACAAAAATGGAAATGTCATATAAAAAATGT
TGCTGACTTCCCAGTGATCTATTACTTCATTCGGCTTGGGATATTCATCG
CGTTGCAGGAATATTACAATAGGCGCTCTTGGTGGGATGTTAGTTCAATG
AATGATATTATAATAAAAGGTCTGGAACTTTTGCTTCAAAATGATCAAGG
AGGAGAGTTCTTTATACAAAAATTTATAAAGCACGTTTGCGTTGGAGAGA
TATCAGGAGAATATTTGGAAAACGAAATTGAAAATTATTTTCATTATTAT
GGAAATCTCAAAATAAAAATGACAAAATCAACGGAGTTTATAAAGGTTCC
ACTAGGAGAAATGAGTCTATTTGAAATCAAGAAAATTGCGCAAATATTTT
GCGGAATAGATGAAGATTTGATATATTTTGTTAATTACGATGAGCAAGAT
TGTAAAGATCCCATAGAAATATCGGCAAACATGACAATTCATTTGGAAGA
AATGACAAGGTTAAAAAAAGAGCAAAAGAGAGACAAAATTGGAAAGGGGT
CTTATGGGAAAGTTTATCTGTTTAAAGAAGCTAATTCTGATGACAAATTT
GCTATCAAAATATTTAATGATTCGGCAAAAAGCGTCCGAGAAATTAATAT
AAATGAAGAAATAAAATATTTGGAATTGTTTCCAAAGTATCGCGGGTTGA
TGAGCTATAACAAAAAGATCTGTGCCGCATTCTCCTTATTTGAAAAATCG
ATGGACAACAAAATAAAAATAACTATTAGAAGTAATCCTAATTTTCGAGT
TCCTCTAATTAGCGAAAATGAGATTATTAAGTTGGCATACGAAATCCTCA
TAGAATTGAAAGTGCTCCACAAATGGAAAATTCTTCATCTCGATATAAAA
CCCGAAAATATTCTGTTGGATAAAAGTGGAAGGGCTACCCTATGTGATTA
TGGTTGCTCAAAAGTGATTTGTAGTCAAACAAGTTTACAAATAAATAAAT
CAGATTTACCTGGTACTCTGGGCTATATAGCTCCGGAATTAATAAATGGC
AAGCCACAATCAGACAAAACCAAAAGCGACATTTGGTCGCTTGGCATTGT
AATAATCGAAATGATGGAAGGAAAATTATCGAGTGATATAAAATTCTCCC
ATAAAATCAACCTAAAAGCTTTGCAGTTTAAATCCGTAAAACTAAAAAAG
ATTTTAAAGAAATGTCTAAATACTAATCCGGATGAAAGATTATCTGCCAA
AGAACTTCTACAACTGGACGCTTTCAAGGATATTCAAAGCGCTACAACAC
AATAAAACCAAATTGTTTTGATTTTAGAGCCTCAAATTGTTTTTCTTCCA
TACAACAAGAAATGCAGTCTCTCTGTGTTCTAAAATTGAAAAGTTGATTA
TCTTAGTGATGCACAGATGAGCCTTGTGCACGCGAAACGAATAAACAGCG
CATTTTTT
back to top

protein sequence of SMED30005629-orf-1

>SMED30005629-orf-1 ID=SMED30005629-orf-1|Name=SMED30005629-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=681bp
MYWVKRENNDPIPVKRKKCLYVKDIIKYCLNEDYTPNQSFPPCELIYDRI
ILNHEKPLQFYKISSDKVIYMGPVEEYILKSGIGDKDPDVFVEVVVQCHY
SESIFLIMKQNDNILKVKEIVARLIRISSLPGIYDINGFQLEDFIALSQI
LKKDSQRIFISWTPDYLHRDYNRYLIEKYFWYMNDSEEGWIKSFNRFLNN
NENRFYLRDFKTYLERNRNCNSSLNRKSLNALFETSEFYFCKYYSEFFYK
EIEQKWKCHIKNVADFPVIYYFIRLGIFIALQEYYNRRSWWDVSSMNDII
IKGLELLLQNDQGGEFFIQKFIKHVCVGEISGEYLENEIENYFHYYGNLK
IKMTKSTEFIKVPLGEMSLFEIKKIAQIFCGIDEDLIYFVNYDEQDCKDP
IEISANMTIHLEEMTRLKKEQKRDKIGKGSYGKVYLFKEANSDDKFAIKI
FNDSAKSVREININEEIKYLELFPKYRGLMSYNKKICAAFSLFEKSMDNK
IKITIRSNPNFRVPLISENEIIKLAYEILIELKVLHKWKILHLDIKPENI
LLDKSGRATLCDYGCSKVICSQTSLQINKSDLPGTLGYIAPELINGKPQS
DKTKSDIWSLGIVIIEMMEGKLSSDIKFSHKINLKALQFKSVKLKKILKK
CLNTNPDERLSAKELLQLDAFKDIQSATTQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 393..546
e-value: 1.1E-14
score: 56.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 422..546
e-value: 3.7E-13
score: 49.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 420..546
score: 14.097
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 426..449
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 421..546